F446348

General Info

Members Datasets Scaffolds Average Seq Length
449 345 328 377

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100224053|Ga0070712_1002240532
Length 402
Sequence MQPSARLSLDRFRQLDHAPVSYGANAMKITGIRTHVLSAALSQPFAYSRAWYDTRTAMLVEIETDDGLIGWGECYGPAAMTAAVVNSVVPWLIGEDPLRTDFLWRMIYARLRDHGQKGVVIEGLSGIDIALWDIKGKHFGVPVYQLLGGPLRNEVQAYATGLYRRKSGNPLRYLAEEAAGYVVDGFKAVKLKVGFGVAEDAAVTRAVREAIGPDIALMVDANHAYDASAAIRLGRMIEAHDIGWFEEPVPPEDVSGYQAVKAALAIPIAGGECEFTRFGFRNLLVSRAVDIVQPDTCAAGGLSECKKIADMAEAFGTRYNPHVWGTGIAIAASLQLLAVLPTHTPNSLAPIAPMLEFDRTEHPIRQAILTRPLEPADGTIRVPDGPGLGIEVDRAALARFSA

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
6 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
7 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
8 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
9 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
10 2791355199
11 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
12 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
13 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
14 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
15 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
16 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
17 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
18 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
19 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
20 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
21 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
22 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
23 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
24 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
25 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
26 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
27 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
28 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
29 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
30 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
31 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
32 2922368715
33 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
34 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
35 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
36 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
37 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
38 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
39 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
40 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
41 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
42 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
43 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
44 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
45 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
46 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
47 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
48 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
49 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
50 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
51 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
52 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
53 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
54 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
55 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
56 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
57 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
58 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
59 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
60 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
61 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
62 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
63 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
64 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
65 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
66 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
67 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
68 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
69 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
70 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
71 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
72 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
73 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
74 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
75 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
76 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
77 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
78 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
79 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
80 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
81 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
82 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
83 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
84 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
85 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
86 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
87 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
88 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
89 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
90 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
91 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
92 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
93 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
95 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
96 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
97 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
98 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
99 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
100 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
101 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
102 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
103 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
104 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
105 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
106 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
107 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
108 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
109 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
110 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
111 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
112 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
113 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
114 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
115 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
116 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
117 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
118 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
119 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
120 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
121 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
122 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
123 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
124 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
125 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
126 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
127 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
128 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
129 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
130 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
131 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
132 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
133 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
134 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
135 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
136 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
137 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
138 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
156 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
157 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
158 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
159 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
201 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
202 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
203 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
231 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
237 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
249 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
250 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
255 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
291 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
301 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
302 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
305 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
308 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
309 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
310 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
311 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
312 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
313 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
314 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
315 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
316 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
317 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
318 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
319 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
320 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
322 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
323 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
324 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
325 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
326 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
327 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
328 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
329 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
330 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
331 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
332 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
333 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
334 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
335 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
336 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
337 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
338 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
339 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
340 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
341 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
342 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
343 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
344 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
345 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.38
Metatranscriptomes 0
Isolates 26.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.46
Nodule 25.61
Rhizoplane 5.79
Rhizosphere 52.12
Stem 0
Stem Tuber 0
Unclassified 8.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1004506 3300000549 Bacteria 1810
2 JGI25406J46586_10001296 3300003203 Bacteria 11767
3 JGI25153J46596_10035274 3300003215 Bacteria 1622
4 Ga0065165_1020424 3300005262 Bacteria 2330
5 Ga0070683_100001874 3300005329 Bacteria 16425
6 Ga0070683_100045473 3300005329 Bacteria 4051
7 Ga0070690_100162825 3300005330 Bacteria 1530
8 Ga0070677_10019508 3300005333 Bacteria 2457
9 Ga0070680_100003676 3300005336 Bacteria 11456
10 Ga0070682_100006000 3300005337 Bacteria 6800
11 Ga0068868_100054694 3300005338 Bacteria 3147
12 Ga0070689_100029500 3300005340 Bacteria 4153
13 Ga0070668_100106152 3300005347 Bacteria 2231
14 Ga0070671_100009647 3300005355 Bacteria 7755
15 Ga0070674_100002871 3300005356 Bacteria 9524
16 Ga0070673_100026051 3300005364 Bacteria 4313
17 Ga0070673_100057026 3300005364 Bacteria 3085
18 Ga0070709_10036848 3300005434 Bacteria 2983
19 Ga0070713_100085165 3300005436 Bacteria 2707
20 Ga0070710_10112519 3300005437 Bacteria 1637
21 Ga0070711_100047974 3300005439 Bacteria 2918
22 Ga0070678_100006657 3300005456 Bacteria 6796
23 Ga0070678_100009672 3300005456 Bacteria 5855
24 Ga0070678_100087923 3300005456 Bacteria 2374
25 Ga0070681_10001873 3300005458 Bacteria 18987
26 Ga0070681_10146946 3300005458 Bacteria 2286
27 Ga0070681_10446618 3300005458 Bacteria 1205
28 Ga0068867_100085436 3300005459 Bacteria 2385
29 Ga0070707_100255290 3300005468 Bacteria 1706
30 Ga0070698_100206960 3300005471 Bacteria 1897
31 Ga0070679_100002797 3300005530 Bacteria 15857
32 Ga0070679_100100678 3300005530 Bacteria 2875
33 Ga0070679_100167872 3300005530 Bacteria 2168
34 Ga0070684_100008931 3300005535 Bacteria 7867
35 Ga0070665_100045036 3300005548 Bacteria 4430
36 Ga0070665_100374245 3300005548 Bacteria 1431
37 Ga0068855_100288784 3300005563 Bacteria 1819
38 Ga0068866_10118086 3300005718 Unclassified 1490
39 Ga0068861_100141120 3300005719 Bacteria 1966
40 Ga0068858_100154404 3300005842 Bacteria 2159
41 Ga0068862_100033846 3300005844 Bacteria 4322
42 Ga0081455_10004153 3300005937 Bacteria 16343
43 Ga0081455_10053509 3300005937 Bacteria 3448
44 Ga0081455_10122901 3300005937 Bacteria 2043
45 Ga0081540_1005374 3300005983 Bacteria 9579
46 Ga0081540_1006622 3300005983 Bacteria 8401
47 Ga0081540_1029863 3300005983 Bacteria 3029
48 Ga0081539_10000350 3300005985 Bacteria 101255
49 Ga0075365_10000815 3300006038 Bacteria 12843
50 Ga0075365_10070614 3300006038 Bacteria 2349
51 Ga0075365_10088357 3300006038 Bacteria 2108
52 Ga0075365_10148590 3300006038 Bacteria 1629
53 Ga0075368_10001452 3300006042 Bacteria 7584
54 Ga0075368_10018965 3300006042 Bacteria 2592
55 Ga0070712_100063784 3300006175 Bacteria 2610
56 Ga0070712_100070437 3300006175 Bacteria 2498
57 Ga0070712_100224053 3300006175 Bacteria 1490
58 Ga0075362_10018906 3300006177 Bacteria 2859
59 Ga0075367_10064301 3300006178 Bacteria 2194
60 Ga0075369_10021241 3300006186 Bacteria 2665
61 Ga0075370_10084661 3300006353 Bacteria 1825
62 Ga0075370_10116431 3300006353 Bacteria 1554
63 Ga0075428_100003201 3300006844 Bacteria 17902
64 Ga0075428_100430849 3300006844 Bacteria 1413
65 Ga0075433_10033814 3300006852 Bacteria 4385
66 Ga0068865_100117214 3300006881 Bacteria 1974
67 Ga0099824_1007458 3300006942 Bacteria 14473
68 Ga0099822_1019645 3300006943 Bacteria 6840
69 Ga0099822_1042043 3300006943 Bacteria 2415
70 Ga0105240_10081044 3300009093 Bacteria 3990
71 Ga0111539_10001837 3300009094 Bacteria 28233
72 Ga0111539_10057305 3300009094 Bacteria 4627
73 Ga0111539_10172637 3300009094 Bacteria 2526
74 Ga0105245_10155464 3300009098 Bacteria 2166
75 Ga0105241_10038032 3300009174 Bacteria 3628
76 Ga0105237_10060254 3300009545 Bacteria 3798
77 Ga0105237_10073458 3300009545 Bacteria 3412
78 Ga0105237_10104392 3300009545 Bacteria 2826
79 Ga0105238_10190146 3300009551 Bacteria 2029
80 Ga0105239_10231368 3300010375 Bacteria 2073
81 Ga0105246_10014157 3300011119 Bacteria 5012
82 Ga0105246_10317818 3300011119 Bacteria 1264
83 Ga0157369_10004167 3300013105 Bacteria 17131
84 Ga0157369_10027253 3300013105 Bacteria 6336
85 Ga0157369_10273916 3300013105 Bacteria 1758
86 Ga0157374_10063013 3300013296 Bacteria 3477
87 Ga0157374_10087636 3300013296 Bacteria 2964
88 Ga0163162_10200112 3300013306 Bacteria 2126
89 Ga0157375_10043838 3300013308 Bacteria 4341
90 Ga0157375_10045375 3300013308 Bacteria 4277
91 Ga0157375_10248374 3300013308 Bacteria 1940
92 Ga0163163_10031684 3300014325 Bacteria 5104
93 Ga0163163_10038386 3300014325 Bacteria 4668
94 Ga0157379_10105334 3300014968 Bacteria 2531
95 Ga0157376_10007978 3300014969 Bacteria 7597
96 Ga0163161_10075526 3300017792 Bacteria 2473
97 Ga0214544_1003153 3300021320 Bacteria 34430
98 Ga0214544_1006247 3300021320 Bacteria 22163
99 Ga0214542_1001978 3300021321 Bacteria 42477
100 Ga0214542_1002098 3300021321 Bacteria 41259
101 Ga0214542_1005215 3300021321 Bacteria 24970
102 Ga0214542_1007226 3300021321 Bacteria 19478
103 Ga0214543_1000066 3300021327 Bacteria 126288
104 Ga0214543_1004129 3300021327 Bacteria 27729
105 Ga0213876_10051624 3300021384 Bacteria 2173
106 Ga0213875_10007644 3300021388 Bacteria 5570
107 Ga0209233_1016706 3300025261 Bacteria 2016
108 Ga0209564_1001604 3300025295 Bacteria 22024
109 Ga0209758_1001198 3300025297 Bacteria 32768
110 Ga0207426_1000292 3300025302 Bacteria 99342
111 Ga0207682_10015034 3300025893 Bacteria 3014
112 Ga0207680_10045084 3300025903 Bacteria 2597
113 Ga0207699_10050077 3300025906 Bacteria 2462
114 Ga0207645_10097072 3300025907 Bacteria 1899
115 Ga0207705_10023490 3300025909 Bacteria 4398
116 Ga0207707_10001373 3300025912 Bacteria 22581
117 Ga0207707_10035462 3300025912 Bacteria 4362
118 Ga0207707_10393306 3300025912 Bacteria 1191
119 Ga0207695_10045295 3300025913 Bacteria 4670
120 Ga0207695_10155984 3300025913 Bacteria 2217
121 Ga0207671_10215059 3300025914 Unclassified 1504
122 Ga0207693_10017173 3300025915 Bacteria 5771
123 Ga0207693_10057272 3300025915 Bacteria 3054
124 Ga0207663_10069022 3300025916 Bacteria 2272
125 Ga0207657_10072992 3300025919 Bacteria 2901
126 Ga0207652_10310525 3300025921 Bacteria 1423
127 Ga0207694_10045216 3300025924 Bacteria 3401
128 Ga0207659_10065106 3300025926 Bacteria 2640
129 Ga0207659_10285680 3300025926 Bacteria 1350
130 Ga0207687_10098420 3300025927 Bacteria 2147
131 Ga0207700_10109871 3300025928 Bacteria 2217
132 Ga0207664_10421647 3300025929 Bacteria 1189
133 Ga0207644_10006453 3300025931 Bacteria 7644
134 Ga0207706_10019267 3300025933 Bacteria 6137
135 Ga0207669_10031312 3300025937 Bacteria 2970
136 Ga0207669_10270509 3300025937 Bacteria 1276
137 Ga0207704_10004149 3300025938 Bacteria 6605
138 Ga0207661_10000512 3300025944 Bacteria 25087
139 Ga0207667_10171339 3300025949 Bacteria 2231
140 Ga0207667_10181764 3300025949 Bacteria 2159
141 Ga0207667_10322432 3300025949 Bacteria 1578
142 Ga0207651_10005518 3300025960 Bacteria 6507
143 Ga0207651_10063364 3300025960 Bacteria 2581
144 Ga0207668_10050060 3300025972 Bacteria 2876
145 Ga0207668_10178376 3300025972 Bacteria 1673
146 Ga0207668_10203836 3300025972 Bacteria 1577
147 Ga0207640_10254271 3300025981 Bacteria 1365
148 Ga0207677_10040020 3300026023 Bacteria 3087
149 Ga0207703_10345003 3300026035 Bacteria 1370
150 Ga0207639_10026817 3300026041 Bacteria 4189
151 Ga0207678_10019008 3300026067 Bacteria 6036
152 Ga0207678_10048990 3300026067 Bacteria 3651
153 Ga0207678_10064930 3300026067 Bacteria 3136
154 Ga0207702_10065643 3300026078 Bacteria 3109
155 Ga0207702_10197292 3300026078 Bacteria 1864
156 Ga0207648_10124141 3300026089 Bacteria 2271
157 Ga0207676_10076147 3300026095 Bacteria 2710
158 Ga0207676_10118535 3300026095 Bacteria 2228
159 Ga0207675_100061586 3300026118 Bacteria 3502
160 Ga0207675_100086167 3300026118 Bacteria 2949
161 Ga0207683_10034074 3300026121 Bacteria 4425
162 Ga0207683_10056565 3300026121 Bacteria 3441
163 Ga0207683_10158379 3300026121 Bacteria 2046
164 Ga0207698_10044572 3300026142 Bacteria 3334
165 Ga0209389_1000024 3300027296 Bacteria 150002
166 Ga0209589_1003796 3300027357 Bacteria 26331
167 Ga0209589_1005115 3300027357 Bacteria 22395
168 Ga0209489_100052 3300027361 Bacteria 150002
169 Ga0209813_10000399 3300027866 Bacteria 10715
170 Ga0207428_10008351 3300027907 Bacteria 9355
171 Ga0268266_10031546 3300028379 Bacteria 4501
172 Ga0268266_10128919 3300028379 Bacteria 2261
173 Ga0268266_10307520 3300028379 Bacteria 1480
174 Ga0268265_10189816 3300028380 Bacteria 1773
175 Ga0265327_10004333 3300031251 Bacteria 12648
176 Ga0265313_10057963 3300031595 Bacteria 1826
177 Ga0307516_10065839 3300031730 Bacteria 3498
178 Ga0316577_10112697 3300031733 Bacteria 1526
179 Ga0307407_10093963 3300031903 Bacteria 1845
180 Ga0307411_10270859 3300032005 Bacteria 1346
181 Ga0307510_10003194 3300033180 Bacteria 19031
182 Ga0373923_0027683 3300035111 Bacteria 2262
183 Ga0373936_0082045 3300035113 Bacteria 1343
184 Ga0373945_0009771 3300035116 Bacteria 3148
185 Ga0373954_0019248 3300035118 Bacteria 3078
186 Ga0373954_0115178 3300035118 Bacteria 1302
187 Ga0373946_0018711 3300035171 Bacteria 2662
188 Ga0373955_0105907 3300035172 Bacteria 1620
189 Ga0373955_0182429 3300035172 Bacteria 1246
190 Ga0373935_0104078 3300035692 Bacteria 1875
191 Ga0373927_0103855 3300035695 Bacteria 1849
192 Ga0395900_0002386 3300037418 Bacteria 20745
193 Ga0395898_0016285 3300037466 Bacteria 7608
194 Ga0395898_0019202 3300037466 Bacteria 6959
195 Ga0395905_0004620 3300037471 Bacteria 14248
196 Ga0436364_0248881 3300037853 Bacteria 2905
197 Ga0436364_0431342 3300037853 Bacteria 1603
198 Ga0436364_1273206 3300037853 Bacteria 77554
199 Ga0436365_1256094 3300039437 Bacteria 14655
200 Ga0436365_1696728 3300039437 Bacteria 1876
201 Ga0436360_0347114 3300039438 Bacteria 1786
202 Ga0436361_1093097 3300039447 Bacteria 2743
203 Ga0451577_0092182 3300042876 Bacteria 2705
204 Ga0466966_0005443 3300044684 Bacteria 8370
205 Ga0466961_0000005 3300044693 Bacteria 173105
206 Ga0466961_0051971 3300044693 Bacteria 2616
207 Ga0453684_0010690 3300044712 Bacteria 15611
208 Ga0466959_0000670 3300045049 Bacteria 20009
209 Ga0466967_0189250 3300045976 Bacteria 1944
210 Ga0495592_0024959 3300046454 Bacteria 4541
211 Ga0495592_0094167 3300046454 Bacteria 2144
212 Ga0495592_0230816 3300046454 Bacteria 1232
213 Ga0495603_0063652 3300046455 Bacteria 2176
214 Ga0495641_0047695 3300046461 Bacteria 1966
215 Ga0495651_0013345 3300046462 Bacteria 6356
216 Ga0495651_0076548 3300046462 Bacteria 2534
217 Ga0495653_0110125 3300046463 Bacteria 1980
218 Ga0495639_0015814 3300046475 Bacteria 3272
219 Ga0495664_0074955 3300046477 Bacteria 2024
220 Ga0495608_0010208 3300046511 Bacteria 6554
221 Ga0495610_0075781 3300046512 Bacteria 1557
222 Ga0495628_0032324 3300046516 Bacteria 4225
223 Ga0495628_0151911 3300046516 Bacteria 1763
224 Ga0495630_0081798 3300046517 Bacteria 2437
225 Ga0495666_0044930 3300046526 Bacteria 2132
226 Ga0495652_0011068 3300046529 Bacteria 8174
227 Ga0495652_0110738 3300046529 Bacteria 2208
228 Ga0495665_0074743 3300046531 Bacteria 1784
229 Ga0495640_0028164 3300046533 Bacteria 4047
230 Ga0495621_0010893 3300046539 Bacteria 2797
231 Ga0495645_0006653 3300046543 Bacteria 8029
232 Ga0495645_0047674 3300046543 Bacteria 3121
233 Ga0495667_0013229 3300046559 Bacteria 5588
234 Ga0495634_0072371 3300046642 Bacteria 2267
235 Ga0495611_0031362 3300046648 Bacteria 2339
236 Ga0495625_0275743 3300046660 Bacteria 1084
237 Ga0495635_0036638 3300046663 Bacteria 3399
238 Ga0495635_0062636 3300046663 Bacteria 2554
239 Ga0495661_0119560 3300046665 Bacteria 1457
240 Ga0495588_0007702 3300046674 Bacteria 4918
241 Ga0495657_0184458 3300046675 Bacteria 1278
242 Ga0495599_0003706 3300046678 Bacteria 8956
243 Ga0495646_0069240 3300046680 Bacteria 2082
244 Ga0495613_0194532 3300046689 Bacteria 1432
245 Ga0495649_0005466 3300046694 Bacteria 8073
246 Ga0495600_0041009 3300046809 Bacteria 3017
247 Ga0495604_0024214 3300047317 Bacteria 4845
248 Ga0495604_0087137 3300047317 Bacteria 2326
249 Ga0495604_0228843 3300047317 Bacteria 1276
250 Ga0495674_0002679 3300047319 Bacteria 17337
251 Ga0495674_0139262 3300047319 Bacteria 2040
252 Ga0495680_0002674 3300047322 Bacteria 17996
253 Ga0495683_0024584 3300047323 Bacteria 3091
254 Ga0495685_056337 3300047447 Bacteria 1329
255 Ga0495684_0015062 3300047471 Bacteria 5955
256 Ga0495686_0087406 3300047472 Bacteria 1896
257 Ga0495602_0007206 3300048088 Bacteria 11654
258 Ga0495602_0082987 3300048088 Bacteria 2687
259 Ga0495615_0002319 3300048090 Bacteria 3036
260 Ga0496100_0033086 3300048903 Bacteria 3232
261 Ga0496100_0050423 3300048903 Bacteria 2697
262 Ga0496101_0118596 3300048904 Bacteria 1999
263 Ga0496101_0306549 3300048904 Bacteria 1244
264 Ga0496102_0001773 3300048905 Bacteria 18732
265 Ga0496102_0170473 3300048905 Bacteria 2049
266 Ga0496103_0020201 3300048906 Bacteria 4000
267 Ga0496103_0026425 3300048906 Bacteria 3515
268 Ga0496104_0017161 3300048907 Bacteria 6584
269 Ga0496104_0029286 3300048907 Bacteria 5107
270 Ga0496105_0017385 3300048908 Bacteria 5764
271 Ga0496106_0077099 3300048909 Bacteria 2556
272 Ga0496107_0000906 3300048910 Bacteria 17468
273 Ga0496110_0012336 3300048913 Bacteria 7027
274 Ga0496110_0061908 3300048913 Bacteria 3304
275 Ga0496111_0033818 3300048914 Bacteria 3647
276 Ga0496112_0019875 3300048915 Bacteria 6355
277 Ga0496112_0040104 3300048915 Bacteria 4578
278 Ga0496112_0195677 3300048915 Bacteria 1982
279 Ga0496113_0005552 3300048916 Bacteria 7879
280 Ga0496114_0019194 3300048917 Bacteria 5538
281 Ga0496114_0026084 3300048917 Bacteria 4782
282 Ga0496114_0305986 3300048917 Unclassified 1404
283 Ga0496115_0001360 3300048918 Bacteria 17447
284 Ga0496115_0150331 3300048918 Bacteria 1923
285 Ga0496115_0301771 3300048918 Bacteria 1312
286 Ga0496116_0100298 3300048919 Bacteria 1732
287 Ga0496118_0042947 3300048921 Bacteria 3560
288 Ga0496118_0049435 3300048921 Bacteria 3238
289 Ga0496120_0013470 3300048923 Bacteria 5502
290 Ga0496121_0012060 3300048924 Bacteria 9495
291 Ga0496121_0179734 3300048924 Bacteria 1528
292 Ga0496126_0046554 3300048929 Bacteria 3977
293 Ga0495682_0002812 3300049460 Bacteria 8029
294 Ga0501047_0109214 3300049581 Bacteria 2649
295 Ga0501047_0124801 3300049581 Bacteria 2455
296 Ga0501074_0034434 3300049590 Bacteria 3671
297 Ga0501080_0060687 3300049742 Bacteria 3520
298 Ga0501083_0048935 3300049744 Bacteria 2852
299 Ga0501044_0052681 3300049823 Bacteria 4191
300 nmdc:mga00v17_15228_c1 3300050491 Bacteria 4312
301 nmdc:mga0yw44_132195_c1 3300050492 Bacteria 1616
302 nmdc:mga0yw44_13968_c1 3300050492 Bacteria 4247
303 nmdc:mga0yw44_149011_c1 3300050492 Bacteria 1525
304 nmdc:mga0yw44_2679_c1 3300050492 Bacteria 7683
305 nmdc:mga04h51_362_c1 3300050495 Bacteria 11218
306 nmdc:mga06r32_237250_c1 3300050510 Bacteria 1811
307 nmdc:mga08y16_153491_c1 3300050511 Bacteria 2393
308 nmdc:mga08y16_4071_c1 3300050511 Bacteria 15268
309 nmdc:mga0a205_133450_c1 3300050515 Bacteria 2383
310 nmdc:mga0a205_29655_c1 3300050515 Bacteria 5236
311 nmdc:mga0sz30_7767_c1 3300050516 Bacteria 4031
312 Ga0495601_0011448 3300053077 Bacteria 5306
313 Ga0495595_0087472 3300053084 Bacteria 1492
314 Ga0495619_0015097 3300053085 Bacteria 4881
315 Ga0500578_0009955 3300053086 Bacteria 6168
316 Ga0500566_0000562 3300053094 Bacteria 20869
317 Ga0500566_0001998 3300053094 Bacteria 12032
318 Ga0500641_0008314 3300053096 Bacteria 3701
319 Ga0500557_000003 3300053105 Bacteria 228429
320 Ga0500595_001143 3300053119 Bacteria 14723
321 Ga0500559_0007895 3300053136 Bacteria 4693
322 Ga0500620_001310 3300053155 Bacteria 4509
323 Ga0500638_030123 3300053162 Bacteria 2611
324 Ga0500636_0110363 3300053177 Bacteria 1555
325 Ga0500637_0000068 3300053178 Bacteria 37212
326 Ga0500625_007016 3300053729 Bacteria 4854
327 Ga0500661_000814 3300055283 Bacteria 5813
328 Ga0501082_0000057 3300060353 Bacteria 79254

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006881 Ga0068865_100117214 Ga0068865_1001172143 321
2 3300046533 Ga0495640_0028164 Ga0495640_0028164_3050_4024 323
3 3300046660 Ga0495625_0275743 Ga0495625_0275743_40_1014 323
4 3300046675 Ga0495657_0184458 Ga0495657_0184458_27_1001 323
5 3300053085 Ga0495619_0015097 Ga0495619_0015097_11_985 323
6 3300053162 Ga0500638_030123 Ga0500638_030123_1593_2567 323
7 3300035172 Ga0373955_0182429 Ga0373955_0182429_224_1201 324
8 3300046454 Ga0495592_0094167 Ga0495592_0094167_1132_2109 324
9 3300046680 Ga0495646_0069240 Ga0495646_0069240_103_1080 324
10 3300025929 Ga0207664_10421647 Ga0207664_104216471 334
11 3300050510 nmdc:mga06r32_237250_c1 nmdc:mga06r32_237250_c1_41_1054 336
12 3300025912 Ga0207707_10393306 Ga0207707_103933062 338
13 3300039447 Ga0436361_1093097 Ga0436361_1093097_1120_2277 343
14 3300048924 Ga0496121_0179734 Ga0496121_0179734_21_1055 343
15 3300046663 Ga0495635_0062636 Ga0495635_0062636_1491_2531 345
16 3300053094 Ga0500566_0000562 Ga0500566_0000562_3928_4968 345
17 3300037853 Ga0436364_0431342 Ga0436364_0431342_528_1574 347
18 3300025916 Ga0207663_10069022 Ga0207663_100690224 349
19 3300009094 Ga0111539_10172637 Ga0111539_101726373 351
20 3300011119 Ga0105246_10317818 Ga0105246_103178181 351
21 3300046539 Ga0495621_0010893 Ga0495621_0010893_715_1848 352
22 iso_pu_bacteria 8019608314 8019609320 352
23 iso_pu_bacteria 8016539877 8016546920 360
24 3300003203 JGI25406J46586_10001296 JGI25406J46586_1000129610 363
25 3300005985 Ga0081539_10000350 Ga0081539_1000035073 363
26 3300006942 Ga0099824_1007458 Ga0099824_100745816 364
27 3300006943 Ga0099822_1042043 Ga0099822_10420432 364
28 3300021321 Ga0214542_1005215 Ga0214542_100521511 364
29 3300021327 Ga0214543_1000066 Ga0214543_100006686 364
30 3300027296 Ga0209389_1000024 Ga0209389_100002490 364
31 3300027357 Ga0209589_1003796 Ga0209589_100379623 364
32 3300027361 Ga0209489_100052 Ga0209489_10005290 364
33 3300006943 Ga0099822_1019645 Ga0099822_10196459 365
34 3300027357 Ga0209589_1005115 Ga0209589_100511525 365
35 3300026067 Ga0207678_10019008 Ga0207678_100190083 366
36 3300048909 Ga0496106_0077099 Ga0496106_0077099_471_1646 366
37 3300021388 Ga0213875_10007644 Ga0213875_100076443 367
38 3300037853 Ga0436364_1273206 Ga0436364_1273206_72565_73698 367
39 iso_pu_bacteria 3005710791 3005715947 367
40 iso_pu_bacteria 2508501009 2508541632 372
41 iso_pu_bacteria 2508501042 2508692828 372
42 iso_pu_bacteria 2508501128 2509151021 372
43 iso_pu_bacteria 2513237092 2513625964 372
44 iso_pu_bacteria 2513237141 2513887296 372
45 iso_pu_bacteria 2528768022 2528857191 372
46 iso_pu_bacteria 2617270735 2617353996 372
47 iso_pu_bacteria 2791355199 2793079544 372
48 iso_pu_bacteria 2824600985 2824602928 372
49 iso_pu_bacteria 2824609381 2824611849 372
50 iso_pu_bacteria 2824653114 2824655080 372
51 iso_pu_bacteria 2824661429 2824664462 372
52 iso_pu_bacteria 2824671348 2824672257 372
53 iso_pu_bacteria 2824687955 2824688860 372
54 iso_pu_bacteria 2824704595 2824708463 372
55 iso_pu_bacteria 2824753945 2824757972 372
56 iso_pu_bacteria 2824763712 2824766493 372
57 iso_pu_bacteria 2874590934 2874593860 372
58 iso_pu_bacteria 2874590934 2874598629 372
59 iso_pu_bacteria 2874645413 2874652083 372
60 iso_pu_bacteria 2876771140 2876773491 372
61 iso_pu_bacteria 2876771140 2876778668 372
62 iso_pu_bacteria 2876818435 2876821713 372
63 iso_pu_bacteria 2876818435 2876823472 372
64 iso_pu_bacteria 2879074833 2879077406 372
65 iso_pu_bacteria 2879074833 2879082461 372
66 iso_pu_bacteria 2879099564 2879107859 372
67 iso_pu_bacteria 2888419890 2888425741 372
68 iso_pu_bacteria 2889033259 2889033652 372
69 iso_pu_bacteria 2904690495 2904693533 372
70 iso_pu_bacteria 2904711408 2904711809 372
71 iso_pu_bacteria 2922361189 2922367017 372
72 iso_pu_bacteria 2922368715 2922375865 372
73 iso_pu_bacteria 2929615660 2929621180 372
74 iso_pu_bacteria 2929624759 2929625989 372
75 iso_pu_bacteria 2932784394 2932785130 372
76 iso_pu_bacteria 2932809354 2932810157 372
77 iso_pu_bacteria 2932818245 2932821731 372
78 iso_pu_bacteria 2932828146 2932828967 372
79 iso_pu_bacteria 2933577622 2933582951 372
80 iso_pu_bacteria 2935608549 2935609976 372
81 iso_pu_bacteria 2935616580 2935619614 372
82 iso_pu_bacteria 2935638405 2935638594 372
83 iso_pu_bacteria 2935648319 2935651992 372
84 iso_pu_bacteria 2935656913 2935660035 372
85 iso_pu_bacteria 2935665750 2935666554 372
86 iso_pu_bacteria 2935675223 2935676402 372
87 iso_pu_bacteria 2935684952 2935691081 372
88 iso_pu_bacteria 2935694250 2935694486 372
89 iso_pu_bacteria 2935703347 2935703600 372
90 iso_pu_bacteria 2935713505 2935718462 372
91 iso_pu_bacteria 2935722832 2935727558 372
92 iso_pu_bacteria 2935732158 2935736261 372
93 iso_pu_bacteria 2935741537 2935745641 372
94 iso_pu_bacteria 2935750917 2935756022 372
95 iso_pu_bacteria 2935760218 2935760718 372
96 iso_pu_bacteria 2935769743 2935777135 372
97 iso_pu_bacteria 2935777560 2935780806 372
98 iso_pu_bacteria 2935785616 2935793017 372
99 iso_pu_bacteria 2935793552 2935801018 372
100 iso_pu_bacteria 2935801545 2935801737 372
101 iso_pu_bacteria 2935819856 2935823136 372
102 iso_pu_bacteria 2935819856 2935827880 372
103 iso_pu_bacteria 2935827899 2935828088 372
104 iso_pu_bacteria 2935837841 2935842293 372
105 iso_pu_bacteria 2935847175 2935848718 372
106 iso_pu_bacteria 2935847175 2935855181 372
107 iso_pu_bacteria 2935855204 2935858070 372
108 iso_pu_bacteria 2935864058 2935867975 372
109 iso_pu_bacteria 2935873716 2935874002 372
110 iso_pu_bacteria 2935908558 2935909476 372
111 iso_pu_bacteria 2935916978 2935917200 372
112 iso_pu_bacteria 2935926038 2935926957 372
113 iso_pu_bacteria 2935934488 2935937199 372
114 iso_pu_bacteria 2935942939 2935944498 372
115 iso_pu_bacteria 2935951376 2935952935 372
116 iso_pu_bacteria 2935959822 2935962868 372
117 iso_pu_bacteria 2935967501 2935969775 372
118 iso_pu_bacteria 2935975950 2935983700 372
119 iso_pu_bacteria 2935984226 2935987180 372
120 iso_pu_bacteria 2935992306 2935993074 372
121 iso_pu_bacteria 2936002035 2936002986 372
122 iso_pu_bacteria 2936011229 2936014451 372
123 iso_pu_bacteria 2936019824 2936023709 372
124 iso_pu_bacteria 2936028420 2936031352 372
125 iso_pu_bacteria 2936046547 2936049557 372
126 iso_pu_bacteria 2936055302 2936061228 372
127 iso_pu_bacteria 2940556831 2940562003 372
128 iso_pu_bacteria 2941531003 2941531344 372
129 iso_pu_bacteria 2941538514 2941542342 372
130 iso_pu_bacteria 3005587118 3005590763 372
131 iso_pu_bacteria 3005718088 3005723304 372
132 iso_pu_bacteria 8006964411 8006966553 372
133 iso_pu_bacteria 8006984368 8006989960 372
134 iso_pu_bacteria 8006994254 8006997866 372
135 iso_pu_bacteria 8016511872 8016520494 372
136 iso_pu_bacteria 8016530956 8016533701 372
137 iso_pu_bacteria 8016548790 8016555195 372
138 iso_pu_bacteria 8016557553 8016563564 372
139 iso_pu_bacteria 8016575299 8016576232 372
140 iso_pu_bacteria 8016583857 8016584854 372
141 iso_pu_bacteria 8016595262 8016601299 372
142 iso_pu_bacteria 8016630954 8016639012 372
143 iso_pu_bacteria 8017057580 8017065080 372
144 iso_pu_bacteria 8019530166 8019533478 372
145 iso_pu_bacteria 8019538911 8019546201 372
146 iso_pu_bacteria 8019547302 8019552508 372
147 iso_pu_bacteria 8019576017 8019584463 372
148 iso_pu_bacteria 8019586578 8019592237 372
149 iso_pu_bacteria 8019597564 8019599048 372
150 iso_pu_bacteria 8019629233 8019631790 372
151 iso_pu_bacteria 8019678201 8019686889 372
152 iso_pu_bacteria 8055742211 8055744958 372
153 iso_pu_bacteria 8056673599 8056677919 372
154 3300021321 Ga0214542_1007226 Ga0214542_100722623 373
155 3300005718 Ga0068866_10118086 Ga0068866_101180861 374
156 3300005468 Ga0070707_100255290 Ga0070707_1002552902 375
157 3300005471 Ga0070698_100206960 Ga0070698_1002069601 375
158 3300006175 Ga0070712_100224053 Ga0070712_1002240532 375
159 3300025906 Ga0207699_10050077 Ga0207699_100500772 375
160 3300025913 Ga0207695_10155984 Ga0207695_101559841 375
161 3300039437 Ga0436365_1696728 Ga0436365_1696728_104_1234 375
162 3300045976 Ga0466967_0189250 Ga0466967_0189250_371_1501 375
163 3300047323 Ga0495683_0024584 Ga0495683_0024584_1026_2189 375
164 3300048918 Ga0496115_0301771 Ga0496115_0301771_139_1269 375
165 3300053086 Ga0500578_0009955 Ga0500578_0009955_5022_6155 375
166 3300053096 Ga0500641_0008314 Ga0500641_0008314_1563_2693 375
167 3300003215 JGI25153J46596_10035274 JGI25153J46596_100352741 376
168 3300005262 Ga0065165_1020424 Ga0065165_10204242 376
169 3300005329 Ga0070683_100001874 Ga0070683_10000187415 376
170 3300005329 Ga0070683_100045473 Ga0070683_1000454734 376
171 3300005330 Ga0070690_100162825 Ga0070690_1001628251 376
172 3300005333 Ga0070677_10019508 Ga0070677_100195083 376
173 3300005336 Ga0070680_100003676 Ga0070680_10000367612 376
174 3300005337 Ga0070682_100006000 Ga0070682_1000060004 376
175 3300005338 Ga0068868_100054694 Ga0068868_1000546944 376
176 3300005347 Ga0070668_100106152 Ga0070668_1001061523 376
177 3300005356 Ga0070674_100002871 Ga0070674_1000028714 376
178 3300005364 Ga0070673_100026051 Ga0070673_1000260512 376
179 3300005434 Ga0070709_10036848 Ga0070709_100368484 376
180 3300005439 Ga0070711_100047974 Ga0070711_1000479742 376
181 3300005456 Ga0070678_100006657 Ga0070678_1000066575 376
182 3300005456 Ga0070678_100009672 Ga0070678_1000096722 376
183 3300005456 Ga0070678_100087923 Ga0070678_1000879233 376
184 3300005458 Ga0070681_10001873 Ga0070681_100018735 376
185 3300005458 Ga0070681_10146946 Ga0070681_101469462 376
186 3300005458 Ga0070681_10446618 Ga0070681_104466181 376
187 3300005459 Ga0068867_100085436 Ga0068867_1000854362 376
188 3300005530 Ga0070679_100002797 Ga0070679_1000027975 376
189 3300005530 Ga0070679_100100678 Ga0070679_1001006782 376
190 3300005530 Ga0070679_100167872 Ga0070679_1001678722 376
191 3300005535 Ga0070684_100008931 Ga0070684_1000089314 376
192 3300005548 Ga0070665_100045036 Ga0070665_1000450365 376
193 3300005548 Ga0070665_100374245 Ga0070665_1003742451 376
194 3300005719 Ga0068861_100141120 Ga0068861_1001411202 376
195 3300005842 Ga0068858_100154404 Ga0068858_1001544042 376
196 3300005844 Ga0068862_100033846 Ga0068862_1000338466 376
197 3300005937 Ga0081455_10004153 Ga0081455_1000415317 376
198 3300005937 Ga0081455_10053509 Ga0081455_100535092 376
199 3300005937 Ga0081455_10122901 Ga0081455_101229011 376
200 3300005983 Ga0081540_1005374 Ga0081540_10053744 376
201 3300005983 Ga0081540_1006622 Ga0081540_10066227 376
202 3300006038 Ga0075365_10000815 Ga0075365_1000081510 376
203 3300006038 Ga0075365_10070614 Ga0075365_100706143 376
204 3300006038 Ga0075365_10088357 Ga0075365_100883572 376
205 3300006038 Ga0075365_10148590 Ga0075365_101485902 376
206 3300006042 Ga0075368_10001452 Ga0075368_100014526 376
207 3300006042 Ga0075368_10018965 Ga0075368_100189652 376
208 3300006175 Ga0070712_100063784 Ga0070712_1000637842 376
209 3300006177 Ga0075362_10018906 Ga0075362_100189062 376
210 3300006178 Ga0075367_10064301 Ga0075367_100643013 376
211 3300006353 Ga0075370_10084661 Ga0075370_100846612 376
212 3300006353 Ga0075370_10116431 Ga0075370_101164312 376
213 3300006844 Ga0075428_100430849 Ga0075428_1004308492 376
214 3300009093 Ga0105240_10081044 Ga0105240_100810442 376
215 3300009098 Ga0105245_10155464 Ga0105245_101554642 376
216 3300009545 Ga0105237_10073458 Ga0105237_100734582 376
217 3300009545 Ga0105237_10104392 Ga0105237_101043922 376
218 3300009551 Ga0105238_10190146 Ga0105238_101901462 376
219 3300010375 Ga0105239_10231368 Ga0105239_102313682 376
220 3300011119 Ga0105246_10014157 Ga0105246_100141574 376
221 3300013105 Ga0157369_10004167 Ga0157369_1000416712 376
222 3300013105 Ga0157369_10027253 Ga0157369_100272535 376
223 3300013105 Ga0157369_10273916 Ga0157369_102739162 376
224 3300013296 Ga0157374_10063013 Ga0157374_100630132 376
225 3300013296 Ga0157374_10087636 Ga0157374_100876363 376
226 3300013306 Ga0163162_10200112 Ga0163162_102001122 376
227 3300013308 Ga0157375_10043838 Ga0157375_100438384 376
228 3300013308 Ga0157375_10045375 Ga0157375_100453753 376
229 3300013308 Ga0157375_10248374 Ga0157375_102483741 376
230 3300014325 Ga0163163_10031684 Ga0163163_100316845 376
231 3300014968 Ga0157379_10105334 Ga0157379_101053344 376
232 3300014969 Ga0157376_10007978 Ga0157376_100079786 376
233 3300017792 Ga0163161_10075526 Ga0163161_100755262 376
234 3300021320 Ga0214544_1003153 Ga0214544_100315310 376
235 3300021320 Ga0214544_1006247 Ga0214544_100624713 376
236 3300021321 Ga0214542_1001978 Ga0214542_10019787 376
237 3300021321 Ga0214542_1002098 Ga0214542_100209818 376
238 3300021327 Ga0214543_1004129 Ga0214543_100412911 376
239 3300025261 Ga0209233_1016706 Ga0209233_10167061 376
240 3300025295 Ga0209564_1001604 Ga0209564_100160420 376
241 3300025297 Ga0209758_1001198 Ga0209758_100119823 376
242 3300025302 Ga0207426_1000292 Ga0207426_100029216 376
243 3300025893 Ga0207682_10015034 Ga0207682_100150343 376
244 3300025903 Ga0207680_10045084 Ga0207680_100450842 376
245 3300025909 Ga0207705_10023490 Ga0207705_100234902 376
246 3300025912 Ga0207707_10001373 Ga0207707_100013735 376
247 3300025912 Ga0207707_10035462 Ga0207707_100354622 376
248 3300025913 Ga0207695_10045295 Ga0207695_100452952 376
249 3300025915 Ga0207693_10017173 Ga0207693_100171734 376
250 3300025919 Ga0207657_10072992 Ga0207657_100729922 376
251 3300025921 Ga0207652_10310525 Ga0207652_103105252 376
252 3300025924 Ga0207694_10045216 Ga0207694_100452162 376
253 3300025926 Ga0207659_10285680 Ga0207659_102856801 376
254 3300025927 Ga0207687_10098420 Ga0207687_100984202 376
255 3300025933 Ga0207706_10019267 Ga0207706_100192673 376
256 3300025937 Ga0207669_10031312 Ga0207669_100313122 376
257 3300025937 Ga0207669_10270509 Ga0207669_102705091 376
258 3300025938 Ga0207704_10004149 Ga0207704_100041496 376
259 3300025944 Ga0207661_10000512 Ga0207661_1000051216 376
260 3300025949 Ga0207667_10171339 Ga0207667_101713392 376
261 3300025949 Ga0207667_10181764 Ga0207667_101817642 376
262 3300025960 Ga0207651_10063364 Ga0207651_100633641 376
263 3300025972 Ga0207668_10050060 Ga0207668_100500602 376
264 3300025972 Ga0207668_10178376 Ga0207668_101783761 376
265 3300025972 Ga0207668_10203836 Ga0207668_102038361 376
266 3300025981 Ga0207640_10254271 Ga0207640_102542712 376
267 3300026023 Ga0207677_10040020 Ga0207677_100400203 376
268 3300026035 Ga0207703_10345003 Ga0207703_103450032 376
269 3300026041 Ga0207639_10026817 Ga0207639_100268172 376
270 3300026067 Ga0207678_10048990 Ga0207678_100489904 376
271 3300026067 Ga0207678_10064930 Ga0207678_100649302 376
272 3300026078 Ga0207702_10065643 Ga0207702_100656432 376
273 3300026078 Ga0207702_10197292 Ga0207702_101972922 376
274 3300026089 Ga0207648_10124141 Ga0207648_101241412 376
275 3300026095 Ga0207676_10076147 Ga0207676_100761472 376
276 3300026095 Ga0207676_10118535 Ga0207676_101185352 376
277 3300026118 Ga0207675_100061586 Ga0207675_1000615863 376
278 3300026118 Ga0207675_100086167 Ga0207675_1000861674 376
279 3300026121 Ga0207683_10034074 Ga0207683_100340745 376
280 3300026121 Ga0207683_10056565 Ga0207683_100565655 376
281 3300026121 Ga0207683_10158379 Ga0207683_101583791 376
282 3300026142 Ga0207698_10044572 Ga0207698_100445723 376
283 3300027866 Ga0209813_10000399 Ga0209813_100003992 376
284 3300028379 Ga0268266_10031546 Ga0268266_100315464 376
285 3300028379 Ga0268266_10128919 Ga0268266_101289192 376
286 3300028379 Ga0268266_10307520 Ga0268266_103075201 376
287 3300028380 Ga0268265_10189816 Ga0268265_101898162 376
288 3300031251 Ga0265327_10004333 Ga0265327_100043333 376
289 3300031595 Ga0265313_10057963 Ga0265313_100579632 376
290 3300031730 Ga0307516_10065839 Ga0307516_100658395 376
291 3300031903 Ga0307407_10093963 Ga0307407_100939631 376
292 3300032005 Ga0307411_10270859 Ga0307411_102708591 376
293 3300033180 Ga0307510_10003194 Ga0307510_100031944 376
294 3300035111 Ga0373923_0027683 Ga0373923_0027683_553_1704 376
295 3300035113 Ga0373936_0082045 Ga0373936_0082045_119_1252 376
296 3300035116 Ga0373945_0009771 Ga0373945_0009771_324_1475 376
297 3300035118 Ga0373954_0019248 Ga0373954_0019248_1253_2386 376
298 3300035171 Ga0373946_0018711 Ga0373946_0018711_685_1836 376
299 3300035172 Ga0373955_0105907 Ga0373955_0105907_306_1457 376
300 3300035692 Ga0373935_0104078 Ga0373935_0104078_442_1593 376
301 3300035695 Ga0373927_0103855 Ga0373927_0103855_211_1362 376
302 3300037418 Ga0395900_0002386 Ga0395900_0002386_6357_7490 376
303 3300037466 Ga0395898_0016285 Ga0395898_0016285_1031_2164 376
304 3300037466 Ga0395898_0019202 Ga0395898_0019202_4809_5942 376
305 3300037853 Ga0436364_0248881 Ga0436364_0248881_327_1460 376
306 3300044684 Ga0466966_0005443 Ga0466966_0005443_3181_4323 376
307 3300044693 Ga0466961_0000005 Ga0466961_0000005_3987_5129 376
308 3300044693 Ga0466961_0051971 Ga0466961_0051971_1260_2405 376
309 3300045049 Ga0466959_0000670 Ga0466959_0000670_13854_14996 376
310 3300046454 Ga0495592_0024959 Ga0495592_0024959_2332_3465 376
311 3300046455 Ga0495603_0063652 Ga0495603_0063652_667_1800 376
312 3300046461 Ga0495641_0047695 Ga0495641_0047695_37_1188 376
313 3300046462 Ga0495651_0013345 Ga0495651_0013345_2095_3228 376
314 3300046463 Ga0495653_0110125 Ga0495653_0110125_818_1951 376
315 3300046475 Ga0495639_0015814 Ga0495639_0015814_2074_3225 376
316 3300046477 Ga0495664_0074955 Ga0495664_0074955_95_1228 376
317 3300046511 Ga0495608_0010208 Ga0495608_0010208_2410_3543 376
318 3300046512 Ga0495610_0075781 Ga0495610_0075781_405_1541 376
319 3300046516 Ga0495628_0032324 Ga0495628_0032324_2235_3368 376
320 3300046517 Ga0495630_0081798 Ga0495630_0081798_196_1347 376
321 3300046526 Ga0495666_0044930 Ga0495666_0044930_756_1907 376
322 3300046529 Ga0495652_0011068 Ga0495652_0011068_4263_5396 376
323 3300046531 Ga0495665_0074743 Ga0495665_0074743_526_1677 376
324 3300046543 Ga0495645_0006653 Ga0495645_0006653_646_1779 376
325 3300046543 Ga0495645_0047674 Ga0495645_0047674_1614_2747 376
326 3300046559 Ga0495667_0013229 Ga0495667_0013229_1567_2700 376
327 3300046642 Ga0495634_0072371 Ga0495634_0072371_52_1203 376
328 3300046648 Ga0495611_0031362 Ga0495611_0031362_132_1265 376
329 3300046663 Ga0495635_0036638 Ga0495635_0036638_2233_3384 376
330 3300046665 Ga0495661_0119560 Ga0495661_0119560_137_1270 376
331 3300046674 Ga0495588_0007702 Ga0495588_0007702_1808_2941 376
332 3300046678 Ga0495599_0003706 Ga0495599_0003706_3315_4448 376
333 3300046689 Ga0495613_0194532 Ga0495613_0194532_205_1338 376
334 3300046694 Ga0495649_0005466 Ga0495649_0005466_5372_6538 376
335 3300046809 Ga0495600_0041009 Ga0495600_0041009_1710_2843 376
336 3300047317 Ga0495604_0024214 Ga0495604_0024214_3412_4545 376
337 3300047317 Ga0495604_0228843 Ga0495604_0228843_62_1195 376
338 3300047319 Ga0495674_0002679 Ga0495674_0002679_2402_3535 376
339 3300047319 Ga0495674_0139262 Ga0495674_0139262_530_1681 376
340 3300047322 Ga0495680_0002674 Ga0495680_0002674_15467_16600 376
341 3300047447 Ga0495685_056337 Ga0495685_056337_82_1215 376
342 3300047471 Ga0495684_0015062 Ga0495684_0015062_2905_4056 376
343 3300047472 Ga0495686_0087406 Ga0495686_0087406_479_1612 376
344 3300048088 Ga0495602_0007206 Ga0495602_0007206_8215_9348 376
345 3300048088 Ga0495602_0082987 Ga0495602_0082987_413_1555 376
346 3300048090 Ga0495615_0002319 Ga0495615_0002319_129_1262 376
347 3300048903 Ga0496100_0033086 Ga0496100_0033086_195_1337 376
348 3300048903 Ga0496100_0050423 Ga0496100_0050423_979_2112 376
349 3300048904 Ga0496101_0306549 Ga0496101_0306549_38_1171 376
350 3300048905 Ga0496102_0001773 Ga0496102_0001773_6833_7975 376
351 3300048905 Ga0496102_0170473 Ga0496102_0170473_357_1490 376
352 3300048906 Ga0496103_0020201 Ga0496103_0020201_2792_3934 376
353 3300048906 Ga0496103_0026425 Ga0496103_0026425_383_1516 376
354 3300048907 Ga0496104_0017161 Ga0496104_0017161_1998_3140 376
355 3300048908 Ga0496105_0017385 Ga0496105_0017385_1848_2990 376
356 3300048910 Ga0496107_0000906 Ga0496107_0000906_4483_5625 376
357 3300048913 Ga0496110_0012336 Ga0496110_0012336_1511_2653 376
358 3300048913 Ga0496110_0061908 Ga0496110_0061908_669_1802 376
359 3300048914 Ga0496111_0033818 Ga0496111_0033818_1073_2215 376
360 3300048915 Ga0496112_0019875 Ga0496112_0019875_1431_2573 376
361 3300048915 Ga0496112_0040104 Ga0496112_0040104_2492_3625 376
362 3300048916 Ga0496113_0005552 Ga0496113_0005552_4308_5450 376
363 3300048917 Ga0496114_0019194 Ga0496114_0019194_1703_2845 376
364 3300048917 Ga0496114_0026084 Ga0496114_0026084_3513_4646 376
365 3300048918 Ga0496115_0001360 Ga0496115_0001360_11870_13012 376
366 3300048919 Ga0496116_0100298 Ga0496116_0100298_344_1477 376
367 3300048921 Ga0496118_0042947 Ga0496118_0042947_2294_3427 376
368 3300048921 Ga0496118_0049435 Ga0496118_0049435_1622_2755 376
369 3300048923 Ga0496120_0013470 Ga0496120_0013470_3936_5069 376
370 3300048924 Ga0496121_0012060 Ga0496121_0012060_6559_7692 376
371 3300048929 Ga0496126_0046554 Ga0496126_0046554_954_2087 376
372 3300049460 Ga0495682_0002812 Ga0495682_0002812_2088_3254 376
373 3300049581 Ga0501047_0109214 Ga0501047_0109214_449_1582 376
374 3300049590 Ga0501074_0034434 Ga0501074_0034434_2305_3438 376
375 3300049742 Ga0501080_0060687 Ga0501080_0060687_2278_3411 376
376 3300049744 Ga0501083_0048935 Ga0501083_0048935_1059_2195 376
377 3300050492 nmdc:mga0yw44_132195_c1 nmdc:mga0yw44_132195_c1_240_1373 376
378 3300050492 nmdc:mga0yw44_13968_c1 nmdc:mga0yw44_13968_c1_1731_2876 376
379 3300050492 nmdc:mga0yw44_149011_c1 nmdc:mga0yw44_149011_c1_31_1164 376
380 3300050492 nmdc:mga0yw44_2679_c1 nmdc:mga0yw44_2679_c1_2963_4108 376
381 3300050495 nmdc:mga04h51_362_c1 nmdc:mga04h51_362_c1_8627_9826 376
382 3300053084 Ga0495595_0087472 Ga0495595_0087472_276_1409 376
383 3300053094 Ga0500566_0001998 Ga0500566_0001998_8966_10099 376
384 3300053105 Ga0500557_000003 Ga0500557_000003_197803_198945 376
385 3300053119 Ga0500595_001143 Ga0500595_001143_13528_14661 376
386 3300053136 Ga0500559_0007895 Ga0500559_0007895_1701_2834 376
387 3300053155 Ga0500620_001310 Ga0500620_001310_84_1217 376
388 3300053177 Ga0500636_0110363 Ga0500636_0110363_162_1295 376
389 3300053178 Ga0500637_0000068 Ga0500637_0000068_1811_2944 376
390 3300053729 Ga0500625_007016 Ga0500625_007016_2888_4030 376
391 3300055283 Ga0500661_000814 Ga0500661_000814_2602_3735 376
392 3300060353 Ga0501082_0000057 Ga0501082_0000057_59359_60495 376
393 3300006844 Ga0075428_100003201 Ga0075428_1000032013 378
394 3300006852 Ga0075433_10033814 Ga0075433_100338142 378
395 3300009094 Ga0111539_10001837 Ga0111539_1000183720 378
396 3300009094 Ga0111539_10057305 Ga0111539_100573056 378
397 3300027907 Ga0207428_10008351 Ga0207428_100083513 378
398 3300050511 nmdc:mga08y16_153491_c1 nmdc:mga08y16_153491_c1_952_2091 378
399 3300050511 nmdc:mga08y16_4071_c1 nmdc:mga08y16_4071_c1_1736_2875 378
400 3300050515 nmdc:mga0a205_133450_c1 nmdc:mga0a205_133450_c1_1035_2174 378
401 3300050515 nmdc:mga0a205_29655_c1 nmdc:mga0a205_29655_c1_1944_3083 378
402 3300031733 Ga0316577_10112697 Ga0316577_101126972 380
403 3300042876 Ga0451577_0092182 Ga0451577_0092182_120_1265 380
404 3300044712 Ga0453684_0010690 Ga0453684_0010690_13564_14709 380
405 3300005563 Ga0068855_100288784 Ga0068855_1002887842 384
406 3300025949 Ga0207667_10322432 Ga0207667_103224322 384
407 iso_pu_bacteria 2582581304 2585255846 384
408 iso_pu_bacteria 2597490356 2599100594 385
409 iso_pu_bacteria 2848858292 2848863492 385
410 iso_pu_bacteria 2980125574 2980125878 385
411 3300009545 Ga0105237_10060254 Ga0105237_100602544 388
412 3300021384 Ga0213876_10051624 Ga0213876_100516242 388
413 3300025914 Ga0207671_10215059 Ga0207671_102150591 388
414 3300037471 Ga0395905_0004620 Ga0395905_0004620_5921_7087 388
415 3300039437 Ga0436365_1256094 Ga0436365_1256094_7404_8570 388
416 3300048917 Ga0496114_0305986 Ga0496114_0305986_45_1211 388
417 3300048918 Ga0496115_0150331 Ga0496115_0150331_396_1562 388
418 3300000549 LJQas_1004506 LJQas_10045062 389
419 3300005340 Ga0070689_100029500 Ga0070689_1000295002 389
420 3300005355 Ga0070671_100009647 Ga0070671_1000096476 389
421 3300005364 Ga0070673_100057026 Ga0070673_1000570263 389
422 3300005436 Ga0070713_100085165 Ga0070713_1000851652 389
423 3300005437 Ga0070710_10112519 Ga0070710_101125192 389
424 3300005983 Ga0081540_1029863 Ga0081540_10298634 389
425 3300006175 Ga0070712_100070437 Ga0070712_1000704374 389
426 3300006186 Ga0075369_10021241 Ga0075369_100212413 389
427 3300009174 Ga0105241_10038032 Ga0105241_100380323 389
428 3300014325 Ga0163163_10038386 Ga0163163_100383862 389
429 3300025907 Ga0207645_10097072 Ga0207645_100970722 389
430 3300025915 Ga0207693_10057272 Ga0207693_100572723 389
431 3300025926 Ga0207659_10065106 Ga0207659_100651061 389
432 3300025928 Ga0207700_10109871 Ga0207700_101098712 389
433 3300025931 Ga0207644_10006453 Ga0207644_100064534 389
434 3300025960 Ga0207651_10005518 Ga0207651_100055184 389
435 3300035118 Ga0373954_0115178 Ga0373954_0115178_27_1208 389
436 3300039438 Ga0436360_0347114 Ga0436360_0347114_231_1406 389
437 3300046454 Ga0495592_0230816 Ga0495592_0230816_42_1214 389
438 3300046462 Ga0495651_0076548 Ga0495651_0076548_38_1210 389
439 3300046516 Ga0495628_0151911 Ga0495628_0151911_450_1622 389
440 3300046529 Ga0495652_0110738 Ga0495652_0110738_943_2115 389
441 3300047317 Ga0495604_0087137 Ga0495604_0087137_146_1318 389
442 3300048904 Ga0496101_0118596 Ga0496101_0118596_550_1722 389
443 3300048907 Ga0496104_0029286 Ga0496104_0029286_1696_2868 389
444 3300048915 Ga0496112_0195677 Ga0496112_0195677_354_1526 389
445 3300049581 Ga0501047_0124801 Ga0501047_0124801_85_1254 389
446 3300049823 Ga0501044_0052681 Ga0501044_0052681_1865_3034 389
447 3300050491 nmdc:mga00v17_15228_c1 nmdc:mga00v17_15228_c1_2145_3314 389
448 3300050516 nmdc:mga0sz30_7767_c1 nmdc:mga0sz30_7767_c1_641_1810 389
449 3300053077 Ga0495601_0011448 Ga0495601_0011448_732_1904 389

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13378

MR_MLE_C

Enolase C-terminal domain-like

173

396

0.97

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

29

148

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5olc-assembly1.cif.gz_F crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans 0.9739 1 389
5olc-assembly1.cif.gz_F crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans 0.9712 1 389
4hpn-assembly1.cif.gz_A crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops 0.9545 1 389
4ggb-assembly1.cif.gz_A crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, disordered loops 0.9513 1 381
4hpn-assembly1.cif.gz_A crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops 0.9471 1 389
ID Description Score Start End Superfamily
5olcB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9719 120 389 3.20.20.120
5olcB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9642 120 389 3.20.20.120
4ggbA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9525 120 381 3.20.20.120
5olcA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9361 1 117 3.30.390.10
3sjnB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9336 119 389 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A263DHE3-F1-model_v4 Mandelate racemase 0.9823 59 389 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-A0A263DHE3-F1-model_v4 Mandelate racemase 0.9765 59 389 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-A0A4V3MR21-F1-model_v4 deleted 0.9725 199 324
AF-A0A852TQ88-F1-model_v4 D-galactarolactone cycloisomerase (EC 5.5.1.-) 0.9687 100 388 GO:0000287
GO:0009063
GO:0016052
GO:0016836
GO:0016853
AF-A0A3S0K0W6-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme family protein 0.9686 1 388 GO:0000287
GO:0009063
GO:0016052
GO:0016836

Feature Viewer

pLDDT pTM Quality
92.65 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map