F446339

General Info

Members Datasets Scaffolds Average Seq Length
449 231 898 152

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100455495|Ga0068858_1004554952
Length 166
Sequence VLPRCSSGWPDAAGDALRVAVAFDHRGVQLREAVLAALVGHEVVDLGAQTAAVRLDYPDKAREVGEAIRQGRAVRGVLVCGSGVGAAIAACKLAGIRAAICHDTYSAHQGVEHDDLNVLCLGSEVVGPSLARELVDTFLRAEFIGGEPYLGRLQKVAEMERVMHGG

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
92 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
93 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
110 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
111 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
112 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
113 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
142 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
231 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.67
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 10.02
Rhizosphere 88.86
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100455495 3300005842 Bacteria 1233
2 JGI25159J45721_1023538 3300002987 Bacteria 1115
3 Ga0058862_12318768 3300004803 Unclassified 857
4 Ga0070658_10087177 3300005327 Bacteria 2569
5 Ga0070658_10250145 3300005327 Bacteria 1504
6 Ga0070683_100087068 3300005329 Bacteria 2929
7 Ga0070683_100478310 3300005329 Bacteria 1189
8 Ga0068869_100830602 3300005334 Bacteria 796
9 Ga0070680_100173327 3300005336 Bacteria 1816
10 Ga0070680_100465333 3300005336 Bacteria 1080
11 Ga0070680_100939201 3300005336 Bacteria 746
12 Ga0070660_100016653 3300005339 Bacteria 5342
13 Ga0070660_100134765 3300005339 Bacteria 1978
14 Ga0070692_10261445 3300005345 Bacteria 1041
15 Ga0070692_10383200 3300005345 Bacteria 883
16 Ga0070659_100065119 3300005366 Bacteria 2886
17 Ga0070667_100007329 3300005367 Bacteria 9168
18 Ga0070714_100083640 3300005435 Bacteria 2783
19 Ga0070714_101735280 3300005435 Bacteria 610
20 Ga0070713_100505541 3300005436 Bacteria 1141
21 Ga0070694_100031528 3300005444 Bacteria 3475
22 Ga0070662_100629981 3300005457 Bacteria 903
23 Ga0070681_10063131 3300005458 Bacteria 3677
24 Ga0070681_10271655 3300005458 Bacteria 1607
25 Ga0070681_10638546 3300005458 Bacteria 979
26 Ga0070679_100125489 3300005530 Bacteria 2549
27 Ga0070679_100221642 3300005530 Bacteria 1852
28 Ga0070679_101767126 3300005530 Unclassified 567
29 Ga0070684_100006456 3300005535 Bacteria 9077
30 Ga0070684_100164930 3300005535 Bacteria 2011
31 Ga0070684_100372162 3300005535 Bacteria 1315
32 Ga0070684_100761954 3300005535 Bacteria 904
33 Ga0068853_100783176 3300005539 Bacteria 912
34 Ga0070695_100270240 3300005545 Bacteria 1245
35 Ga0070696_100404266 3300005546 Bacteria 1069
36 Ga0068855_100161633 3300005563 Bacteria 2541
37 Ga0068855_100183671 3300005563 Bacteria 2363
38 Ga0070664_100218289 3300005564 Bacteria 1706
39 Ga0070664_100497702 3300005564 Bacteria 1123
40 Ga0068854_100655823 3300005578 Bacteria 901
41 Ga0068854_101260173 3300005578 Bacteria 664
42 Ga0068856_100141916 3300005614 Bacteria 2409
43 Ga0068856_100189529 3300005614 Bacteria 2070
44 Ga0068856_100364276 3300005614 Bacteria 1464
45 Ga0068856_100488288 3300005614 Bacteria 1252
46 Ga0068852_100250918 3300005616 Bacteria 1695
47 Ga0068852_100666708 3300005616 Bacteria 1048
48 Ga0068861_100506194 3300005719 Bacteria 1092
49 Ga0081538_10116527 3300005981 Bacteria 1296
50 Ga0070717_10212416 3300006028 Bacteria 1698
51 Ga0070717_11199251 3300006028 Bacteria 691
52 Ga0075432_10012676 3300006058 Bacteria 2863
53 Ga0070712_100098899 3300006175 Bacteria 2152
54 Ga0075428_100000756 3300006844 Bacteria 33584
55 Ga0075433_10299564 3300006852 Bacteria 1424
56 Ga0075429_100132069 3300006880 Bacteria 2184
57 Ga0068865_100056261 3300006881 Bacteria 2740
58 Ga0111539_10040477 3300009094 Bacteria 5610
59 Ga0105245_10362730 3300009098 Bacteria 1438
60 Ga0105245_10420370 3300009098 Bacteria 1340
61 Ga0105245_13144445 3300009098 Bacteria 512
62 Ga0105247_10494738 3300009101 Bacteria 890
63 Ga0114129_10640664 3300009147 Bacteria 1373
64 Ga0105241_10683616 3300009174 Bacteria 935
65 Ga0105248_10073301 3300009177 Bacteria 3848
66 Ga0105237_10908533 3300009545 Bacteria 887
67 Ga0105237_11323161 3300009545 Bacteria 727
68 Ga0105238_10966690 3300009551 Bacteria 872
69 Ga0099796_10033980 3300010159 Bacteria 1682
70 Ga0105239_10016391 3300010375 Bacteria 8196
71 Ga0105239_10815103 3300010375 Bacteria 1070
72 Ga0105246_10356418 3300011119 Bacteria 1200
73 Ga0157328_1004488 3300012478 Unclassified 776
74 Ga0157371_10239073 3300013102 Bacteria 1306
75 Ga0163162_10070283 3300013306 Bacteria 3552
76 Ga0157372_10125722 3300013307 Bacteria 2948
77 Ga0157372_10165153 3300013307 Bacteria 2560
78 Ga0157372_11565622 3300013307 Bacteria 759
79 Ga0157375_10003777 3300013308 Bacteria 13125
80 Ga0157375_10543206 3300013308 Bacteria 1324
81 Ga0182008_10214442 3300014497 Bacteria 983
82 Ga0157377_10306284 3300014745 Bacteria 1050
83 Ga0157379_10401073 3300014968 Bacteria 1261
84 Ga0157376_10281343 3300014969 Bacteria 1567
85 Ga0157376_10284719 3300014969 Bacteria 1558
86 Ga0206355_1607321 3300020076 Unclassified 724
87 Ga0213875_10001045 3300021388 Bacteria 19483
88 Ga0207688_10021094 3300025901 Bacteria 3558
89 Ga0207688_10499633 3300025901 Bacteria 761
90 Ga0207705_10065737 3300025909 Bacteria 2622
91 Ga0207705_10166959 3300025909 Bacteria 1656
92 Ga0207707_10017026 3300025912 Bacteria 6331
93 Ga0207707_10105621 3300025912 Bacteria 2461
94 Ga0207693_10196865 3300025915 Bacteria 1585
95 Ga0207660_10152191 3300025917 Bacteria 1778
96 Ga0207657_10010198 3300025919 Bacteria 9386
97 Ga0207657_10019140 3300025919 Bacteria 6510
98 Ga0207657_10101875 3300025919 Bacteria 2382
99 Ga0207657_10692199 3300025919 Bacteria 792
100 Ga0207649_10577019 3300025920 Bacteria 863
101 Ga0207652_10088855 3300025921 Bacteria 2712
102 Ga0207652_10229603 3300025921 Bacteria 1673
103 Ga0207652_10329250 3300025921 Bacteria 1379
104 Ga0207687_10055385 3300025927 Bacteria 2779
105 Ga0207687_10097697 3300025927 Bacteria 2155
106 Ga0207700_10544428 3300025928 Bacteria 1030
107 Ga0207664_10781114 3300025929 Bacteria 859
108 Ga0207644_10477581 3300025931 Bacteria 1026
109 Ga0207690_10027014 3300025932 Bacteria 3623
110 Ga0207690_10085493 3300025932 Bacteria 2214
111 Ga0207706_11006427 3300025933 Bacteria 700
112 Ga0207709_10232561 3300025935 Bacteria 1336
113 Ga0207704_10262714 3300025938 Bacteria 1303
114 Ga0207665_10257037 3300025939 Bacteria 1293
115 Ga0207711_10062889 3300025941 Bacteria 3203
116 Ga0207661_10444251 3300025944 Bacteria 1180
117 Ga0207679_10251334 3300025945 Bacteria 1503
118 Ga0207679_10872961 3300025945 Bacteria 822
119 Ga0207667_10433268 3300025949 Bacteria 1337
120 Ga0207640_10148436 3300025981 Bacteria 1719
121 Ga0207640_10574725 3300025981 Bacteria 950
122 Ga0207658_10002426 3300025986 Bacteria 13637
123 Ga0207703_10594429 3300026035 Bacteria 1046
124 Ga0207708_10207557 3300026075 Bacteria 1565
125 Ga0207702_10306323 3300026078 Bacteria 1509
126 Ga0207674_10113862 3300026116 Bacteria 2677
127 Ga0207675_100255860 3300026118 Bacteria 1696
128 Ga0207698_10243195 3300026142 Bacteria 1641
129 Ga0207698_11104502 3300026142 Bacteria 806
130 Ga0207428_10000525 3300027907 Bacteria 45711
131 Ga0268265_10345716 3300028380 Bacteria 1356
132 Ga0265336_10012443 3300028666 Bacteria 2864
133 Ga0265338_10019394 3300028800 Bacteria 7217
134 Ga0316583_10102252 3300032133 Bacteria 999
135 Ga0373940_0166681 3300035088 Bacteria 710
136 Ga0373944_0094200 3300035089 Bacteria 1004
137 Ga0373956_0111099 3300035119 Bacteria 1276
138 Ga0373960_0081653 3300035121 Bacteria 1019
139 Ga0373943_0015299 3300035170 Bacteria 3483
140 Ga0373946_0016623 3300035171 Bacteria 2805
141 Ga0373935_0091164 3300035692 Bacteria 1996
142 Ga0373947_0004151 3300035725 Bacteria 8514
143 Ga0373947_0445430 3300035725 Bacteria 877
144 Ga0373947_0504835 3300035725 Bacteria 822
145 Ga0373937_0020059 3300036401 Bacteria 5988
146 Ga0373925_0012269 3300037068 Bacteria 6199
147 Ga0395899_0003510 3300037312 Bacteria 12425
148 Ga0395899_0022187 3300037312 Bacteria 4814
149 Ga0395899_0231674 3300037312 Bacteria 1275
150 Ga0395899_0651474 3300037312 Bacteria 665
151 Ga0395900_0003292 3300037418 Bacteria 17477
152 Ga0395900_0006253 3300037418 Bacteria 12427
153 Ga0395900_0010228 3300037418 Bacteria 9595
154 Ga0395900_0023611 3300037418 Bacteria 6292
155 Ga0395900_0090950 3300037418 Bacteria 3136
156 Ga0395900_0170483 3300037418 Bacteria 2216
157 Ga0395900_0349690 3300037418 Bacteria 1452
158 Ga0395900_0465459 3300037418 Bacteria 1218
159 Ga0395898_0007592 3300037466 Bacteria 11514
160 Ga0395898_0014933 3300037466 Bacteria 7975
161 Ga0395898_0017981 3300037466 Bacteria 7212
162 Ga0395898_0025762 3300037466 Bacteria 5923
163 Ga0395898_0069563 3300037466 Bacteria 3405
164 Ga0395898_0346220 3300037466 Bacteria 1417
165 Ga0395898_0752103 3300037466 Bacteria 916
166 Ga0395898_1884426 3300037466 Unclassified 518
167 Ga0395905_0002725 3300037471 Bacteria 19346
168 Ga0395905_0005899 3300037471 Bacteria 12424
169 Ga0395905_0014203 3300037471 Bacteria 7607
170 Ga0395905_0562632 3300037471 Bacteria 1041
171 Ga0395905_0923136 3300037471 Bacteria 776
172 Ga0436364_0121966 3300037853 Bacteria 57474
173 Ga0395901_0002252 3300038443 Bacteria 19683
174 Ga0395901_0004857 3300038443 Bacteria 13568
175 Ga0395901_0008438 3300038443 Bacteria 10412
176 Ga0395901_0017435 3300038443 Bacteria 7330
177 Ga0395901_0032871 3300038443 Bacteria 5352
178 Ga0395901_0060565 3300038443 Bacteria 3939
179 Ga0395901_0120936 3300038443 Bacteria 2752
180 Ga0395901_2155793 3300038443 Unclassified 502
181 Ga0451853_2655281 3300041512 Bacteria 936
182 Ga0439455_0024912 3300042012 Bacteria 1451
183 Ga0450920_058617 3300042122 Bacteria 776
184 Ga0450900_017424 3300042136 Bacteria 979
185 Ga0450907_001962 3300042146 Bacteria 4149
186 Ga0450907_059728 3300042146 Bacteria 658
187 Ga0450916_044871 3300042530 Bacteria 682
188 Ga0466969_0001344 3300044656 Bacteria 13262
189 Ga0466965_0022529 3300044683 Bacteria 3037
190 Ga0466965_0143205 3300044683 Bacteria 1246
191 Ga0466965_0218158 3300044683 Bacteria 1016
192 Ga0466966_0048365 3300044684 Bacteria 2709
193 Ga0466966_0072845 3300044684 Bacteria 2150
194 Ga0466966_0125575 3300044684 Bacteria 1574
195 Ga0466961_0001489 3300044693 Bacteria 14537
196 Ga0466961_0059551 3300044693 Bacteria 2429
197 Ga0466961_0088102 3300044693 Bacteria 1961
198 Ga0466961_0184225 3300044693 Bacteria 1295
199 Ga0466963_0006001 3300044694 Bacteria 7159
200 Ga0466963_0018623 3300044694 Bacteria 4344
201 Ga0466963_0052893 3300044694 Bacteria 2695
202 Ga0466964_0077595 3300044706 Bacteria 1418
203 Ga0466971_0019799 3300044719 Bacteria 2989
204 Ga0466971_0035439 3300044719 Bacteria 2237
205 Ga0466971_0244922 3300044719 Bacteria 853
206 Ga0466968_0001014 3300044735 Bacteria 9899
207 Ga0466968_0016504 3300044735 Bacteria 2941
208 Ga0466968_0055203 3300044735 Bacteria 1704
209 Ga0466957_0007860 3300044842 Bacteria 6046
210 Ga0466957_0014160 3300044842 Bacteria 4640
211 Ga0466957_0137982 3300044842 Bacteria 1569
212 Ga0466957_0200281 3300044842 Bacteria 1311
213 Ga0466959_0013371 3300045049 Bacteria 5951
214 Ga0466959_0018084 3300045049 Bacteria 5172
215 Ga0466959_0331438 3300045049 Bacteria 1039
216 Ga0466958_0000746 3300045836 Bacteria 14259
217 Ga0466958_0021730 3300045836 Bacteria 3753
218 Ga0466958_0026200 3300045836 Bacteria 3444
219 Ga0466967_0052432 3300045976 Bacteria 3580
220 Ga0466967_0084597 3300045976 Bacteria 2870
221 Ga0466967_0118178 3300045976 Bacteria 2445
222 Ga0466967_0340353 3300045976 Bacteria 1450
223 Ga0466967_0721743 3300045976 Bacteria 988
224 Ga0495592_0001046 3300046454 Bacteria 19192
225 Ga0495592_0015721 3300046454 Bacteria 5740
226 Ga0495603_0174654 3300046455 Bacteria 1244
227 Ga0495629_0380871 3300046459 Bacteria 960
228 Ga0495641_0203390 3300046461 Bacteria 888
229 Ga0495651_0000004 3300046462 Bacteria 177080
230 Ga0495653_0012045 3300046463 Bacteria 7056
231 Ga0495653_0044526 3300046463 Bacteria 3444
232 Ga0495653_0071623 3300046463 Bacteria 2590
233 Ga0495653_0808014 3300046463 Bacteria 563
234 Ga0495582_0070459 3300046473 Bacteria 1934
235 Ga0495582_0084169 3300046473 Bacteria 1768
236 Ga0495582_0169124 3300046473 Bacteria 1244
237 Ga0495664_0177868 3300046477 Bacteria 1290
238 Ga0495596_0175286 3300046500 Bacteria 834
239 Ga0495607_0053464 3300046501 Bacteria 2334
240 Ga0495608_0043456 3300046511 Bacteria 3002
241 Ga0495618_0003214 3300046514 Bacteria 10239
242 Ga0495618_0319900 3300046514 Bacteria 961
243 Ga0495628_0001177 3300046516 Bacteria 23864
244 Ga0495628_0026811 3300046516 Bacteria 4691
245 Ga0495630_0051926 3300046517 Bacteria 3069
246 Ga0495630_0234759 3300046517 Bacteria 1401
247 Ga0495631_0081614 3300046518 Bacteria 1395
248 Ga0495637_0187056 3300046520 Bacteria 765
249 Ga0495644_0017397 3300046523 Bacteria 2749
250 Ga0495644_0087584 3300046523 Bacteria 1174
251 Ga0495652_0000047 3300046529 Bacteria 121525
252 Ga0495652_0024242 3300046529 Bacteria 5372
253 Ga0495652_0135897 3300046529 Bacteria 1940
254 Ga0495640_0251706 3300046533 Bacteria 1106
255 Ga0495587_0000103 3300046536 Bacteria 64471
256 Ga0495645_0000028 3300046543 Bacteria 113461
257 Ga0495645_0038843 3300046543 Bacteria 3471
258 Ga0495667_0088112 3300046559 Bacteria 2012
259 Ga0495667_0117358 3300046559 Bacteria 1719
260 Ga0495656_0004373 3300046615 Bacteria 4835
261 Ga0495611_0106561 3300046648 Bacteria 1304
262 Ga0495635_0219031 3300046663 Bacteria 1288
263 Ga0495635_0524329 3300046663 Bacteria 778
264 Ga0495588_0065217 3300046674 Bacteria 1889
265 Ga0495657_0002632 3300046675 Bacteria 15029
266 Ga0495657_0074906 3300046675 Bacteria 2201
267 Ga0495599_0000073 3300046678 Bacteria 70685
268 Ga0495623_0000105 3300046679 Bacteria 51809
269 Ga0495623_0019910 3300046679 Bacteria 4338
270 Ga0495646_0001581 3300046680 Bacteria 13581
271 Ga0495646_0022631 3300046680 Bacteria 3963
272 Ga0495669_0477533 3300046684 Bacteria 606
273 Ga0495613_0317357 3300046689 Bacteria 1076
274 Ga0495613_0496604 3300046689 Bacteria 822
275 Ga0495624_0147742 3300046690 Bacteria 1438
276 Ga0495670_0034075 3300046691 Bacteria 2535
277 Ga0495589_0060786 3300046794 Bacteria 1855
278 Ga0495600_0088213 3300046809 Bacteria 2024
279 Ga0495600_0106248 3300046809 Bacteria 1829
280 Ga0495581_0491862 3300047315 Bacteria 713
281 Ga0495604_0000027 3300047317 Bacteria 143025
282 Ga0495674_0711604 3300047319 Bacteria 787
283 Ga0495676_0116486 3300047321 Bacteria 1951
284 Ga0495680_0001582 3300047322 Bacteria 24358
285 Ga0495680_0044887 3300047322 Bacteria 3492
286 Ga0495680_0161061 3300047322 Bacteria 1629
287 Ga0495675_0000273 3300047444 Bacteria 37403
288 Ga0495679_028706 3300047446 Bacteria 1823
289 Ga0495684_0059758 3300047471 Bacteria 2902
290 Ga0495602_0000096 3300048088 Bacteria 82587
291 Ga0495602_0191304 3300048088 Bacteria 1569
292 Ga0496100_0127071 3300048903 Bacteria 1790
293 Ga0496101_0006305 3300048904 Bacteria 7635
294 Ga0496101_0283848 3300048904 Bacteria 1294
295 Ga0496102_0063054 3300048905 Bacteria 3394
296 Ga0496102_0080162 3300048905 Bacteria 3007
297 Ga0496103_0019091 3300048906 Bacteria 4116
298 Ga0496103_0027842 3300048906 Bacteria 3427
299 Ga0496104_0090436 3300048907 Bacteria 2925
300 Ga0496104_0100793 3300048907 Bacteria 2764
301 Ga0496105_0066088 3300048908 Bacteria 2985
302 Ga0496105_0181343 3300048908 Bacteria 1724
303 Ga0496106_0191347 3300048909 Bacteria 1627
304 Ga0496108_0004672 3300048911 Bacteria 11040
305 Ga0496108_0005299 3300048911 Bacteria 10411
306 Ga0496108_0078215 3300048911 Bacteria 2799
307 Ga0496108_0709009 3300048911 Bacteria 872
308 Ga0496109_0006626 3300048912 Bacteria 9753
309 Ga0496109_0012945 3300048912 Bacteria 7213
310 Ga0496109_0021005 3300048912 Bacteria 5772
311 Ga0496109_0321677 3300048912 Bacteria 1460
312 Ga0496109_0330294 3300048912 Bacteria 1439
313 Ga0496109_1661623 3300048912 Bacteria 573
314 Ga0496110_0003987 3300048913 Bacteria 11369
315 Ga0496110_0036806 3300048913 Bacteria 4251
316 Ga0496110_0107979 3300048913 Bacteria 2499
317 Ga0496110_0479392 3300048913 Bacteria 1133
318 Ga0496111_0004611 3300048914 Bacteria 8722
319 Ga0496111_0288729 3300048914 Bacteria 1216
320 Ga0496111_0597021 3300048914 Bacteria 808
321 Ga0496112_0002778 3300048915 Bacteria 14202
322 Ga0496112_0012982 3300048915 Bacteria 7677
323 Ga0496112_0023401 3300048915 Bacteria 5903
324 Ga0496112_0142346 3300048915 Bacteria 2367
325 Ga0496112_0162116 3300048915 Bacteria 2203
326 Ga0496112_0172744 3300048915 Bacteria 2126
327 Ga0496112_1193758 3300048915 Bacteria 678
328 Ga0496113_0017197 3300048916 Bacteria 5015
329 Ga0496113_0094629 3300048916 Bacteria 2308
330 Ga0496113_0266616 3300048916 Bacteria 1368
331 Ga0496113_0661461 3300048916 Bacteria 835
332 Ga0496114_0007830 3300048917 Bacteria 8453
333 Ga0496114_0035412 3300048917 Bacteria 4122
334 Ga0496114_0350930 3300048917 Bacteria 1305
335 Ga0496115_0001419 3300048918 Bacteria 17150
336 Ga0496115_0003525 3300048918 Bacteria 11248
337 Ga0501312_001018 3300049528 Bacteria 2597
338 Ga0501031_0040387 3300049568 Bacteria 3046
339 Ga0501031_0120037 3300049568 Bacteria 1717
340 Ga0501031_0120803 3300049568 Bacteria 1711
341 Ga0501032_0009175 3300049569 Bacteria 7174
342 Ga0501032_0083677 3300049569 Bacteria 2122
343 Ga0501032_0424095 3300049569 Bacteria 853
344 Ga0501033_0025703 3300049570 Bacteria 4436
345 Ga0501033_0528297 3300049570 Bacteria 814
346 Ga0501033_0763258 3300049570 Bacteria 655
347 Ga0501034_0273916 3300049571 Bacteria 1628
348 Ga0501034_0403143 3300049571 Bacteria 1290
349 Ga0501034_0689108 3300049571 Bacteria 921
350 Ga0501036_0017570 3300049572 Bacteria 5982
351 Ga0501036_0423622 3300049572 Bacteria 1110
352 Ga0501037_0004963 3300049573 Bacteria 9674
353 Ga0501037_0616739 3300049573 Bacteria 727
354 Ga0501038_0059539 3300049574 Bacteria 3271
355 Ga0501039_0043675 3300049575 Bacteria 3461
356 Ga0501039_0081735 3300049575 Bacteria 2515
357 Ga0501039_0640256 3300049575 Bacteria 832
358 Ga0501040_0007711 3300049576 Bacteria 6966
359 Ga0501040_0027592 3300049576 Bacteria 3823
360 Ga0501040_0100312 3300049576 Bacteria 2018
361 Ga0501041_0023711 3300049577 Bacteria 3679
362 Ga0501041_0032108 3300049577 Bacteria 3173
363 Ga0501042_0004568 3300049578 Bacteria 8831
364 Ga0501042_0012720 3300049578 Bacteria 5710
365 Ga0501042_0018437 3300049578 Bacteria 4831
366 Ga0501043_0060479 3300049579 Bacteria 2973
367 Ga0501043_0070163 3300049579 Bacteria 2752
368 Ga0501043_0241559 3300049579 Bacteria 1393
369 Ga0501046_0021734 3300049580 Bacteria 5291
370 Ga0501046_0077375 3300049580 Bacteria 2575
371 Ga0501047_0651680 3300049581 Bacteria 872
372 Ga0501048_0018873 3300049582 Bacteria 5069
373 Ga0501048_0028438 3300049582 Bacteria 4057
374 Ga0501048_0200758 3300049582 Bacteria 1413
375 Ga0501067_0199688 3300049583 Bacteria 1114
376 Ga0501068_0007629 3300049584 Bacteria 5986
377 Ga0501069_0008477 3300049585 Bacteria 5406
378 Ga0501069_0021953 3300049585 Bacteria 3468
379 Ga0501069_0088541 3300049585 Bacteria 1750
380 Ga0501069_0865527 3300049585 Bacteria 549
381 Ga0501070_0000176 3300049586 Bacteria 59256
382 Ga0501070_0008821 3300049586 Bacteria 8525
383 Ga0501070_0020101 3300049586 Bacteria 5600
384 Ga0501070_0088612 3300049586 Bacteria 2561
385 Ga0501070_0196607 3300049586 Bacteria 1656
386 Ga0501070_0548696 3300049586 Bacteria 925
387 Ga0501071_0005213 3300049587 Bacteria 8328
388 Ga0501071_0034760 3300049587 Bacteria 3589
389 Ga0501071_0035488 3300049587 Bacteria 3551
390 Ga0501072_0017010 3300049588 Bacteria 5587
391 Ga0501072_0027108 3300049588 Bacteria 4470
392 Ga0501072_0664814 3300049588 Bacteria 820
393 Ga0501073_0043202 3300049589 Bacteria 3178
394 Ga0501073_0123800 3300049589 Bacteria 1792
395 Ga0501073_0178386 3300049589 Bacteria 1470
396 Ga0501074_0002043 3300049590 Bacteria 13933
397 Ga0501074_0005872 3300049590 Bacteria 8852
398 Ga0501074_0066585 3300049590 Bacteria 2591
399 Ga0501075_0507113 3300049591 Bacteria 920
400 Ga0501076_0023161 3300049592 Bacteria 4783
401 Ga0501076_0037324 3300049592 Bacteria 3809
402 Ga0501076_0055466 3300049592 Bacteria 3142
403 Ga0501076_0855777 3300049592 Bacteria 750
404 Ga0501077_0035999 3300049593 Bacteria 3152
405 Ga0501077_0038939 3300049593 Bacteria 3027
406 Ga0501077_0105114 3300049593 Bacteria 1789
407 Ga0501079_0014637 3300049741 Bacteria 5982
408 Ga0501079_0027406 3300049741 Bacteria 4368
409 Ga0501080_0023678 3300049742 Bacteria 5689
410 Ga0501080_0070771 3300049742 Bacteria 3244
411 Ga0501080_0101034 3300049742 Bacteria 2675
412 Ga0501080_0749186 3300049742 Bacteria 859
413 Ga0501081_0005469 3300049743 Bacteria 8197
414 Ga0501081_0024931 3300049743 Bacteria 4020
415 Ga0501083_0010711 3300049744 Bacteria 6451
416 Ga0501083_0047706 3300049744 Bacteria 2893
417 Ga0501083_0208218 3300049744 Bacteria 1275
418 Ga0501035_0016338 3300049822 Bacteria 6847
419 Ga0501035_0033119 3300049822 Bacteria 4699
420 Ga0501035_0150663 3300049822 Bacteria 2018
421 Ga0501044_0091895 3300049823 Bacteria 3061
422 Ga0501044_0232531 3300049823 Bacteria 1790
423 Ga0501045_0069303 3300049824 Bacteria 2592
424 Ga0501045_0101157 3300049824 Bacteria 2133
425 nmdc:mga05p37_15707_c1 3300050507 Bacteria 2022
426 nmdc:mga05p37_3090_c1 3300050507 Bacteria 19345
427 nmdc:mga0n895_2551_c1 3300050512 Bacteria 14270
428 nmdc:mga0rr50_330116_c1 3300050513 Bacteria 1280
429 Ga0495601_0003652 3300053077 Bacteria 8849
430 Ga0495601_0076755 3300053077 Bacteria 2139
431 Ga0495601_0109086 3300053077 Bacteria 1792
432 Ga0495601_0288460 3300053077 Bacteria 1070
433 Ga0495612_0070030 3300053078 Bacteria 1461
434 Ga0495595_0015062 3300053084 Bacteria 3292
435 Ga0495595_0017230 3300053084 Bacteria 3107
436 Ga0495619_0001233 3300053085 Bacteria 16742
437 Ga0495619_0041808 3300053085 Bacteria 2999
438 Ga0495619_0104174 3300053085 Bacteria 1933
439 Ga0501084_0005857 3300054114 Bacteria 10116
440 Ga0501084_0008337 3300054114 Bacteria 8553
441 Ga0501084_0089247 3300054114 Bacteria 2587
442 Ga0501082_0033396 3300060353 Bacteria 4439
443 Ga0501082_0700400 3300060353 Bacteria 886
444 Ga0501082_1475810 3300060353 Bacteria 594
445 Ga0466962_0040262 3300061719 Bacteria 2237
446 Ga0530510_0019456 3300061734 Bacteria 4819
447 Ga0530510_0023395 3300061734 Bacteria 4402
448 Ga0530510_0029628 3300061734 Bacteria 3929
449 2687579825 2687453129 Bacteria 4387428
450 Ga0068858_100455495
451 JGI25159J45721_1023538
452 Ga0058862_12318768
453 Ga0070658_10087177
454 Ga0070658_10250145
455 Ga0070683_100087068
456 Ga0070683_100478310
457 Ga0068869_100830602
458 Ga0070680_100173327
459 Ga0070680_100465333
460 Ga0070680_100939201
461 Ga0070660_100016653
462 Ga0070660_100134765
463 Ga0070692_10261445
464 Ga0070692_10383200
465 Ga0070659_100065119
466 Ga0070667_100007329
467 Ga0070714_100083640
468 Ga0070714_101735280
469 Ga0070713_100505541
470 Ga0070694_100031528
471 Ga0070662_100629981
472 Ga0070681_10063131
473 Ga0070681_10271655
474 Ga0070681_10638546
475 Ga0070679_100125489
476 Ga0070679_100221642
477 Ga0070679_101767126
478 Ga0070684_100006456
479 Ga0070684_100164930
480 Ga0070684_100372162
481 Ga0070684_100761954
482 Ga0068853_100783176
483 Ga0070695_100270240
484 Ga0070696_100404266
485 Ga0068855_100161633
486 Ga0068855_100183671
487 Ga0070664_100218289
488 Ga0070664_100497702
489 Ga0068854_100655823
490 Ga0068854_101260173
491 Ga0068856_100141916
492 Ga0068856_100189529
493 Ga0068856_100364276
494 Ga0068856_100488288
495 Ga0068852_100250918
496 Ga0068852_100666708
497 Ga0068861_100506194
498 Ga0081538_10116527
499 Ga0070717_10212416
500 Ga0070717_11199251
501 Ga0075432_10012676
502 Ga0070712_100098899
503 Ga0075428_100000756
504 Ga0075433_10299564
505 Ga0075429_100132069
506 Ga0068865_100056261
507 Ga0111539_10040477
508 Ga0105245_10362730
509 Ga0105245_10420370
510 Ga0105245_13144445
511 Ga0105247_10494738
512 Ga0114129_10640664
513 Ga0105241_10683616
514 Ga0105248_10073301
515 Ga0105237_10908533
516 Ga0105237_11323161
517 Ga0105238_10966690
518 Ga0099796_10033980
519 Ga0105239_10016391
520 Ga0105239_10815103
521 Ga0105246_10356418
522 Ga0157328_1004488
523 Ga0157371_10239073
524 Ga0163162_10070283
525 Ga0157372_10125722
526 Ga0157372_10165153
527 Ga0157372_11565622
528 Ga0157375_10003777
529 Ga0157375_10543206
530 Ga0182008_10214442
531 Ga0157377_10306284
532 Ga0157379_10401073
533 Ga0157376_10281343
534 Ga0157376_10284719
535 Ga0206355_1607321
536 Ga0213875_10001045
537 Ga0207688_10021094
538 Ga0207688_10499633
539 Ga0207705_10065737
540 Ga0207705_10166959
541 Ga0207707_10017026
542 Ga0207707_10105621
543 Ga0207693_10196865
544 Ga0207660_10152191
545 Ga0207657_10010198
546 Ga0207657_10019140
547 Ga0207657_10101875
548 Ga0207657_10692199
549 Ga0207649_10577019
550 Ga0207652_10088855
551 Ga0207652_10229603
552 Ga0207652_10329250
553 Ga0207687_10055385
554 Ga0207687_10097697
555 Ga0207700_10544428
556 Ga0207664_10781114
557 Ga0207644_10477581
558 Ga0207690_10027014
559 Ga0207690_10085493
560 Ga0207706_11006427
561 Ga0207709_10232561
562 Ga0207704_10262714
563 Ga0207665_10257037
564 Ga0207711_10062889
565 Ga0207661_10444251
566 Ga0207679_10251334
567 Ga0207679_10872961
568 Ga0207667_10433268
569 Ga0207640_10148436
570 Ga0207640_10574725
571 Ga0207658_10002426
572 Ga0207703_10594429
573 Ga0207708_10207557
574 Ga0207702_10306323
575 Ga0207674_10113862
576 Ga0207675_100255860
577 Ga0207698_10243195
578 Ga0207698_11104502
579 Ga0207428_10000525
580 Ga0268265_10345716
581 Ga0265336_10012443
582 Ga0265338_10019394
583 Ga0316583_10102252
584 Ga0373940_0166681
585 Ga0373944_0094200
586 Ga0373956_0111099
587 Ga0373960_0081653
588 Ga0373943_0015299
589 Ga0373946_0016623
590 Ga0373935_0091164
591 Ga0373947_0004151
592 Ga0373947_0445430
593 Ga0373947_0504835
594 Ga0373937_0020059
595 Ga0373925_0012269
596 Ga0395899_0003510
597 Ga0395899_0022187
598 Ga0395899_0231674
599 Ga0395899_0651474
600 Ga0395900_0003292
601 Ga0395900_0006253
602 Ga0395900_0010228
603 Ga0395900_0023611
604 Ga0395900_0090950
605 Ga0395900_0170483
606 Ga0395900_0349690
607 Ga0395900_0465459
608 Ga0395898_0007592
609 Ga0395898_0014933
610 Ga0395898_0017981
611 Ga0395898_0025762
612 Ga0395898_0069563
613 Ga0395898_0346220
614 Ga0395898_0752103
615 Ga0395898_1884426
616 Ga0395905_0002725
617 Ga0395905_0005899
618 Ga0395905_0014203
619 Ga0395905_0562632
620 Ga0395905_0923136
621 Ga0436364_0121966
622 Ga0395901_0002252
623 Ga0395901_0004857
624 Ga0395901_0008438
625 Ga0395901_0017435
626 Ga0395901_0032871
627 Ga0395901_0060565
628 Ga0395901_0120936
629 Ga0395901_2155793
630 Ga0451853_2655281
631 Ga0439455_0024912
632 Ga0450920_058617
633 Ga0450900_017424
634 Ga0450907_001962
635 Ga0450907_059728
636 Ga0450916_044871
637 Ga0466969_0001344
638 Ga0466965_0022529
639 Ga0466965_0143205
640 Ga0466965_0218158
641 Ga0466966_0048365
642 Ga0466966_0072845
643 Ga0466966_0125575
644 Ga0466961_0001489
645 Ga0466961_0059551
646 Ga0466961_0088102
647 Ga0466961_0184225
648 Ga0466963_0006001
649 Ga0466963_0018623
650 Ga0466963_0052893
651 Ga0466964_0077595
652 Ga0466971_0019799
653 Ga0466971_0035439
654 Ga0466971_0244922
655 Ga0466968_0001014
656 Ga0466968_0016504
657 Ga0466968_0055203
658 Ga0466957_0007860
659 Ga0466957_0014160
660 Ga0466957_0137982
661 Ga0466957_0200281
662 Ga0466959_0013371
663 Ga0466959_0018084
664 Ga0466959_0331438
665 Ga0466958_0000746
666 Ga0466958_0021730
667 Ga0466958_0026200
668 Ga0466967_0052432
669 Ga0466967_0084597
670 Ga0466967_0118178
671 Ga0466967_0340353
672 Ga0466967_0721743
673 Ga0495592_0001046
674 Ga0495592_0015721
675 Ga0495603_0174654
676 Ga0495629_0380871
677 Ga0495641_0203390
678 Ga0495651_0000004
679 Ga0495653_0012045
680 Ga0495653_0044526
681 Ga0495653_0071623
682 Ga0495653_0808014
683 Ga0495582_0070459
684 Ga0495582_0084169
685 Ga0495582_0169124
686 Ga0495664_0177868
687 Ga0495596_0175286
688 Ga0495607_0053464
689 Ga0495608_0043456
690 Ga0495618_0003214
691 Ga0495618_0319900
692 Ga0495628_0001177
693 Ga0495628_0026811
694 Ga0495630_0051926
695 Ga0495630_0234759
696 Ga0495631_0081614
697 Ga0495637_0187056
698 Ga0495644_0017397
699 Ga0495644_0087584
700 Ga0495652_0000047
701 Ga0495652_0024242
702 Ga0495652_0135897
703 Ga0495640_0251706
704 Ga0495587_0000103
705 Ga0495645_0000028
706 Ga0495645_0038843
707 Ga0495667_0088112
708 Ga0495667_0117358
709 Ga0495656_0004373
710 Ga0495611_0106561
711 Ga0495635_0219031
712 Ga0495635_0524329
713 Ga0495588_0065217
714 Ga0495657_0002632
715 Ga0495657_0074906
716 Ga0495599_0000073
717 Ga0495623_0000105
718 Ga0495623_0019910
719 Ga0495646_0001581
720 Ga0495646_0022631
721 Ga0495669_0477533
722 Ga0495613_0317357
723 Ga0495613_0496604
724 Ga0495624_0147742
725 Ga0495670_0034075
726 Ga0495589_0060786
727 Ga0495600_0088213
728 Ga0495600_0106248
729 Ga0495581_0491862
730 Ga0495604_0000027
731 Ga0495674_0711604
732 Ga0495676_0116486
733 Ga0495680_0001582
734 Ga0495680_0044887
735 Ga0495680_0161061
736 Ga0495675_0000273
737 Ga0495679_028706
738 Ga0495684_0059758
739 Ga0495602_0000096
740 Ga0495602_0191304
741 Ga0496100_0127071
742 Ga0496101_0006305
743 Ga0496101_0283848
744 Ga0496102_0063054
745 Ga0496102_0080162
746 Ga0496103_0019091
747 Ga0496103_0027842
748 Ga0496104_0090436
749 Ga0496104_0100793
750 Ga0496105_0066088
751 Ga0496105_0181343
752 Ga0496106_0191347
753 Ga0496108_0004672
754 Ga0496108_0005299
755 Ga0496108_0078215
756 Ga0496108_0709009
757 Ga0496109_0006626
758 Ga0496109_0012945
759 Ga0496109_0021005
760 Ga0496109_0321677
761 Ga0496109_0330294
762 Ga0496109_1661623
763 Ga0496110_0003987
764 Ga0496110_0036806
765 Ga0496110_0107979
766 Ga0496110_0479392
767 Ga0496111_0004611
768 Ga0496111_0288729
769 Ga0496111_0597021
770 Ga0496112_0002778
771 Ga0496112_0012982
772 Ga0496112_0023401
773 Ga0496112_0142346
774 Ga0496112_0162116
775 Ga0496112_0172744
776 Ga0496112_1193758
777 Ga0496113_0017197
778 Ga0496113_0094629
779 Ga0496113_0266616
780 Ga0496113_0661461
781 Ga0496114_0007830
782 Ga0496114_0035412
783 Ga0496114_0350930
784 Ga0496115_0001419
785 Ga0496115_0003525
786 Ga0501312_001018
787 Ga0501031_0040387
788 Ga0501031_0120037
789 Ga0501031_0120803
790 Ga0501032_0009175
791 Ga0501032_0083677
792 Ga0501032_0424095
793 Ga0501033_0025703
794 Ga0501033_0528297
795 Ga0501033_0763258
796 Ga0501034_0273916
797 Ga0501034_0403143
798 Ga0501034_0689108
799 Ga0501036_0017570
800 Ga0501036_0423622
801 Ga0501037_0004963
802 Ga0501037_0616739
803 Ga0501038_0059539
804 Ga0501039_0043675
805 Ga0501039_0081735
806 Ga0501039_0640256
807 Ga0501040_0007711
808 Ga0501040_0027592
809 Ga0501040_0100312
810 Ga0501041_0023711
811 Ga0501041_0032108
812 Ga0501042_0004568
813 Ga0501042_0012720
814 Ga0501042_0018437
815 Ga0501043_0060479
816 Ga0501043_0070163
817 Ga0501043_0241559
818 Ga0501046_0021734
819 Ga0501046_0077375
820 Ga0501047_0651680
821 Ga0501048_0018873
822 Ga0501048_0028438
823 Ga0501048_0200758
824 Ga0501067_0199688
825 Ga0501068_0007629
826 Ga0501069_0008477
827 Ga0501069_0021953
828 Ga0501069_0088541
829 Ga0501069_0865527
830 Ga0501070_0000176
831 Ga0501070_0008821
832 Ga0501070_0020101
833 Ga0501070_0088612
834 Ga0501070_0196607
835 Ga0501070_0548696
836 Ga0501071_0005213
837 Ga0501071_0034760
838 Ga0501071_0035488
839 Ga0501072_0017010
840 Ga0501072_0027108
841 Ga0501072_0664814
842 Ga0501073_0043202
843 Ga0501073_0123800
844 Ga0501073_0178386
845 Ga0501074_0002043
846 Ga0501074_0005872
847 Ga0501074_0066585
848 Ga0501075_0507113
849 Ga0501076_0023161
850 Ga0501076_0037324
851 Ga0501076_0055466
852 Ga0501076_0855777
853 Ga0501077_0035999
854 Ga0501077_0038939
855 Ga0501077_0105114
856 Ga0501079_0014637
857 Ga0501079_0027406
858 Ga0501080_0023678
859 Ga0501080_0070771
860 Ga0501080_0101034
861 Ga0501080_0749186
862 Ga0501081_0005469
863 Ga0501081_0024931
864 Ga0501083_0010711
865 Ga0501083_0047706
866 Ga0501083_0208218
867 Ga0501035_0016338
868 Ga0501035_0033119
869 Ga0501035_0150663
870 Ga0501044_0091895
871 Ga0501044_0232531
872 Ga0501045_0069303
873 Ga0501045_0101157
874 nmdc:mga05p37_15707_c1
875 nmdc:mga05p37_3090_c1
876 nmdc:mga0n895_2551_c1
877 nmdc:mga0rr50_330116_c1
878 Ga0495601_0003652
879 Ga0495601_0076755
880 Ga0495601_0109086
881 Ga0495601_0288460
882 Ga0495612_0070030
883 Ga0495595_0015062
884 Ga0495595_0017230
885 Ga0495619_0001233
886 Ga0495619_0041808
887 Ga0495619_0104174
888 Ga0501084_0005857
889 Ga0501084_0008337
890 Ga0501084_0089247
891 Ga0501082_0033396
892 Ga0501082_0700400
893 Ga0501082_1475810
894 Ga0466962_0040262
895 Ga0530510_0019456
896 Ga0530510_0023395
897 Ga0530510_0029628
898 2687579825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

19

156

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9846 6 151
4lfk-assembly1.cif.gz_B crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form 0.9781 6 148
1o1x-assembly1.cif.gz_A crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution 0.9767 5 147
3s5p-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase b rpib from giardia lamblia 0.9767 5 133
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9759 2 149
ID Description Score Start End Superfamily
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9865 6 150 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9781 6 148 3.40.1400.10
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9767 5 133 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9735 5 147 3.40.1400.10
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9724 6 132 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A7S7NYL1-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.9988 6 150 GO:0005975
GO:0016861
AF-A0A1V6M1G7-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9969 6 148 GO:0004347
GO:0004801
GO:0005737
GO:0006094
GO:0006096
GO:0006098
GO:0097367
AF-A0A8B5WR16-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9963 6 151 GO:0005975
GO:0016861
AF-A0A536LPP1-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.996 6 151 GO:0004751
GO:0005975
AF-A0A7C1V9Z5-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.996 19 151 GO:0005975
GO:0016861

Map