F446348
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 449 | 345 | 328 | 377 |
Family's Representative Sequence
| Representative Sequence | 3300006175|Ga0070712_100224053|Ga0070712_1002240532 |
| Length | 402 |
| Sequence | MQPSARLSLDRFRQLDHAPVSYGANAMKITGIRTHVLSAALSQPFAYSRAWYDTRTAMLVEIETDDGLIGWGECYGPAAMTAAVVNSVVPWLIGEDPLRTDFLWRMIYARLRDHGQKGVVIEGLSGIDIALWDIKGKHFGVPVYQLLGGPLRNEVQAYATGLYRRKSGNPLRYLAEEAAGYVVDGFKAVKLKVGFGVAEDAAVTRAVREAIGPDIALMVDANHAYDASAAIRLGRMIEAHDIGWFEEPVPPEDVSGYQAVKAALAIPIAGGECEFTRFGFRNLLVSRAVDIVQPDTCAAGGLSECKKIADMAEAFGTRYNPHVWGTGIAIAASLQLLAVLPTHTPNSLAPIAPMLEFDRTEHPIRQAILTRPLEPADGTIRVPDGPGLGIEVDRAALARFSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 5 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 6 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 7 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 8 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 9 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 10 | 2791355199 | |||
| 11 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 12 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 13 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 14 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 15 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 16 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 17 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 18 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 19 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 20 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 21 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 22 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 23 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 24 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 25 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 26 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 27 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 28 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 29 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 30 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 31 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 32 | 2922368715 | |||
| 33 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 34 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 35 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 36 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 37 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 38 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 39 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 40 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 41 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 42 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 43 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 44 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 45 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 46 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 47 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 48 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 49 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 50 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 51 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 52 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 53 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 54 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 55 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 56 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 57 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 58 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 59 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 60 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 61 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 62 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 63 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 64 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 65 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 66 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 67 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 68 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 69 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 70 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 71 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 72 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 73 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 74 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 75 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 76 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 77 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 78 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 79 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 80 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 81 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 82 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 83 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 84 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 85 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 86 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 87 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 88 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 89 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 90 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 91 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 92 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 93 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 95 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 96 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 98 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 102 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 103 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 113 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 114 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 117 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 118 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 120 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 121 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 122 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 123 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 124 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 125 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 126 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 127 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 128 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 129 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 131 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 132 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 133 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 134 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 135 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 136 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 137 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 138 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 139 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 156 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 157 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 158 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 159 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 160 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 201 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 203 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 210 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 211 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 214 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 228 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 229 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 230 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 231 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 232 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 291 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 292 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 293 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 300 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 301 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 302 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 306 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 310 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 311 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 312 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 313 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 314 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 315 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 316 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 317 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 319 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 320 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 321 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 323 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 324 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 325 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 326 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 327 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 328 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 329 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 330 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 331 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 332 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 333 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 334 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 335 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 336 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 337 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 338 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 339 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 340 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 341 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 342 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 343 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 344 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 345 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.38 |
| Metatranscriptomes | 0 |
| Isolates | 26.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.46 |
| Nodule | 25.61 |
| Rhizoplane | 5.79 |
| Rhizosphere | 52.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1004506 | 3300000549 | Bacteria | 1810 |
| 2 | JGI25406J46586_10001296 | 3300003203 | Bacteria | 11767 |
| 3 | JGI25153J46596_10035274 | 3300003215 | Bacteria | 1622 |
| 4 | Ga0065165_1020424 | 3300005262 | Bacteria | 2330 |
| 5 | Ga0070683_100001874 | 3300005329 | Bacteria | 16425 |
| 6 | Ga0070683_100045473 | 3300005329 | Bacteria | 4051 |
| 7 | Ga0070690_100162825 | 3300005330 | Bacteria | 1530 |
| 8 | Ga0070677_10019508 | 3300005333 | Bacteria | 2457 |
| 9 | Ga0070680_100003676 | 3300005336 | Bacteria | 11456 |
| 10 | Ga0070682_100006000 | 3300005337 | Bacteria | 6800 |
| 11 | Ga0068868_100054694 | 3300005338 | Bacteria | 3147 |
| 12 | Ga0070689_100029500 | 3300005340 | Bacteria | 4153 |
| 13 | Ga0070668_100106152 | 3300005347 | Bacteria | 2231 |
| 14 | Ga0070671_100009647 | 3300005355 | Bacteria | 7755 |
| 15 | Ga0070674_100002871 | 3300005356 | Bacteria | 9524 |
| 16 | Ga0070673_100026051 | 3300005364 | Bacteria | 4313 |
| 17 | Ga0070673_100057026 | 3300005364 | Bacteria | 3085 |
| 18 | Ga0070709_10036848 | 3300005434 | Bacteria | 2983 |
| 19 | Ga0070713_100085165 | 3300005436 | Bacteria | 2707 |
| 20 | Ga0070710_10112519 | 3300005437 | Bacteria | 1637 |
| 21 | Ga0070711_100047974 | 3300005439 | Bacteria | 2918 |
| 22 | Ga0070678_100006657 | 3300005456 | Bacteria | 6796 |
| 23 | Ga0070678_100009672 | 3300005456 | Bacteria | 5855 |
| 24 | Ga0070678_100087923 | 3300005456 | Bacteria | 2374 |
| 25 | Ga0070681_10001873 | 3300005458 | Bacteria | 18987 |
| 26 | Ga0070681_10146946 | 3300005458 | Bacteria | 2286 |
| 27 | Ga0070681_10446618 | 3300005458 | Bacteria | 1205 |
| 28 | Ga0068867_100085436 | 3300005459 | Bacteria | 2385 |
| 29 | Ga0070707_100255290 | 3300005468 | Bacteria | 1706 |
| 30 | Ga0070698_100206960 | 3300005471 | Bacteria | 1897 |
| 31 | Ga0070679_100002797 | 3300005530 | Bacteria | 15857 |
| 32 | Ga0070679_100100678 | 3300005530 | Bacteria | 2875 |
| 33 | Ga0070679_100167872 | 3300005530 | Bacteria | 2168 |
| 34 | Ga0070684_100008931 | 3300005535 | Bacteria | 7867 |
| 35 | Ga0070665_100045036 | 3300005548 | Bacteria | 4430 |
| 36 | Ga0070665_100374245 | 3300005548 | Bacteria | 1431 |
| 37 | Ga0068855_100288784 | 3300005563 | Bacteria | 1819 |
| 38 | Ga0068866_10118086 | 3300005718 | Unclassified | 1490 |
| 39 | Ga0068861_100141120 | 3300005719 | Bacteria | 1966 |
| 40 | Ga0068858_100154404 | 3300005842 | Bacteria | 2159 |
| 41 | Ga0068862_100033846 | 3300005844 | Bacteria | 4322 |
| 42 | Ga0081455_10004153 | 3300005937 | Bacteria | 16343 |
| 43 | Ga0081455_10053509 | 3300005937 | Bacteria | 3448 |
| 44 | Ga0081455_10122901 | 3300005937 | Bacteria | 2043 |
| 45 | Ga0081540_1005374 | 3300005983 | Bacteria | 9579 |
| 46 | Ga0081540_1006622 | 3300005983 | Bacteria | 8401 |
| 47 | Ga0081540_1029863 | 3300005983 | Bacteria | 3029 |
| 48 | Ga0081539_10000350 | 3300005985 | Bacteria | 101255 |
| 49 | Ga0075365_10000815 | 3300006038 | Bacteria | 12843 |
| 50 | Ga0075365_10070614 | 3300006038 | Bacteria | 2349 |
| 51 | Ga0075365_10088357 | 3300006038 | Bacteria | 2108 |
| 52 | Ga0075365_10148590 | 3300006038 | Bacteria | 1629 |
| 53 | Ga0075368_10001452 | 3300006042 | Bacteria | 7584 |
| 54 | Ga0075368_10018965 | 3300006042 | Bacteria | 2592 |
| 55 | Ga0070712_100063784 | 3300006175 | Bacteria | 2610 |
| 56 | Ga0070712_100070437 | 3300006175 | Bacteria | 2498 |
| 57 | Ga0070712_100224053 | 3300006175 | Bacteria | 1490 |
| 58 | Ga0075362_10018906 | 3300006177 | Bacteria | 2859 |
| 59 | Ga0075367_10064301 | 3300006178 | Bacteria | 2194 |
| 60 | Ga0075369_10021241 | 3300006186 | Bacteria | 2665 |
| 61 | Ga0075370_10084661 | 3300006353 | Bacteria | 1825 |
| 62 | Ga0075370_10116431 | 3300006353 | Bacteria | 1554 |
| 63 | Ga0075428_100003201 | 3300006844 | Bacteria | 17902 |
| 64 | Ga0075428_100430849 | 3300006844 | Bacteria | 1413 |
| 65 | Ga0075433_10033814 | 3300006852 | Bacteria | 4385 |
| 66 | Ga0068865_100117214 | 3300006881 | Bacteria | 1974 |
| 67 | Ga0099824_1007458 | 3300006942 | Bacteria | 14473 |
| 68 | Ga0099822_1019645 | 3300006943 | Bacteria | 6840 |
| 69 | Ga0099822_1042043 | 3300006943 | Bacteria | 2415 |
| 70 | Ga0105240_10081044 | 3300009093 | Bacteria | 3990 |
| 71 | Ga0111539_10001837 | 3300009094 | Bacteria | 28233 |
| 72 | Ga0111539_10057305 | 3300009094 | Bacteria | 4627 |
| 73 | Ga0111539_10172637 | 3300009094 | Bacteria | 2526 |
| 74 | Ga0105245_10155464 | 3300009098 | Bacteria | 2166 |
| 75 | Ga0105241_10038032 | 3300009174 | Bacteria | 3628 |
| 76 | Ga0105237_10060254 | 3300009545 | Bacteria | 3798 |
| 77 | Ga0105237_10073458 | 3300009545 | Bacteria | 3412 |
| 78 | Ga0105237_10104392 | 3300009545 | Bacteria | 2826 |
| 79 | Ga0105238_10190146 | 3300009551 | Bacteria | 2029 |
| 80 | Ga0105239_10231368 | 3300010375 | Bacteria | 2073 |
| 81 | Ga0105246_10014157 | 3300011119 | Bacteria | 5012 |
| 82 | Ga0105246_10317818 | 3300011119 | Bacteria | 1264 |
| 83 | Ga0157369_10004167 | 3300013105 | Bacteria | 17131 |
| 84 | Ga0157369_10027253 | 3300013105 | Bacteria | 6336 |
| 85 | Ga0157369_10273916 | 3300013105 | Bacteria | 1758 |
| 86 | Ga0157374_10063013 | 3300013296 | Bacteria | 3477 |
| 87 | Ga0157374_10087636 | 3300013296 | Bacteria | 2964 |
| 88 | Ga0163162_10200112 | 3300013306 | Bacteria | 2126 |
| 89 | Ga0157375_10043838 | 3300013308 | Bacteria | 4341 |
| 90 | Ga0157375_10045375 | 3300013308 | Bacteria | 4277 |
| 91 | Ga0157375_10248374 | 3300013308 | Bacteria | 1940 |
| 92 | Ga0163163_10031684 | 3300014325 | Bacteria | 5104 |
| 93 | Ga0163163_10038386 | 3300014325 | Bacteria | 4668 |
| 94 | Ga0157379_10105334 | 3300014968 | Bacteria | 2531 |
| 95 | Ga0157376_10007978 | 3300014969 | Bacteria | 7597 |
| 96 | Ga0163161_10075526 | 3300017792 | Bacteria | 2473 |
| 97 | Ga0214544_1003153 | 3300021320 | Bacteria | 34430 |
| 98 | Ga0214544_1006247 | 3300021320 | Bacteria | 22163 |
| 99 | Ga0214542_1001978 | 3300021321 | Bacteria | 42477 |
| 100 | Ga0214542_1002098 | 3300021321 | Bacteria | 41259 |
| 101 | Ga0214542_1005215 | 3300021321 | Bacteria | 24970 |
| 102 | Ga0214542_1007226 | 3300021321 | Bacteria | 19478 |
| 103 | Ga0214543_1000066 | 3300021327 | Bacteria | 126288 |
| 104 | Ga0214543_1004129 | 3300021327 | Bacteria | 27729 |
| 105 | Ga0213876_10051624 | 3300021384 | Bacteria | 2173 |
| 106 | Ga0213875_10007644 | 3300021388 | Bacteria | 5570 |
| 107 | Ga0209233_1016706 | 3300025261 | Bacteria | 2016 |
| 108 | Ga0209564_1001604 | 3300025295 | Bacteria | 22024 |
| 109 | Ga0209758_1001198 | 3300025297 | Bacteria | 32768 |
| 110 | Ga0207426_1000292 | 3300025302 | Bacteria | 99342 |
| 111 | Ga0207682_10015034 | 3300025893 | Bacteria | 3014 |
| 112 | Ga0207680_10045084 | 3300025903 | Bacteria | 2597 |
| 113 | Ga0207699_10050077 | 3300025906 | Bacteria | 2462 |
| 114 | Ga0207645_10097072 | 3300025907 | Bacteria | 1899 |
| 115 | Ga0207705_10023490 | 3300025909 | Bacteria | 4398 |
| 116 | Ga0207707_10001373 | 3300025912 | Bacteria | 22581 |
| 117 | Ga0207707_10035462 | 3300025912 | Bacteria | 4362 |
| 118 | Ga0207707_10393306 | 3300025912 | Bacteria | 1191 |
| 119 | Ga0207695_10045295 | 3300025913 | Bacteria | 4670 |
| 120 | Ga0207695_10155984 | 3300025913 | Bacteria | 2217 |
| 121 | Ga0207671_10215059 | 3300025914 | Unclassified | 1504 |
| 122 | Ga0207693_10017173 | 3300025915 | Bacteria | 5771 |
| 123 | Ga0207693_10057272 | 3300025915 | Bacteria | 3054 |
| 124 | Ga0207663_10069022 | 3300025916 | Bacteria | 2272 |
| 125 | Ga0207657_10072992 | 3300025919 | Bacteria | 2901 |
| 126 | Ga0207652_10310525 | 3300025921 | Bacteria | 1423 |
| 127 | Ga0207694_10045216 | 3300025924 | Bacteria | 3401 |
| 128 | Ga0207659_10065106 | 3300025926 | Bacteria | 2640 |
| 129 | Ga0207659_10285680 | 3300025926 | Bacteria | 1350 |
| 130 | Ga0207687_10098420 | 3300025927 | Bacteria | 2147 |
| 131 | Ga0207700_10109871 | 3300025928 | Bacteria | 2217 |
| 132 | Ga0207664_10421647 | 3300025929 | Bacteria | 1189 |
| 133 | Ga0207644_10006453 | 3300025931 | Bacteria | 7644 |
| 134 | Ga0207706_10019267 | 3300025933 | Bacteria | 6137 |
| 135 | Ga0207669_10031312 | 3300025937 | Bacteria | 2970 |
| 136 | Ga0207669_10270509 | 3300025937 | Bacteria | 1276 |
| 137 | Ga0207704_10004149 | 3300025938 | Bacteria | 6605 |
| 138 | Ga0207661_10000512 | 3300025944 | Bacteria | 25087 |
| 139 | Ga0207667_10171339 | 3300025949 | Bacteria | 2231 |
| 140 | Ga0207667_10181764 | 3300025949 | Bacteria | 2159 |
| 141 | Ga0207667_10322432 | 3300025949 | Bacteria | 1578 |
| 142 | Ga0207651_10005518 | 3300025960 | Bacteria | 6507 |
| 143 | Ga0207651_10063364 | 3300025960 | Bacteria | 2581 |
| 144 | Ga0207668_10050060 | 3300025972 | Bacteria | 2876 |
| 145 | Ga0207668_10178376 | 3300025972 | Bacteria | 1673 |
| 146 | Ga0207668_10203836 | 3300025972 | Bacteria | 1577 |
| 147 | Ga0207640_10254271 | 3300025981 | Bacteria | 1365 |
| 148 | Ga0207677_10040020 | 3300026023 | Bacteria | 3087 |
| 149 | Ga0207703_10345003 | 3300026035 | Bacteria | 1370 |
| 150 | Ga0207639_10026817 | 3300026041 | Bacteria | 4189 |
| 151 | Ga0207678_10019008 | 3300026067 | Bacteria | 6036 |
| 152 | Ga0207678_10048990 | 3300026067 | Bacteria | 3651 |
| 153 | Ga0207678_10064930 | 3300026067 | Bacteria | 3136 |
| 154 | Ga0207702_10065643 | 3300026078 | Bacteria | 3109 |
| 155 | Ga0207702_10197292 | 3300026078 | Bacteria | 1864 |
| 156 | Ga0207648_10124141 | 3300026089 | Bacteria | 2271 |
| 157 | Ga0207676_10076147 | 3300026095 | Bacteria | 2710 |
| 158 | Ga0207676_10118535 | 3300026095 | Bacteria | 2228 |
| 159 | Ga0207675_100061586 | 3300026118 | Bacteria | 3502 |
| 160 | Ga0207675_100086167 | 3300026118 | Bacteria | 2949 |
| 161 | Ga0207683_10034074 | 3300026121 | Bacteria | 4425 |
| 162 | Ga0207683_10056565 | 3300026121 | Bacteria | 3441 |
| 163 | Ga0207683_10158379 | 3300026121 | Bacteria | 2046 |
| 164 | Ga0207698_10044572 | 3300026142 | Bacteria | 3334 |
| 165 | Ga0209389_1000024 | 3300027296 | Bacteria | 150002 |
| 166 | Ga0209589_1003796 | 3300027357 | Bacteria | 26331 |
| 167 | Ga0209589_1005115 | 3300027357 | Bacteria | 22395 |
| 168 | Ga0209489_100052 | 3300027361 | Bacteria | 150002 |
| 169 | Ga0209813_10000399 | 3300027866 | Bacteria | 10715 |
| 170 | Ga0207428_10008351 | 3300027907 | Bacteria | 9355 |
| 171 | Ga0268266_10031546 | 3300028379 | Bacteria | 4501 |
| 172 | Ga0268266_10128919 | 3300028379 | Bacteria | 2261 |
| 173 | Ga0268266_10307520 | 3300028379 | Bacteria | 1480 |
| 174 | Ga0268265_10189816 | 3300028380 | Bacteria | 1773 |
| 175 | Ga0265327_10004333 | 3300031251 | Bacteria | 12648 |
| 176 | Ga0265313_10057963 | 3300031595 | Bacteria | 1826 |
| 177 | Ga0307516_10065839 | 3300031730 | Bacteria | 3498 |
| 178 | Ga0316577_10112697 | 3300031733 | Bacteria | 1526 |
| 179 | Ga0307407_10093963 | 3300031903 | Bacteria | 1845 |
| 180 | Ga0307411_10270859 | 3300032005 | Bacteria | 1346 |
| 181 | Ga0307510_10003194 | 3300033180 | Bacteria | 19031 |
| 182 | Ga0373923_0027683 | 3300035111 | Bacteria | 2262 |
| 183 | Ga0373936_0082045 | 3300035113 | Bacteria | 1343 |
| 184 | Ga0373945_0009771 | 3300035116 | Bacteria | 3148 |
| 185 | Ga0373954_0019248 | 3300035118 | Bacteria | 3078 |
| 186 | Ga0373954_0115178 | 3300035118 | Bacteria | 1302 |
| 187 | Ga0373946_0018711 | 3300035171 | Bacteria | 2662 |
| 188 | Ga0373955_0105907 | 3300035172 | Bacteria | 1620 |
| 189 | Ga0373955_0182429 | 3300035172 | Bacteria | 1246 |
| 190 | Ga0373935_0104078 | 3300035692 | Bacteria | 1875 |
| 191 | Ga0373927_0103855 | 3300035695 | Bacteria | 1849 |
| 192 | Ga0395900_0002386 | 3300037418 | Bacteria | 20745 |
| 193 | Ga0395898_0016285 | 3300037466 | Bacteria | 7608 |
| 194 | Ga0395898_0019202 | 3300037466 | Bacteria | 6959 |
| 195 | Ga0395905_0004620 | 3300037471 | Bacteria | 14248 |
| 196 | Ga0436364_0248881 | 3300037853 | Bacteria | 2905 |
| 197 | Ga0436364_0431342 | 3300037853 | Bacteria | 1603 |
| 198 | Ga0436364_1273206 | 3300037853 | Bacteria | 77554 |
| 199 | Ga0436365_1256094 | 3300039437 | Bacteria | 14655 |
| 200 | Ga0436365_1696728 | 3300039437 | Bacteria | 1876 |
| 201 | Ga0436360_0347114 | 3300039438 | Bacteria | 1786 |
| 202 | Ga0436361_1093097 | 3300039447 | Bacteria | 2743 |
| 203 | Ga0451577_0092182 | 3300042876 | Bacteria | 2705 |
| 204 | Ga0466966_0005443 | 3300044684 | Bacteria | 8370 |
| 205 | Ga0466961_0000005 | 3300044693 | Bacteria | 173105 |
| 206 | Ga0466961_0051971 | 3300044693 | Bacteria | 2616 |
| 207 | Ga0453684_0010690 | 3300044712 | Bacteria | 15611 |
| 208 | Ga0466959_0000670 | 3300045049 | Bacteria | 20009 |
| 209 | Ga0466967_0189250 | 3300045976 | Bacteria | 1944 |
| 210 | Ga0495592_0024959 | 3300046454 | Bacteria | 4541 |
| 211 | Ga0495592_0094167 | 3300046454 | Bacteria | 2144 |
| 212 | Ga0495592_0230816 | 3300046454 | Bacteria | 1232 |
| 213 | Ga0495603_0063652 | 3300046455 | Bacteria | 2176 |
| 214 | Ga0495641_0047695 | 3300046461 | Bacteria | 1966 |
| 215 | Ga0495651_0013345 | 3300046462 | Bacteria | 6356 |
| 216 | Ga0495651_0076548 | 3300046462 | Bacteria | 2534 |
| 217 | Ga0495653_0110125 | 3300046463 | Bacteria | 1980 |
| 218 | Ga0495639_0015814 | 3300046475 | Bacteria | 3272 |
| 219 | Ga0495664_0074955 | 3300046477 | Bacteria | 2024 |
| 220 | Ga0495608_0010208 | 3300046511 | Bacteria | 6554 |
| 221 | Ga0495610_0075781 | 3300046512 | Bacteria | 1557 |
| 222 | Ga0495628_0032324 | 3300046516 | Bacteria | 4225 |
| 223 | Ga0495628_0151911 | 3300046516 | Bacteria | 1763 |
| 224 | Ga0495630_0081798 | 3300046517 | Bacteria | 2437 |
| 225 | Ga0495666_0044930 | 3300046526 | Bacteria | 2132 |
| 226 | Ga0495652_0011068 | 3300046529 | Bacteria | 8174 |
| 227 | Ga0495652_0110738 | 3300046529 | Bacteria | 2208 |
| 228 | Ga0495665_0074743 | 3300046531 | Bacteria | 1784 |
| 229 | Ga0495640_0028164 | 3300046533 | Bacteria | 4047 |
| 230 | Ga0495621_0010893 | 3300046539 | Bacteria | 2797 |
| 231 | Ga0495645_0006653 | 3300046543 | Bacteria | 8029 |
| 232 | Ga0495645_0047674 | 3300046543 | Bacteria | 3121 |
| 233 | Ga0495667_0013229 | 3300046559 | Bacteria | 5588 |
| 234 | Ga0495634_0072371 | 3300046642 | Bacteria | 2267 |
| 235 | Ga0495611_0031362 | 3300046648 | Bacteria | 2339 |
| 236 | Ga0495625_0275743 | 3300046660 | Bacteria | 1084 |
| 237 | Ga0495635_0036638 | 3300046663 | Bacteria | 3399 |
| 238 | Ga0495635_0062636 | 3300046663 | Bacteria | 2554 |
| 239 | Ga0495661_0119560 | 3300046665 | Bacteria | 1457 |
| 240 | Ga0495588_0007702 | 3300046674 | Bacteria | 4918 |
| 241 | Ga0495657_0184458 | 3300046675 | Bacteria | 1278 |
| 242 | Ga0495599_0003706 | 3300046678 | Bacteria | 8956 |
| 243 | Ga0495646_0069240 | 3300046680 | Bacteria | 2082 |
| 244 | Ga0495613_0194532 | 3300046689 | Bacteria | 1432 |
| 245 | Ga0495649_0005466 | 3300046694 | Bacteria | 8073 |
| 246 | Ga0495600_0041009 | 3300046809 | Bacteria | 3017 |
| 247 | Ga0495604_0024214 | 3300047317 | Bacteria | 4845 |
| 248 | Ga0495604_0087137 | 3300047317 | Bacteria | 2326 |
| 249 | Ga0495604_0228843 | 3300047317 | Bacteria | 1276 |
| 250 | Ga0495674_0002679 | 3300047319 | Bacteria | 17337 |
| 251 | Ga0495674_0139262 | 3300047319 | Bacteria | 2040 |
| 252 | Ga0495680_0002674 | 3300047322 | Bacteria | 17996 |
| 253 | Ga0495683_0024584 | 3300047323 | Bacteria | 3091 |
| 254 | Ga0495685_056337 | 3300047447 | Bacteria | 1329 |
| 255 | Ga0495684_0015062 | 3300047471 | Bacteria | 5955 |
| 256 | Ga0495686_0087406 | 3300047472 | Bacteria | 1896 |
| 257 | Ga0495602_0007206 | 3300048088 | Bacteria | 11654 |
| 258 | Ga0495602_0082987 | 3300048088 | Bacteria | 2687 |
| 259 | Ga0495615_0002319 | 3300048090 | Bacteria | 3036 |
| 260 | Ga0496100_0033086 | 3300048903 | Bacteria | 3232 |
| 261 | Ga0496100_0050423 | 3300048903 | Bacteria | 2697 |
| 262 | Ga0496101_0118596 | 3300048904 | Bacteria | 1999 |
| 263 | Ga0496101_0306549 | 3300048904 | Bacteria | 1244 |
| 264 | Ga0496102_0001773 | 3300048905 | Bacteria | 18732 |
| 265 | Ga0496102_0170473 | 3300048905 | Bacteria | 2049 |
| 266 | Ga0496103_0020201 | 3300048906 | Bacteria | 4000 |
| 267 | Ga0496103_0026425 | 3300048906 | Bacteria | 3515 |
| 268 | Ga0496104_0017161 | 3300048907 | Bacteria | 6584 |
| 269 | Ga0496104_0029286 | 3300048907 | Bacteria | 5107 |
| 270 | Ga0496105_0017385 | 3300048908 | Bacteria | 5764 |
| 271 | Ga0496106_0077099 | 3300048909 | Bacteria | 2556 |
| 272 | Ga0496107_0000906 | 3300048910 | Bacteria | 17468 |
| 273 | Ga0496110_0012336 | 3300048913 | Bacteria | 7027 |
| 274 | Ga0496110_0061908 | 3300048913 | Bacteria | 3304 |
| 275 | Ga0496111_0033818 | 3300048914 | Bacteria | 3647 |
| 276 | Ga0496112_0019875 | 3300048915 | Bacteria | 6355 |
| 277 | Ga0496112_0040104 | 3300048915 | Bacteria | 4578 |
| 278 | Ga0496112_0195677 | 3300048915 | Bacteria | 1982 |
| 279 | Ga0496113_0005552 | 3300048916 | Bacteria | 7879 |
| 280 | Ga0496114_0019194 | 3300048917 | Bacteria | 5538 |
| 281 | Ga0496114_0026084 | 3300048917 | Bacteria | 4782 |
| 282 | Ga0496114_0305986 | 3300048917 | Unclassified | 1404 |
| 283 | Ga0496115_0001360 | 3300048918 | Bacteria | 17447 |
| 284 | Ga0496115_0150331 | 3300048918 | Bacteria | 1923 |
| 285 | Ga0496115_0301771 | 3300048918 | Bacteria | 1312 |
| 286 | Ga0496116_0100298 | 3300048919 | Bacteria | 1732 |
| 287 | Ga0496118_0042947 | 3300048921 | Bacteria | 3560 |
| 288 | Ga0496118_0049435 | 3300048921 | Bacteria | 3238 |
| 289 | Ga0496120_0013470 | 3300048923 | Bacteria | 5502 |
| 290 | Ga0496121_0012060 | 3300048924 | Bacteria | 9495 |
| 291 | Ga0496121_0179734 | 3300048924 | Bacteria | 1528 |
| 292 | Ga0496126_0046554 | 3300048929 | Bacteria | 3977 |
| 293 | Ga0495682_0002812 | 3300049460 | Bacteria | 8029 |
| 294 | Ga0501047_0109214 | 3300049581 | Bacteria | 2649 |
| 295 | Ga0501047_0124801 | 3300049581 | Bacteria | 2455 |
| 296 | Ga0501074_0034434 | 3300049590 | Bacteria | 3671 |
| 297 | Ga0501080_0060687 | 3300049742 | Bacteria | 3520 |
| 298 | Ga0501083_0048935 | 3300049744 | Bacteria | 2852 |
| 299 | Ga0501044_0052681 | 3300049823 | Bacteria | 4191 |
| 300 | nmdc:mga00v17_15228_c1 | 3300050491 | Bacteria | 4312 |
| 301 | nmdc:mga0yw44_132195_c1 | 3300050492 | Bacteria | 1616 |
| 302 | nmdc:mga0yw44_13968_c1 | 3300050492 | Bacteria | 4247 |
| 303 | nmdc:mga0yw44_149011_c1 | 3300050492 | Bacteria | 1525 |
| 304 | nmdc:mga0yw44_2679_c1 | 3300050492 | Bacteria | 7683 |
| 305 | nmdc:mga04h51_362_c1 | 3300050495 | Bacteria | 11218 |
| 306 | nmdc:mga06r32_237250_c1 | 3300050510 | Bacteria | 1811 |
| 307 | nmdc:mga08y16_153491_c1 | 3300050511 | Bacteria | 2393 |
| 308 | nmdc:mga08y16_4071_c1 | 3300050511 | Bacteria | 15268 |
| 309 | nmdc:mga0a205_133450_c1 | 3300050515 | Bacteria | 2383 |
| 310 | nmdc:mga0a205_29655_c1 | 3300050515 | Bacteria | 5236 |
| 311 | nmdc:mga0sz30_7767_c1 | 3300050516 | Bacteria | 4031 |
| 312 | Ga0495601_0011448 | 3300053077 | Bacteria | 5306 |
| 313 | Ga0495595_0087472 | 3300053084 | Bacteria | 1492 |
| 314 | Ga0495619_0015097 | 3300053085 | Bacteria | 4881 |
| 315 | Ga0500578_0009955 | 3300053086 | Bacteria | 6168 |
| 316 | Ga0500566_0000562 | 3300053094 | Bacteria | 20869 |
| 317 | Ga0500566_0001998 | 3300053094 | Bacteria | 12032 |
| 318 | Ga0500641_0008314 | 3300053096 | Bacteria | 3701 |
| 319 | Ga0500557_000003 | 3300053105 | Bacteria | 228429 |
| 320 | Ga0500595_001143 | 3300053119 | Bacteria | 14723 |
| 321 | Ga0500559_0007895 | 3300053136 | Bacteria | 4693 |
| 322 | Ga0500620_001310 | 3300053155 | Bacteria | 4509 |
| 323 | Ga0500638_030123 | 3300053162 | Bacteria | 2611 |
| 324 | Ga0500636_0110363 | 3300053177 | Bacteria | 1555 |
| 325 | Ga0500637_0000068 | 3300053178 | Bacteria | 37212 |
| 326 | Ga0500625_007016 | 3300053729 | Bacteria | 4854 |
| 327 | Ga0500661_000814 | 3300055283 | Bacteria | 5813 |
| 328 | Ga0501082_0000057 | 3300060353 | Bacteria | 79254 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006881 | Ga0068865_100117214 | Ga0068865_1001172143 | 321 |
| 2 | 3300046533 | Ga0495640_0028164 | Ga0495640_0028164_3050_4024 | 323 |
| 3 | 3300046660 | Ga0495625_0275743 | Ga0495625_0275743_40_1014 | 323 |
| 4 | 3300046675 | Ga0495657_0184458 | Ga0495657_0184458_27_1001 | 323 |
| 5 | 3300053085 | Ga0495619_0015097 | Ga0495619_0015097_11_985 | 323 |
| 6 | 3300053162 | Ga0500638_030123 | Ga0500638_030123_1593_2567 | 323 |
| 7 | 3300035172 | Ga0373955_0182429 | Ga0373955_0182429_224_1201 | 324 |
| 8 | 3300046454 | Ga0495592_0094167 | Ga0495592_0094167_1132_2109 | 324 |
| 9 | 3300046680 | Ga0495646_0069240 | Ga0495646_0069240_103_1080 | 324 |
| 10 | 3300025929 | Ga0207664_10421647 | Ga0207664_104216471 | 334 |
| 11 | 3300050510 | nmdc:mga06r32_237250_c1 | nmdc:mga06r32_237250_c1_41_1054 | 336 |
| 12 | 3300025912 | Ga0207707_10393306 | Ga0207707_103933062 | 338 |
| 13 | 3300039447 | Ga0436361_1093097 | Ga0436361_1093097_1120_2277 | 343 |
| 14 | 3300048924 | Ga0496121_0179734 | Ga0496121_0179734_21_1055 | 343 |
| 15 | 3300046663 | Ga0495635_0062636 | Ga0495635_0062636_1491_2531 | 345 |
| 16 | 3300053094 | Ga0500566_0000562 | Ga0500566_0000562_3928_4968 | 345 |
| 17 | 3300037853 | Ga0436364_0431342 | Ga0436364_0431342_528_1574 | 347 |
| 18 | 3300025916 | Ga0207663_10069022 | Ga0207663_100690224 | 349 |
| 19 | 3300009094 | Ga0111539_10172637 | Ga0111539_101726373 | 351 |
| 20 | 3300011119 | Ga0105246_10317818 | Ga0105246_103178181 | 351 |
| 21 | 3300046539 | Ga0495621_0010893 | Ga0495621_0010893_715_1848 | 352 |
| 22 | iso_pu_bacteria | 8019608314 | 8019609320 | 352 |
| 23 | iso_pu_bacteria | 8016539877 | 8016546920 | 360 |
| 24 | 3300003203 | JGI25406J46586_10001296 | JGI25406J46586_1000129610 | 363 |
| 25 | 3300005985 | Ga0081539_10000350 | Ga0081539_1000035073 | 363 |
| 26 | 3300006942 | Ga0099824_1007458 | Ga0099824_100745816 | 364 |
| 27 | 3300006943 | Ga0099822_1042043 | Ga0099822_10420432 | 364 |
| 28 | 3300021321 | Ga0214542_1005215 | Ga0214542_100521511 | 364 |
| 29 | 3300021327 | Ga0214543_1000066 | Ga0214543_100006686 | 364 |
| 30 | 3300027296 | Ga0209389_1000024 | Ga0209389_100002490 | 364 |
| 31 | 3300027357 | Ga0209589_1003796 | Ga0209589_100379623 | 364 |
| 32 | 3300027361 | Ga0209489_100052 | Ga0209489_10005290 | 364 |
| 33 | 3300006943 | Ga0099822_1019645 | Ga0099822_10196459 | 365 |
| 34 | 3300027357 | Ga0209589_1005115 | Ga0209589_100511525 | 365 |
| 35 | 3300026067 | Ga0207678_10019008 | Ga0207678_100190083 | 366 |
| 36 | 3300048909 | Ga0496106_0077099 | Ga0496106_0077099_471_1646 | 366 |
| 37 | 3300021388 | Ga0213875_10007644 | Ga0213875_100076443 | 367 |
| 38 | 3300037853 | Ga0436364_1273206 | Ga0436364_1273206_72565_73698 | 367 |
| 39 | iso_pu_bacteria | 3005710791 | 3005715947 | 367 |
| 40 | iso_pu_bacteria | 2508501009 | 2508541632 | 372 |
| 41 | iso_pu_bacteria | 2508501042 | 2508692828 | 372 |
| 42 | iso_pu_bacteria | 2508501128 | 2509151021 | 372 |
| 43 | iso_pu_bacteria | 2513237092 | 2513625964 | 372 |
| 44 | iso_pu_bacteria | 2513237141 | 2513887296 | 372 |
| 45 | iso_pu_bacteria | 2528768022 | 2528857191 | 372 |
| 46 | iso_pu_bacteria | 2617270735 | 2617353996 | 372 |
| 47 | iso_pu_bacteria | 2791355199 | 2793079544 | 372 |
| 48 | iso_pu_bacteria | 2824600985 | 2824602928 | 372 |
| 49 | iso_pu_bacteria | 2824609381 | 2824611849 | 372 |
| 50 | iso_pu_bacteria | 2824653114 | 2824655080 | 372 |
| 51 | iso_pu_bacteria | 2824661429 | 2824664462 | 372 |
| 52 | iso_pu_bacteria | 2824671348 | 2824672257 | 372 |
| 53 | iso_pu_bacteria | 2824687955 | 2824688860 | 372 |
| 54 | iso_pu_bacteria | 2824704595 | 2824708463 | 372 |
| 55 | iso_pu_bacteria | 2824753945 | 2824757972 | 372 |
| 56 | iso_pu_bacteria | 2824763712 | 2824766493 | 372 |
| 57 | iso_pu_bacteria | 2874590934 | 2874593860 | 372 |
| 58 | iso_pu_bacteria | 2874590934 | 2874598629 | 372 |
| 59 | iso_pu_bacteria | 2874645413 | 2874652083 | 372 |
| 60 | iso_pu_bacteria | 2876771140 | 2876773491 | 372 |
| 61 | iso_pu_bacteria | 2876771140 | 2876778668 | 372 |
| 62 | iso_pu_bacteria | 2876818435 | 2876821713 | 372 |
| 63 | iso_pu_bacteria | 2876818435 | 2876823472 | 372 |
| 64 | iso_pu_bacteria | 2879074833 | 2879077406 | 372 |
| 65 | iso_pu_bacteria | 2879074833 | 2879082461 | 372 |
| 66 | iso_pu_bacteria | 2879099564 | 2879107859 | 372 |
| 67 | iso_pu_bacteria | 2888419890 | 2888425741 | 372 |
| 68 | iso_pu_bacteria | 2889033259 | 2889033652 | 372 |
| 69 | iso_pu_bacteria | 2904690495 | 2904693533 | 372 |
| 70 | iso_pu_bacteria | 2904711408 | 2904711809 | 372 |
| 71 | iso_pu_bacteria | 2922361189 | 2922367017 | 372 |
| 72 | iso_pu_bacteria | 2922368715 | 2922375865 | 372 |
| 73 | iso_pu_bacteria | 2929615660 | 2929621180 | 372 |
| 74 | iso_pu_bacteria | 2929624759 | 2929625989 | 372 |
| 75 | iso_pu_bacteria | 2932784394 | 2932785130 | 372 |
| 76 | iso_pu_bacteria | 2932809354 | 2932810157 | 372 |
| 77 | iso_pu_bacteria | 2932818245 | 2932821731 | 372 |
| 78 | iso_pu_bacteria | 2932828146 | 2932828967 | 372 |
| 79 | iso_pu_bacteria | 2933577622 | 2933582951 | 372 |
| 80 | iso_pu_bacteria | 2935608549 | 2935609976 | 372 |
| 81 | iso_pu_bacteria | 2935616580 | 2935619614 | 372 |
| 82 | iso_pu_bacteria | 2935638405 | 2935638594 | 372 |
| 83 | iso_pu_bacteria | 2935648319 | 2935651992 | 372 |
| 84 | iso_pu_bacteria | 2935656913 | 2935660035 | 372 |
| 85 | iso_pu_bacteria | 2935665750 | 2935666554 | 372 |
| 86 | iso_pu_bacteria | 2935675223 | 2935676402 | 372 |
| 87 | iso_pu_bacteria | 2935684952 | 2935691081 | 372 |
| 88 | iso_pu_bacteria | 2935694250 | 2935694486 | 372 |
| 89 | iso_pu_bacteria | 2935703347 | 2935703600 | 372 |
| 90 | iso_pu_bacteria | 2935713505 | 2935718462 | 372 |
| 91 | iso_pu_bacteria | 2935722832 | 2935727558 | 372 |
| 92 | iso_pu_bacteria | 2935732158 | 2935736261 | 372 |
| 93 | iso_pu_bacteria | 2935741537 | 2935745641 | 372 |
| 94 | iso_pu_bacteria | 2935750917 | 2935756022 | 372 |
| 95 | iso_pu_bacteria | 2935760218 | 2935760718 | 372 |
| 96 | iso_pu_bacteria | 2935769743 | 2935777135 | 372 |
| 97 | iso_pu_bacteria | 2935777560 | 2935780806 | 372 |
| 98 | iso_pu_bacteria | 2935785616 | 2935793017 | 372 |
| 99 | iso_pu_bacteria | 2935793552 | 2935801018 | 372 |
| 100 | iso_pu_bacteria | 2935801545 | 2935801737 | 372 |
| 101 | iso_pu_bacteria | 2935819856 | 2935823136 | 372 |
| 102 | iso_pu_bacteria | 2935819856 | 2935827880 | 372 |
| 103 | iso_pu_bacteria | 2935827899 | 2935828088 | 372 |
| 104 | iso_pu_bacteria | 2935837841 | 2935842293 | 372 |
| 105 | iso_pu_bacteria | 2935847175 | 2935848718 | 372 |
| 106 | iso_pu_bacteria | 2935847175 | 2935855181 | 372 |
| 107 | iso_pu_bacteria | 2935855204 | 2935858070 | 372 |
| 108 | iso_pu_bacteria | 2935864058 | 2935867975 | 372 |
| 109 | iso_pu_bacteria | 2935873716 | 2935874002 | 372 |
| 110 | iso_pu_bacteria | 2935908558 | 2935909476 | 372 |
| 111 | iso_pu_bacteria | 2935916978 | 2935917200 | 372 |
| 112 | iso_pu_bacteria | 2935926038 | 2935926957 | 372 |
| 113 | iso_pu_bacteria | 2935934488 | 2935937199 | 372 |
| 114 | iso_pu_bacteria | 2935942939 | 2935944498 | 372 |
| 115 | iso_pu_bacteria | 2935951376 | 2935952935 | 372 |
| 116 | iso_pu_bacteria | 2935959822 | 2935962868 | 372 |
| 117 | iso_pu_bacteria | 2935967501 | 2935969775 | 372 |
| 118 | iso_pu_bacteria | 2935975950 | 2935983700 | 372 |
| 119 | iso_pu_bacteria | 2935984226 | 2935987180 | 372 |
| 120 | iso_pu_bacteria | 2935992306 | 2935993074 | 372 |
| 121 | iso_pu_bacteria | 2936002035 | 2936002986 | 372 |
| 122 | iso_pu_bacteria | 2936011229 | 2936014451 | 372 |
| 123 | iso_pu_bacteria | 2936019824 | 2936023709 | 372 |
| 124 | iso_pu_bacteria | 2936028420 | 2936031352 | 372 |
| 125 | iso_pu_bacteria | 2936046547 | 2936049557 | 372 |
| 126 | iso_pu_bacteria | 2936055302 | 2936061228 | 372 |
| 127 | iso_pu_bacteria | 2940556831 | 2940562003 | 372 |
| 128 | iso_pu_bacteria | 2941531003 | 2941531344 | 372 |
| 129 | iso_pu_bacteria | 2941538514 | 2941542342 | 372 |
| 130 | iso_pu_bacteria | 3005587118 | 3005590763 | 372 |
| 131 | iso_pu_bacteria | 3005718088 | 3005723304 | 372 |
| 132 | iso_pu_bacteria | 8006964411 | 8006966553 | 372 |
| 133 | iso_pu_bacteria | 8006984368 | 8006989960 | 372 |
| 134 | iso_pu_bacteria | 8006994254 | 8006997866 | 372 |
| 135 | iso_pu_bacteria | 8016511872 | 8016520494 | 372 |
| 136 | iso_pu_bacteria | 8016530956 | 8016533701 | 372 |
| 137 | iso_pu_bacteria | 8016548790 | 8016555195 | 372 |
| 138 | iso_pu_bacteria | 8016557553 | 8016563564 | 372 |
| 139 | iso_pu_bacteria | 8016575299 | 8016576232 | 372 |
| 140 | iso_pu_bacteria | 8016583857 | 8016584854 | 372 |
| 141 | iso_pu_bacteria | 8016595262 | 8016601299 | 372 |
| 142 | iso_pu_bacteria | 8016630954 | 8016639012 | 372 |
| 143 | iso_pu_bacteria | 8017057580 | 8017065080 | 372 |
| 144 | iso_pu_bacteria | 8019530166 | 8019533478 | 372 |
| 145 | iso_pu_bacteria | 8019538911 | 8019546201 | 372 |
| 146 | iso_pu_bacteria | 8019547302 | 8019552508 | 372 |
| 147 | iso_pu_bacteria | 8019576017 | 8019584463 | 372 |
| 148 | iso_pu_bacteria | 8019586578 | 8019592237 | 372 |
| 149 | iso_pu_bacteria | 8019597564 | 8019599048 | 372 |
| 150 | iso_pu_bacteria | 8019629233 | 8019631790 | 372 |
| 151 | iso_pu_bacteria | 8019678201 | 8019686889 | 372 |
| 152 | iso_pu_bacteria | 8055742211 | 8055744958 | 372 |
| 153 | iso_pu_bacteria | 8056673599 | 8056677919 | 372 |
| 154 | 3300021321 | Ga0214542_1007226 | Ga0214542_100722623 | 373 |
| 155 | 3300005718 | Ga0068866_10118086 | Ga0068866_101180861 | 374 |
| 156 | 3300005468 | Ga0070707_100255290 | Ga0070707_1002552902 | 375 |
| 157 | 3300005471 | Ga0070698_100206960 | Ga0070698_1002069601 | 375 |
| 158 | 3300006175 | Ga0070712_100224053 | Ga0070712_1002240532 | 375 |
| 159 | 3300025906 | Ga0207699_10050077 | Ga0207699_100500772 | 375 |
| 160 | 3300025913 | Ga0207695_10155984 | Ga0207695_101559841 | 375 |
| 161 | 3300039437 | Ga0436365_1696728 | Ga0436365_1696728_104_1234 | 375 |
| 162 | 3300045976 | Ga0466967_0189250 | Ga0466967_0189250_371_1501 | 375 |
| 163 | 3300047323 | Ga0495683_0024584 | Ga0495683_0024584_1026_2189 | 375 |
| 164 | 3300048918 | Ga0496115_0301771 | Ga0496115_0301771_139_1269 | 375 |
| 165 | 3300053086 | Ga0500578_0009955 | Ga0500578_0009955_5022_6155 | 375 |
| 166 | 3300053096 | Ga0500641_0008314 | Ga0500641_0008314_1563_2693 | 375 |
| 167 | 3300003215 | JGI25153J46596_10035274 | JGI25153J46596_100352741 | 376 |
| 168 | 3300005262 | Ga0065165_1020424 | Ga0065165_10204242 | 376 |
| 169 | 3300005329 | Ga0070683_100001874 | Ga0070683_10000187415 | 376 |
| 170 | 3300005329 | Ga0070683_100045473 | Ga0070683_1000454734 | 376 |
| 171 | 3300005330 | Ga0070690_100162825 | Ga0070690_1001628251 | 376 |
| 172 | 3300005333 | Ga0070677_10019508 | Ga0070677_100195083 | 376 |
| 173 | 3300005336 | Ga0070680_100003676 | Ga0070680_10000367612 | 376 |
| 174 | 3300005337 | Ga0070682_100006000 | Ga0070682_1000060004 | 376 |
| 175 | 3300005338 | Ga0068868_100054694 | Ga0068868_1000546944 | 376 |
| 176 | 3300005347 | Ga0070668_100106152 | Ga0070668_1001061523 | 376 |
| 177 | 3300005356 | Ga0070674_100002871 | Ga0070674_1000028714 | 376 |
| 178 | 3300005364 | Ga0070673_100026051 | Ga0070673_1000260512 | 376 |
| 179 | 3300005434 | Ga0070709_10036848 | Ga0070709_100368484 | 376 |
| 180 | 3300005439 | Ga0070711_100047974 | Ga0070711_1000479742 | 376 |
| 181 | 3300005456 | Ga0070678_100006657 | Ga0070678_1000066575 | 376 |
| 182 | 3300005456 | Ga0070678_100009672 | Ga0070678_1000096722 | 376 |
| 183 | 3300005456 | Ga0070678_100087923 | Ga0070678_1000879233 | 376 |
| 184 | 3300005458 | Ga0070681_10001873 | Ga0070681_100018735 | 376 |
| 185 | 3300005458 | Ga0070681_10146946 | Ga0070681_101469462 | 376 |
| 186 | 3300005458 | Ga0070681_10446618 | Ga0070681_104466181 | 376 |
| 187 | 3300005459 | Ga0068867_100085436 | Ga0068867_1000854362 | 376 |
| 188 | 3300005530 | Ga0070679_100002797 | Ga0070679_1000027975 | 376 |
| 189 | 3300005530 | Ga0070679_100100678 | Ga0070679_1001006782 | 376 |
| 190 | 3300005530 | Ga0070679_100167872 | Ga0070679_1001678722 | 376 |
| 191 | 3300005535 | Ga0070684_100008931 | Ga0070684_1000089314 | 376 |
| 192 | 3300005548 | Ga0070665_100045036 | Ga0070665_1000450365 | 376 |
| 193 | 3300005548 | Ga0070665_100374245 | Ga0070665_1003742451 | 376 |
| 194 | 3300005719 | Ga0068861_100141120 | Ga0068861_1001411202 | 376 |
| 195 | 3300005842 | Ga0068858_100154404 | Ga0068858_1001544042 | 376 |
| 196 | 3300005844 | Ga0068862_100033846 | Ga0068862_1000338466 | 376 |
| 197 | 3300005937 | Ga0081455_10004153 | Ga0081455_1000415317 | 376 |
| 198 | 3300005937 | Ga0081455_10053509 | Ga0081455_100535092 | 376 |
| 199 | 3300005937 | Ga0081455_10122901 | Ga0081455_101229011 | 376 |
| 200 | 3300005983 | Ga0081540_1005374 | Ga0081540_10053744 | 376 |
| 201 | 3300005983 | Ga0081540_1006622 | Ga0081540_10066227 | 376 |
| 202 | 3300006038 | Ga0075365_10000815 | Ga0075365_1000081510 | 376 |
| 203 | 3300006038 | Ga0075365_10070614 | Ga0075365_100706143 | 376 |
| 204 | 3300006038 | Ga0075365_10088357 | Ga0075365_100883572 | 376 |
| 205 | 3300006038 | Ga0075365_10148590 | Ga0075365_101485902 | 376 |
| 206 | 3300006042 | Ga0075368_10001452 | Ga0075368_100014526 | 376 |
| 207 | 3300006042 | Ga0075368_10018965 | Ga0075368_100189652 | 376 |
| 208 | 3300006175 | Ga0070712_100063784 | Ga0070712_1000637842 | 376 |
| 209 | 3300006177 | Ga0075362_10018906 | Ga0075362_100189062 | 376 |
| 210 | 3300006178 | Ga0075367_10064301 | Ga0075367_100643013 | 376 |
| 211 | 3300006353 | Ga0075370_10084661 | Ga0075370_100846612 | 376 |
| 212 | 3300006353 | Ga0075370_10116431 | Ga0075370_101164312 | 376 |
| 213 | 3300006844 | Ga0075428_100430849 | Ga0075428_1004308492 | 376 |
| 214 | 3300009093 | Ga0105240_10081044 | Ga0105240_100810442 | 376 |
| 215 | 3300009098 | Ga0105245_10155464 | Ga0105245_101554642 | 376 |
| 216 | 3300009545 | Ga0105237_10073458 | Ga0105237_100734582 | 376 |
| 217 | 3300009545 | Ga0105237_10104392 | Ga0105237_101043922 | 376 |
| 218 | 3300009551 | Ga0105238_10190146 | Ga0105238_101901462 | 376 |
| 219 | 3300010375 | Ga0105239_10231368 | Ga0105239_102313682 | 376 |
| 220 | 3300011119 | Ga0105246_10014157 | Ga0105246_100141574 | 376 |
| 221 | 3300013105 | Ga0157369_10004167 | Ga0157369_1000416712 | 376 |
| 222 | 3300013105 | Ga0157369_10027253 | Ga0157369_100272535 | 376 |
| 223 | 3300013105 | Ga0157369_10273916 | Ga0157369_102739162 | 376 |
| 224 | 3300013296 | Ga0157374_10063013 | Ga0157374_100630132 | 376 |
| 225 | 3300013296 | Ga0157374_10087636 | Ga0157374_100876363 | 376 |
| 226 | 3300013306 | Ga0163162_10200112 | Ga0163162_102001122 | 376 |
| 227 | 3300013308 | Ga0157375_10043838 | Ga0157375_100438384 | 376 |
| 228 | 3300013308 | Ga0157375_10045375 | Ga0157375_100453753 | 376 |
| 229 | 3300013308 | Ga0157375_10248374 | Ga0157375_102483741 | 376 |
| 230 | 3300014325 | Ga0163163_10031684 | Ga0163163_100316845 | 376 |
| 231 | 3300014968 | Ga0157379_10105334 | Ga0157379_101053344 | 376 |
| 232 | 3300014969 | Ga0157376_10007978 | Ga0157376_100079786 | 376 |
| 233 | 3300017792 | Ga0163161_10075526 | Ga0163161_100755262 | 376 |
| 234 | 3300021320 | Ga0214544_1003153 | Ga0214544_100315310 | 376 |
| 235 | 3300021320 | Ga0214544_1006247 | Ga0214544_100624713 | 376 |
| 236 | 3300021321 | Ga0214542_1001978 | Ga0214542_10019787 | 376 |
| 237 | 3300021321 | Ga0214542_1002098 | Ga0214542_100209818 | 376 |
| 238 | 3300021327 | Ga0214543_1004129 | Ga0214543_100412911 | 376 |
| 239 | 3300025261 | Ga0209233_1016706 | Ga0209233_10167061 | 376 |
| 240 | 3300025295 | Ga0209564_1001604 | Ga0209564_100160420 | 376 |
| 241 | 3300025297 | Ga0209758_1001198 | Ga0209758_100119823 | 376 |
| 242 | 3300025302 | Ga0207426_1000292 | Ga0207426_100029216 | 376 |
| 243 | 3300025893 | Ga0207682_10015034 | Ga0207682_100150343 | 376 |
| 244 | 3300025903 | Ga0207680_10045084 | Ga0207680_100450842 | 376 |
| 245 | 3300025909 | Ga0207705_10023490 | Ga0207705_100234902 | 376 |
| 246 | 3300025912 | Ga0207707_10001373 | Ga0207707_100013735 | 376 |
| 247 | 3300025912 | Ga0207707_10035462 | Ga0207707_100354622 | 376 |
| 248 | 3300025913 | Ga0207695_10045295 | Ga0207695_100452952 | 376 |
| 249 | 3300025915 | Ga0207693_10017173 | Ga0207693_100171734 | 376 |
| 250 | 3300025919 | Ga0207657_10072992 | Ga0207657_100729922 | 376 |
| 251 | 3300025921 | Ga0207652_10310525 | Ga0207652_103105252 | 376 |
| 252 | 3300025924 | Ga0207694_10045216 | Ga0207694_100452162 | 376 |
| 253 | 3300025926 | Ga0207659_10285680 | Ga0207659_102856801 | 376 |
| 254 | 3300025927 | Ga0207687_10098420 | Ga0207687_100984202 | 376 |
| 255 | 3300025933 | Ga0207706_10019267 | Ga0207706_100192673 | 376 |
| 256 | 3300025937 | Ga0207669_10031312 | Ga0207669_100313122 | 376 |
| 257 | 3300025937 | Ga0207669_10270509 | Ga0207669_102705091 | 376 |
| 258 | 3300025938 | Ga0207704_10004149 | Ga0207704_100041496 | 376 |
| 259 | 3300025944 | Ga0207661_10000512 | Ga0207661_1000051216 | 376 |
| 260 | 3300025949 | Ga0207667_10171339 | Ga0207667_101713392 | 376 |
| 261 | 3300025949 | Ga0207667_10181764 | Ga0207667_101817642 | 376 |
| 262 | 3300025960 | Ga0207651_10063364 | Ga0207651_100633641 | 376 |
| 263 | 3300025972 | Ga0207668_10050060 | Ga0207668_100500602 | 376 |
| 264 | 3300025972 | Ga0207668_10178376 | Ga0207668_101783761 | 376 |
| 265 | 3300025972 | Ga0207668_10203836 | Ga0207668_102038361 | 376 |
| 266 | 3300025981 | Ga0207640_10254271 | Ga0207640_102542712 | 376 |
| 267 | 3300026023 | Ga0207677_10040020 | Ga0207677_100400203 | 376 |
| 268 | 3300026035 | Ga0207703_10345003 | Ga0207703_103450032 | 376 |
| 269 | 3300026041 | Ga0207639_10026817 | Ga0207639_100268172 | 376 |
| 270 | 3300026067 | Ga0207678_10048990 | Ga0207678_100489904 | 376 |
| 271 | 3300026067 | Ga0207678_10064930 | Ga0207678_100649302 | 376 |
| 272 | 3300026078 | Ga0207702_10065643 | Ga0207702_100656432 | 376 |
| 273 | 3300026078 | Ga0207702_10197292 | Ga0207702_101972922 | 376 |
| 274 | 3300026089 | Ga0207648_10124141 | Ga0207648_101241412 | 376 |
| 275 | 3300026095 | Ga0207676_10076147 | Ga0207676_100761472 | 376 |
| 276 | 3300026095 | Ga0207676_10118535 | Ga0207676_101185352 | 376 |
| 277 | 3300026118 | Ga0207675_100061586 | Ga0207675_1000615863 | 376 |
| 278 | 3300026118 | Ga0207675_100086167 | Ga0207675_1000861674 | 376 |
| 279 | 3300026121 | Ga0207683_10034074 | Ga0207683_100340745 | 376 |
| 280 | 3300026121 | Ga0207683_10056565 | Ga0207683_100565655 | 376 |
| 281 | 3300026121 | Ga0207683_10158379 | Ga0207683_101583791 | 376 |
| 282 | 3300026142 | Ga0207698_10044572 | Ga0207698_100445723 | 376 |
| 283 | 3300027866 | Ga0209813_10000399 | Ga0209813_100003992 | 376 |
| 284 | 3300028379 | Ga0268266_10031546 | Ga0268266_100315464 | 376 |
| 285 | 3300028379 | Ga0268266_10128919 | Ga0268266_101289192 | 376 |
| 286 | 3300028379 | Ga0268266_10307520 | Ga0268266_103075201 | 376 |
| 287 | 3300028380 | Ga0268265_10189816 | Ga0268265_101898162 | 376 |
| 288 | 3300031251 | Ga0265327_10004333 | Ga0265327_100043333 | 376 |
| 289 | 3300031595 | Ga0265313_10057963 | Ga0265313_100579632 | 376 |
| 290 | 3300031730 | Ga0307516_10065839 | Ga0307516_100658395 | 376 |
| 291 | 3300031903 | Ga0307407_10093963 | Ga0307407_100939631 | 376 |
| 292 | 3300032005 | Ga0307411_10270859 | Ga0307411_102708591 | 376 |
| 293 | 3300033180 | Ga0307510_10003194 | Ga0307510_100031944 | 376 |
| 294 | 3300035111 | Ga0373923_0027683 | Ga0373923_0027683_553_1704 | 376 |
| 295 | 3300035113 | Ga0373936_0082045 | Ga0373936_0082045_119_1252 | 376 |
| 296 | 3300035116 | Ga0373945_0009771 | Ga0373945_0009771_324_1475 | 376 |
| 297 | 3300035118 | Ga0373954_0019248 | Ga0373954_0019248_1253_2386 | 376 |
| 298 | 3300035171 | Ga0373946_0018711 | Ga0373946_0018711_685_1836 | 376 |
| 299 | 3300035172 | Ga0373955_0105907 | Ga0373955_0105907_306_1457 | 376 |
| 300 | 3300035692 | Ga0373935_0104078 | Ga0373935_0104078_442_1593 | 376 |
| 301 | 3300035695 | Ga0373927_0103855 | Ga0373927_0103855_211_1362 | 376 |
| 302 | 3300037418 | Ga0395900_0002386 | Ga0395900_0002386_6357_7490 | 376 |
| 303 | 3300037466 | Ga0395898_0016285 | Ga0395898_0016285_1031_2164 | 376 |
| 304 | 3300037466 | Ga0395898_0019202 | Ga0395898_0019202_4809_5942 | 376 |
| 305 | 3300037853 | Ga0436364_0248881 | Ga0436364_0248881_327_1460 | 376 |
| 306 | 3300044684 | Ga0466966_0005443 | Ga0466966_0005443_3181_4323 | 376 |
| 307 | 3300044693 | Ga0466961_0000005 | Ga0466961_0000005_3987_5129 | 376 |
| 308 | 3300044693 | Ga0466961_0051971 | Ga0466961_0051971_1260_2405 | 376 |
| 309 | 3300045049 | Ga0466959_0000670 | Ga0466959_0000670_13854_14996 | 376 |
| 310 | 3300046454 | Ga0495592_0024959 | Ga0495592_0024959_2332_3465 | 376 |
| 311 | 3300046455 | Ga0495603_0063652 | Ga0495603_0063652_667_1800 | 376 |
| 312 | 3300046461 | Ga0495641_0047695 | Ga0495641_0047695_37_1188 | 376 |
| 313 | 3300046462 | Ga0495651_0013345 | Ga0495651_0013345_2095_3228 | 376 |
| 314 | 3300046463 | Ga0495653_0110125 | Ga0495653_0110125_818_1951 | 376 |
| 315 | 3300046475 | Ga0495639_0015814 | Ga0495639_0015814_2074_3225 | 376 |
| 316 | 3300046477 | Ga0495664_0074955 | Ga0495664_0074955_95_1228 | 376 |
| 317 | 3300046511 | Ga0495608_0010208 | Ga0495608_0010208_2410_3543 | 376 |
| 318 | 3300046512 | Ga0495610_0075781 | Ga0495610_0075781_405_1541 | 376 |
| 319 | 3300046516 | Ga0495628_0032324 | Ga0495628_0032324_2235_3368 | 376 |
| 320 | 3300046517 | Ga0495630_0081798 | Ga0495630_0081798_196_1347 | 376 |
| 321 | 3300046526 | Ga0495666_0044930 | Ga0495666_0044930_756_1907 | 376 |
| 322 | 3300046529 | Ga0495652_0011068 | Ga0495652_0011068_4263_5396 | 376 |
| 323 | 3300046531 | Ga0495665_0074743 | Ga0495665_0074743_526_1677 | 376 |
| 324 | 3300046543 | Ga0495645_0006653 | Ga0495645_0006653_646_1779 | 376 |
| 325 | 3300046543 | Ga0495645_0047674 | Ga0495645_0047674_1614_2747 | 376 |
| 326 | 3300046559 | Ga0495667_0013229 | Ga0495667_0013229_1567_2700 | 376 |
| 327 | 3300046642 | Ga0495634_0072371 | Ga0495634_0072371_52_1203 | 376 |
| 328 | 3300046648 | Ga0495611_0031362 | Ga0495611_0031362_132_1265 | 376 |
| 329 | 3300046663 | Ga0495635_0036638 | Ga0495635_0036638_2233_3384 | 376 |
| 330 | 3300046665 | Ga0495661_0119560 | Ga0495661_0119560_137_1270 | 376 |
| 331 | 3300046674 | Ga0495588_0007702 | Ga0495588_0007702_1808_2941 | 376 |
| 332 | 3300046678 | Ga0495599_0003706 | Ga0495599_0003706_3315_4448 | 376 |
| 333 | 3300046689 | Ga0495613_0194532 | Ga0495613_0194532_205_1338 | 376 |
| 334 | 3300046694 | Ga0495649_0005466 | Ga0495649_0005466_5372_6538 | 376 |
| 335 | 3300046809 | Ga0495600_0041009 | Ga0495600_0041009_1710_2843 | 376 |
| 336 | 3300047317 | Ga0495604_0024214 | Ga0495604_0024214_3412_4545 | 376 |
| 337 | 3300047317 | Ga0495604_0228843 | Ga0495604_0228843_62_1195 | 376 |
| 338 | 3300047319 | Ga0495674_0002679 | Ga0495674_0002679_2402_3535 | 376 |
| 339 | 3300047319 | Ga0495674_0139262 | Ga0495674_0139262_530_1681 | 376 |
| 340 | 3300047322 | Ga0495680_0002674 | Ga0495680_0002674_15467_16600 | 376 |
| 341 | 3300047447 | Ga0495685_056337 | Ga0495685_056337_82_1215 | 376 |
| 342 | 3300047471 | Ga0495684_0015062 | Ga0495684_0015062_2905_4056 | 376 |
| 343 | 3300047472 | Ga0495686_0087406 | Ga0495686_0087406_479_1612 | 376 |
| 344 | 3300048088 | Ga0495602_0007206 | Ga0495602_0007206_8215_9348 | 376 |
| 345 | 3300048088 | Ga0495602_0082987 | Ga0495602_0082987_413_1555 | 376 |
| 346 | 3300048090 | Ga0495615_0002319 | Ga0495615_0002319_129_1262 | 376 |
| 347 | 3300048903 | Ga0496100_0033086 | Ga0496100_0033086_195_1337 | 376 |
| 348 | 3300048903 | Ga0496100_0050423 | Ga0496100_0050423_979_2112 | 376 |
| 349 | 3300048904 | Ga0496101_0306549 | Ga0496101_0306549_38_1171 | 376 |
| 350 | 3300048905 | Ga0496102_0001773 | Ga0496102_0001773_6833_7975 | 376 |
| 351 | 3300048905 | Ga0496102_0170473 | Ga0496102_0170473_357_1490 | 376 |
| 352 | 3300048906 | Ga0496103_0020201 | Ga0496103_0020201_2792_3934 | 376 |
| 353 | 3300048906 | Ga0496103_0026425 | Ga0496103_0026425_383_1516 | 376 |
| 354 | 3300048907 | Ga0496104_0017161 | Ga0496104_0017161_1998_3140 | 376 |
| 355 | 3300048908 | Ga0496105_0017385 | Ga0496105_0017385_1848_2990 | 376 |
| 356 | 3300048910 | Ga0496107_0000906 | Ga0496107_0000906_4483_5625 | 376 |
| 357 | 3300048913 | Ga0496110_0012336 | Ga0496110_0012336_1511_2653 | 376 |
| 358 | 3300048913 | Ga0496110_0061908 | Ga0496110_0061908_669_1802 | 376 |
| 359 | 3300048914 | Ga0496111_0033818 | Ga0496111_0033818_1073_2215 | 376 |
| 360 | 3300048915 | Ga0496112_0019875 | Ga0496112_0019875_1431_2573 | 376 |
| 361 | 3300048915 | Ga0496112_0040104 | Ga0496112_0040104_2492_3625 | 376 |
| 362 | 3300048916 | Ga0496113_0005552 | Ga0496113_0005552_4308_5450 | 376 |
| 363 | 3300048917 | Ga0496114_0019194 | Ga0496114_0019194_1703_2845 | 376 |
| 364 | 3300048917 | Ga0496114_0026084 | Ga0496114_0026084_3513_4646 | 376 |
| 365 | 3300048918 | Ga0496115_0001360 | Ga0496115_0001360_11870_13012 | 376 |
| 366 | 3300048919 | Ga0496116_0100298 | Ga0496116_0100298_344_1477 | 376 |
| 367 | 3300048921 | Ga0496118_0042947 | Ga0496118_0042947_2294_3427 | 376 |
| 368 | 3300048921 | Ga0496118_0049435 | Ga0496118_0049435_1622_2755 | 376 |
| 369 | 3300048923 | Ga0496120_0013470 | Ga0496120_0013470_3936_5069 | 376 |
| 370 | 3300048924 | Ga0496121_0012060 | Ga0496121_0012060_6559_7692 | 376 |
| 371 | 3300048929 | Ga0496126_0046554 | Ga0496126_0046554_954_2087 | 376 |
| 372 | 3300049460 | Ga0495682_0002812 | Ga0495682_0002812_2088_3254 | 376 |
| 373 | 3300049581 | Ga0501047_0109214 | Ga0501047_0109214_449_1582 | 376 |
| 374 | 3300049590 | Ga0501074_0034434 | Ga0501074_0034434_2305_3438 | 376 |
| 375 | 3300049742 | Ga0501080_0060687 | Ga0501080_0060687_2278_3411 | 376 |
| 376 | 3300049744 | Ga0501083_0048935 | Ga0501083_0048935_1059_2195 | 376 |
| 377 | 3300050492 | nmdc:mga0yw44_132195_c1 | nmdc:mga0yw44_132195_c1_240_1373 | 376 |
| 378 | 3300050492 | nmdc:mga0yw44_13968_c1 | nmdc:mga0yw44_13968_c1_1731_2876 | 376 |
| 379 | 3300050492 | nmdc:mga0yw44_149011_c1 | nmdc:mga0yw44_149011_c1_31_1164 | 376 |
| 380 | 3300050492 | nmdc:mga0yw44_2679_c1 | nmdc:mga0yw44_2679_c1_2963_4108 | 376 |
| 381 | 3300050495 | nmdc:mga04h51_362_c1 | nmdc:mga04h51_362_c1_8627_9826 | 376 |
| 382 | 3300053084 | Ga0495595_0087472 | Ga0495595_0087472_276_1409 | 376 |
| 383 | 3300053094 | Ga0500566_0001998 | Ga0500566_0001998_8966_10099 | 376 |
| 384 | 3300053105 | Ga0500557_000003 | Ga0500557_000003_197803_198945 | 376 |
| 385 | 3300053119 | Ga0500595_001143 | Ga0500595_001143_13528_14661 | 376 |
| 386 | 3300053136 | Ga0500559_0007895 | Ga0500559_0007895_1701_2834 | 376 |
| 387 | 3300053155 | Ga0500620_001310 | Ga0500620_001310_84_1217 | 376 |
| 388 | 3300053177 | Ga0500636_0110363 | Ga0500636_0110363_162_1295 | 376 |
| 389 | 3300053178 | Ga0500637_0000068 | Ga0500637_0000068_1811_2944 | 376 |
| 390 | 3300053729 | Ga0500625_007016 | Ga0500625_007016_2888_4030 | 376 |
| 391 | 3300055283 | Ga0500661_000814 | Ga0500661_000814_2602_3735 | 376 |
| 392 | 3300060353 | Ga0501082_0000057 | Ga0501082_0000057_59359_60495 | 376 |
| 393 | 3300006844 | Ga0075428_100003201 | Ga0075428_1000032013 | 378 |
| 394 | 3300006852 | Ga0075433_10033814 | Ga0075433_100338142 | 378 |
| 395 | 3300009094 | Ga0111539_10001837 | Ga0111539_1000183720 | 378 |
| 396 | 3300009094 | Ga0111539_10057305 | Ga0111539_100573056 | 378 |
| 397 | 3300027907 | Ga0207428_10008351 | Ga0207428_100083513 | 378 |
| 398 | 3300050511 | nmdc:mga08y16_153491_c1 | nmdc:mga08y16_153491_c1_952_2091 | 378 |
| 399 | 3300050511 | nmdc:mga08y16_4071_c1 | nmdc:mga08y16_4071_c1_1736_2875 | 378 |
| 400 | 3300050515 | nmdc:mga0a205_133450_c1 | nmdc:mga0a205_133450_c1_1035_2174 | 378 |
| 401 | 3300050515 | nmdc:mga0a205_29655_c1 | nmdc:mga0a205_29655_c1_1944_3083 | 378 |
| 402 | 3300031733 | Ga0316577_10112697 | Ga0316577_101126972 | 380 |
| 403 | 3300042876 | Ga0451577_0092182 | Ga0451577_0092182_120_1265 | 380 |
| 404 | 3300044712 | Ga0453684_0010690 | Ga0453684_0010690_13564_14709 | 380 |
| 405 | 3300005563 | Ga0068855_100288784 | Ga0068855_1002887842 | 384 |
| 406 | 3300025949 | Ga0207667_10322432 | Ga0207667_103224322 | 384 |
| 407 | iso_pu_bacteria | 2582581304 | 2585255846 | 384 |
| 408 | iso_pu_bacteria | 2597490356 | 2599100594 | 385 |
| 409 | iso_pu_bacteria | 2848858292 | 2848863492 | 385 |
| 410 | iso_pu_bacteria | 2980125574 | 2980125878 | 385 |
| 411 | 3300009545 | Ga0105237_10060254 | Ga0105237_100602544 | 388 |
| 412 | 3300021384 | Ga0213876_10051624 | Ga0213876_100516242 | 388 |
| 413 | 3300025914 | Ga0207671_10215059 | Ga0207671_102150591 | 388 |
| 414 | 3300037471 | Ga0395905_0004620 | Ga0395905_0004620_5921_7087 | 388 |
| 415 | 3300039437 | Ga0436365_1256094 | Ga0436365_1256094_7404_8570 | 388 |
| 416 | 3300048917 | Ga0496114_0305986 | Ga0496114_0305986_45_1211 | 388 |
| 417 | 3300048918 | Ga0496115_0150331 | Ga0496115_0150331_396_1562 | 388 |
| 418 | 3300000549 | LJQas_1004506 | LJQas_10045062 | 389 |
| 419 | 3300005340 | Ga0070689_100029500 | Ga0070689_1000295002 | 389 |
| 420 | 3300005355 | Ga0070671_100009647 | Ga0070671_1000096476 | 389 |
| 421 | 3300005364 | Ga0070673_100057026 | Ga0070673_1000570263 | 389 |
| 422 | 3300005436 | Ga0070713_100085165 | Ga0070713_1000851652 | 389 |
| 423 | 3300005437 | Ga0070710_10112519 | Ga0070710_101125192 | 389 |
| 424 | 3300005983 | Ga0081540_1029863 | Ga0081540_10298634 | 389 |
| 425 | 3300006175 | Ga0070712_100070437 | Ga0070712_1000704374 | 389 |
| 426 | 3300006186 | Ga0075369_10021241 | Ga0075369_100212413 | 389 |
| 427 | 3300009174 | Ga0105241_10038032 | Ga0105241_100380323 | 389 |
| 428 | 3300014325 | Ga0163163_10038386 | Ga0163163_100383862 | 389 |
| 429 | 3300025907 | Ga0207645_10097072 | Ga0207645_100970722 | 389 |
| 430 | 3300025915 | Ga0207693_10057272 | Ga0207693_100572723 | 389 |
| 431 | 3300025926 | Ga0207659_10065106 | Ga0207659_100651061 | 389 |
| 432 | 3300025928 | Ga0207700_10109871 | Ga0207700_101098712 | 389 |
| 433 | 3300025931 | Ga0207644_10006453 | Ga0207644_100064534 | 389 |
| 434 | 3300025960 | Ga0207651_10005518 | Ga0207651_100055184 | 389 |
| 435 | 3300035118 | Ga0373954_0115178 | Ga0373954_0115178_27_1208 | 389 |
| 436 | 3300039438 | Ga0436360_0347114 | Ga0436360_0347114_231_1406 | 389 |
| 437 | 3300046454 | Ga0495592_0230816 | Ga0495592_0230816_42_1214 | 389 |
| 438 | 3300046462 | Ga0495651_0076548 | Ga0495651_0076548_38_1210 | 389 |
| 439 | 3300046516 | Ga0495628_0151911 | Ga0495628_0151911_450_1622 | 389 |
| 440 | 3300046529 | Ga0495652_0110738 | Ga0495652_0110738_943_2115 | 389 |
| 441 | 3300047317 | Ga0495604_0087137 | Ga0495604_0087137_146_1318 | 389 |
| 442 | 3300048904 | Ga0496101_0118596 | Ga0496101_0118596_550_1722 | 389 |
| 443 | 3300048907 | Ga0496104_0029286 | Ga0496104_0029286_1696_2868 | 389 |
| 444 | 3300048915 | Ga0496112_0195677 | Ga0496112_0195677_354_1526 | 389 |
| 445 | 3300049581 | Ga0501047_0124801 | Ga0501047_0124801_85_1254 | 389 |
| 446 | 3300049823 | Ga0501044_0052681 | Ga0501044_0052681_1865_3034 | 389 |
| 447 | 3300050491 | nmdc:mga00v17_15228_c1 | nmdc:mga00v17_15228_c1_2145_3314 | 389 |
| 448 | 3300050516 | nmdc:mga0sz30_7767_c1 | nmdc:mga0sz30_7767_c1_641_1810 | 389 |
| 449 | 3300053077 | Ga0495601_0011448 | Ga0495601_0011448_732_1904 | 389 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5olc-assembly1.cif.gz_F | crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans | 0.9739 | 1 | 389 |
| 5olc-assembly1.cif.gz_F | crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans | 0.9712 | 1 | 389 |
| 4hpn-assembly1.cif.gz_A | crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops | 0.9545 | 1 | 389 |
| 4ggb-assembly1.cif.gz_A | crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, disordered loops | 0.9513 | 1 | 381 |
| 4hpn-assembly1.cif.gz_A | crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops | 0.9471 | 1 | 389 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5olcB02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9719 | 120 | 389 | 3.20.20.120 |
| 5olcB02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9642 | 120 | 389 | 3.20.20.120 |
| 4ggbA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9525 | 120 | 381 | 3.20.20.120 |
| 5olcA01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9361 | 1 | 117 | 3.30.390.10 |
| 3sjnB02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9336 | 119 | 389 | 3.20.20.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A263DHE3-F1-model_v4 | Mandelate racemase | 0.9823 | 59 | 389 |
GO:0000287
GO:0009063 GO:0016052 GO:0016836 |
| AF-A0A263DHE3-F1-model_v4 | Mandelate racemase | 0.9765 | 59 | 389 |
GO:0000287
GO:0009063 GO:0016052 GO:0016836 |
| AF-A0A4V3MR21-F1-model_v4 | deleted | 0.9725 | 199 | 324 |
|
| AF-A0A852TQ88-F1-model_v4 | D-galactarolactone cycloisomerase (EC 5.5.1.-) | 0.9687 | 100 | 388 |
GO:0000287
GO:0009063 GO:0016052 GO:0016836 GO:0016853 |
| AF-A0A3S0K0W6-F1-model_v4 | Mandelate racemase/muconate lactonizing enzyme family protein | 0.9686 | 1 | 388 |
GO:0000287
GO:0009063 GO:0016052 GO:0016836 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar