F446337
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 449 | 240 | 446 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300005616|Ga0068852_100907405|Ga0068852_1009074052 |
| Length | 198 |
| Sequence | MAILKFRIYFEEDDSVYRDVVIRHKQSFFDLHEAILKSFEFDNKHAATFYRSNDNWQRGREISLEVYEKKYKAAPLLMKETTIGSEIQDPNQKFIYVYDFAKNWSFQVELINVSKEENPKITYPAVIRKEGIPPSQYGTKSLLGERFTDIEEKYVLTKGAEGFGEEGEEGTTDSTSDEFGGEESASEEEAFFFVERTI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 3 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 91 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 138 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 139 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 140 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 141 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 142 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 143 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 144 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 147 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 148 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 149 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 150 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 151 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 152 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 155 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 156 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 157 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 158 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 159 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 160 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 161 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 162 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 163 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 164 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 165 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 166 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 167 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 168 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 169 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 170 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 171 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 172 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 173 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 185 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 186 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 187 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 200 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 201 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 202 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 203 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 204 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 205 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 206 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 207 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 208 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 209 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 210 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 211 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 212 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 213 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 214 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 215 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 216 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 217 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 220 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 222 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 223 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 224 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 225 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 226 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 227 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 228 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 229 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 230 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 231 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 232 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 233 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 234 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 235 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 236 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 237 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 238 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 239 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 240 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.11 |
| Metatranscriptomes | 0.22 |
| Isolates | 0.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.13 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 85.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10004081 | 3300001979 | Bacteria | 6318 |
| 2 | JGI24740J21852_10021865 | 3300001979 | Bacteria | 2210 |
| 3 | JGI24737J22298_10127208 | 3300001990 | Bacteria | 753 |
| 4 | JGI25154J39366_1000008 | 3300002738 | Bacteria | 315375 |
| 5 | JGI25158J39367_1011892 | 3300002739 | Bacteria | 1153 |
| 6 | JGI25153J46596_10001413 | 3300003215 | Bacteria | 14398 |
| 7 | rootH1_10060251 | 3300003316 | Bacteria | 6452 |
| 8 | rootH1_10096109 | 3300003316 | Bacteria | 1238 |
| 9 | rootH2_10030144 | 3300003320 | Bacteria | 6564 |
| 10 | rootL2_10044891 | 3300003322 | Bacteria | 5631 |
| 11 | rootH1_10038549 | 3300003323 | Bacteria | 10317 |
| 12 | rootH1_10055347 | 3300003323 | Bacteria | 26133 |
| 13 | rootH1_10111962 | 3300003323 | Bacteria | 1603 |
| 14 | rootH1_10116642 | 3300003323 | Bacteria | 1996 |
| 15 | rootH1_10265137 | 3300003323 | Unclassified | 3362 |
| 16 | rootH1_10374198 | 3300003323 | Bacteria | 1934 |
| 17 | JGI25160J50197_1002257 | 3300003354 | Bacteria | 9045 |
| 18 | Ga0055535_1005622 | 3300003761 | Bacteria | 2704 |
| 19 | Ga0055542_1003917 | 3300003762 | Bacteria | 3819 |
| 20 | Ga0055531_10005359 | 3300003794 | Bacteria | 7520 |
| 21 | Ga0065165_1014717 | 3300005262 | Bacteria | 3024 |
| 22 | Ga0065704_10001498 | 3300005289 | Bacteria | 9163 |
| 23 | Ga0065712_10091398 | 3300005290 | Bacteria | 2373 |
| 24 | Ga0070658_10091083 | 3300005327 | Bacteria | 2513 |
| 25 | Ga0070676_10396415 | 3300005328 | Unclassified | 959 |
| 26 | Ga0070683_100046014 | 3300005329 | Bacteria | 4029 |
| 27 | Ga0070683_100282182 | 3300005329 | Unclassified | 1580 |
| 28 | Ga0070670_100073261 | 3300005331 | Unclassified | 2942 |
| 29 | Ga0070670_100086363 | 3300005331 | Bacteria | 2696 |
| 30 | Ga0070670_100234877 | 3300005331 | Unclassified | 1596 |
| 31 | Ga0068869_100119957 | 3300005334 | Bacteria | 2010 |
| 32 | Ga0068869_100396369 | 3300005334 | Bacteria | 1134 |
| 33 | Ga0070666_10074210 | 3300005335 | Bacteria | 2318 |
| 34 | Ga0070680_100166424 | 3300005336 | Bacteria | 1854 |
| 35 | Ga0070680_101190987 | 3300005336 | Bacteria | 659 |
| 36 | Ga0070682_100025077 | 3300005337 | Bacteria | 3556 |
| 37 | Ga0068868_101189979 | 3300005338 | Bacteria | 704 |
| 38 | Ga0070660_100023293 | 3300005339 | Bacteria | 4587 |
| 39 | Ga0070660_100257834 | 3300005339 | Bacteria | 1423 |
| 40 | Ga0070687_100167658 | 3300005343 | Bacteria | 1304 |
| 41 | Ga0070661_100052441 | 3300005344 | Bacteria | 2986 |
| 42 | Ga0070692_10554349 | 3300005345 | Bacteria | 753 |
| 43 | Ga0070669_100583121 | 3300005353 | Unclassified | 935 |
| 44 | Ga0070675_100014673 | 3300005354 | Bacteria | 6180 |
| 45 | Ga0070675_100286548 | 3300005354 | Bacteria | 1449 |
| 46 | Ga0070675_100820413 | 3300005354 | Bacteria | 851 |
| 47 | Ga0070671_100021409 | 3300005355 | Bacteria | 5280 |
| 48 | Ga0070671_100101961 | 3300005355 | Bacteria | 2408 |
| 49 | Ga0070674_100196408 | 3300005356 | Bacteria | 1555 |
| 50 | Ga0070673_100092153 | 3300005364 | Bacteria | 2478 |
| 51 | Ga0070673_100451779 | 3300005364 | Unclassified | 1156 |
| 52 | Ga0070673_100467087 | 3300005364 | Bacteria | 1137 |
| 53 | Ga0070673_100475363 | 3300005364 | Unclassified | 1127 |
| 54 | Ga0070659_100000832 | 3300005366 | Bacteria | 22486 |
| 55 | Ga0070659_100003144 | 3300005366 | Bacteria | 11757 |
| 56 | Ga0070667_100078976 | 3300005367 | Bacteria | 2812 |
| 57 | Ga0070663_100141848 | 3300005455 | Bacteria | 1835 |
| 58 | Ga0070678_100203881 | 3300005456 | Bacteria | 1634 |
| 59 | Ga0070662_100011837 | 3300005457 | Bacteria | 5767 |
| 60 | Ga0070681_10288233 | 3300005458 | Bacteria | 1552 |
| 61 | Ga0070681_10476266 | 3300005458 | Bacteria | 1161 |
| 62 | Ga0070681_10513000 | 3300005458 | Unclassified | 1112 |
| 63 | Ga0068867_100225040 | 3300005459 | Bacteria | 1514 |
| 64 | Ga0070707_100710515 | 3300005468 | Bacteria | 968 |
| 65 | Ga0070679_100028368 | 3300005530 | Bacteria | 5518 |
| 66 | Ga0070684_100059136 | 3300005535 | Bacteria | 3350 |
| 67 | Ga0070684_100108792 | 3300005535 | Unclassified | 2484 |
| 68 | Ga0068853_100025196 | 3300005539 | Bacteria | 4991 |
| 69 | Ga0068853_100142650 | 3300005539 | Bacteria | 2151 |
| 70 | Ga0068853_100161047 | 3300005539 | Bacteria | 2025 |
| 71 | Ga0068853_100527288 | 3300005539 | Bacteria | 1117 |
| 72 | Ga0070672_100101950 | 3300005543 | Bacteria | 2329 |
| 73 | Ga0070672_100209689 | 3300005543 | Unclassified | 1631 |
| 74 | Ga0070665_100000074 | 3300005548 | Bacteria | 192944 |
| 75 | Ga0068855_100036619 | 3300005563 | Bacteria | 5838 |
| 76 | Ga0068855_100146363 | 3300005563 | Bacteria | 2689 |
| 77 | Ga0068855_100256679 | 3300005563 | Unclassified | 1949 |
| 78 | Ga0070664_100000950 | 3300005564 | Bacteria | 22641 |
| 79 | Ga0070664_100465328 | 3300005564 | Bacteria | 1162 |
| 80 | Ga0068857_100003072 | 3300005577 | Bacteria | 13802 |
| 81 | Ga0068857_100018903 | 3300005577 | Bacteria | 6045 |
| 82 | Ga0068857_100125641 | 3300005577 | Bacteria | 2311 |
| 83 | Ga0068857_100151253 | 3300005577 | Unclassified | 2103 |
| 84 | Ga0068857_100165413 | 3300005577 | Bacteria | 2008 |
| 85 | Ga0068854_100025843 | 3300005578 | Bacteria | 4030 |
| 86 | Ga0068856_100034120 | 3300005614 | Bacteria | 4984 |
| 87 | Ga0068856_100079438 | 3300005614 | Bacteria | 3253 |
| 88 | Ga0068856_100139226 | 3300005614 | Bacteria | 2434 |
| 89 | Ga0068856_100173876 | 3300005614 | Unclassified | 2166 |
| 90 | Ga0070702_100459596 | 3300005615 | Bacteria | 925 |
| 91 | Ga0068852_100001764 | 3300005616 | Bacteria | 14723 |
| 92 | Ga0068852_100002876 | 3300005616 | Bacteria | 11944 |
| 93 | Ga0068852_100005383 | 3300005616 | Bacteria | 9151 |
| 94 | Ga0068852_100095007 | 3300005616 | Bacteria | 2676 |
| 95 | Ga0068852_100096553 | 3300005616 | Bacteria | 2657 |
| 96 | Ga0068852_100263909 | 3300005616 | Unclassified | 1654 |
| 97 | Ga0068852_100344656 | 3300005616 | Bacteria | 1453 |
| 98 | Ga0068852_100907405 | 3300005616 | Bacteria | 898 |
| 99 | Ga0068864_100199168 | 3300005618 | Bacteria | 1839 |
| 100 | Ga0068864_100630090 | 3300005618 | Bacteria | 1043 |
| 101 | Ga0068851_10214797 | 3300005834 | Bacteria | 1078 |
| 102 | Ga0068870_10189405 | 3300005840 | Unclassified | 1240 |
| 103 | Ga0068860_100000034 | 3300005843 | Bacteria | 243128 |
| 104 | Ga0068860_100009185 | 3300005843 | Bacteria | 9826 |
| 105 | Ga0068860_100045048 | 3300005843 | Bacteria | 4205 |
| 106 | Ga0075366_10397399 | 3300006195 | Bacteria | 848 |
| 107 | Ga0097621_100027306 | 3300006237 | Bacteria | 4488 |
| 108 | Ga0097621_100085669 | 3300006237 | Bacteria | 2628 |
| 109 | Ga0097621_100536989 | 3300006237 | Bacteria | 1063 |
| 110 | Ga0068871_100001620 | 3300006358 | Bacteria | 15167 |
| 111 | Ga0068871_101231515 | 3300006358 | Unclassified | 703 |
| 112 | Ga0075428_100386762 | 3300006844 | Bacteria | 1500 |
| 113 | Ga0075431_100044659 | 3300006847 | Bacteria | 4569 |
| 114 | Ga0075429_100058362 | 3300006880 | Unclassified | 3360 |
| 115 | Ga0068865_100595392 | 3300006881 | Unclassified | 934 |
| 116 | Ga0105240_10000008 | 3300009093 | Bacteria | 618862 |
| 117 | Ga0105240_10000059 | 3300009093 | Bacteria | 219860 |
| 118 | Ga0105240_10000753 | 3300009093 | Bacteria | 59090 |
| 119 | Ga0105240_10016430 | 3300009093 | Bacteria | 10021 |
| 120 | Ga0105240_10059903 | 3300009093 | Bacteria | 4748 |
| 121 | Ga0105240_10134524 | 3300009093 | Bacteria | 2962 |
| 122 | Ga0114129_10014867 | 3300009147 | Bacteria | 11089 |
| 123 | Ga0114129_10068767 | 3300009147 | Bacteria | 4937 |
| 124 | Ga0105241_10004808 | 3300009174 | Bacteria | 9951 |
| 125 | Ga0105241_10066594 | 3300009174 | Bacteria | 2786 |
| 126 | Ga0105241_10075190 | 3300009174 | Bacteria | 2632 |
| 127 | Ga0105241_10372371 | 3300009174 | Bacteria | 1246 |
| 128 | Ga0105241_10590747 | 3300009174 | Bacteria | 1002 |
| 129 | Ga0105237_10000137 | 3300009545 | Bacteria | 102639 |
| 130 | Ga0105237_10000365 | 3300009545 | Bacteria | 64152 |
| 131 | Ga0105237_10019925 | 3300009545 | Bacteria | 6925 |
| 132 | Ga0105237_10057490 | 3300009545 | Bacteria | 3892 |
| 133 | Ga0105237_10272495 | 3300009545 | Bacteria | 1695 |
| 134 | Ga0105237_10278614 | 3300009545 | Bacteria | 1675 |
| 135 | Ga0105237_10352893 | 3300009545 | Bacteria | 1475 |
| 136 | Ga0105238_10001640 | 3300009551 | Bacteria | 22429 |
| 137 | Ga0105238_10079019 | 3300009551 | Bacteria | 3279 |
| 138 | Ga0105238_10499119 | 3300009551 | Bacteria | 1217 |
| 139 | Ga0105239_10013585 | 3300010375 | Bacteria | 9039 |
| 140 | Ga0105239_10017342 | 3300010375 | Bacteria | 7965 |
| 141 | Ga0105239_10083774 | 3300010375 | Bacteria | 3512 |
| 142 | Ga0105239_10519656 | 3300010375 | Bacteria | 1354 |
| 143 | Ga0157373_10010080 | 3300013100 | Bacteria | 6963 |
| 144 | Ga0157373_10063980 | 3300013100 | Bacteria | 2604 |
| 145 | Ga0157373_10185581 | 3300013100 | Bacteria | 1465 |
| 146 | Ga0157371_10014609 | 3300013102 | Bacteria | 5918 |
| 147 | Ga0157371_10040631 | 3300013102 | Bacteria | 3321 |
| 148 | Ga0157371_10061853 | 3300013102 | Bacteria | 2655 |
| 149 | Ga0157371_10187722 | 3300013102 | Bacteria | 1479 |
| 150 | Ga0157370_10010368 | 3300013104 | Bacteria | 9824 |
| 151 | Ga0157370_10287782 | 3300013104 | Bacteria | 1518 |
| 152 | Ga0157370_10460370 | 3300013104 | Bacteria | 1169 |
| 153 | Ga0157369_10006593 | 3300013105 | Bacteria | 13423 |
| 154 | Ga0157369_10081519 | 3300013105 | Bacteria | 3462 |
| 155 | Ga0157369_10192829 | 3300013105 | Unclassified | 2140 |
| 156 | Ga0157369_10243594 | 3300013105 | Bacteria | 1877 |
| 157 | Ga0157369_10703765 | 3300013105 | Bacteria | 1040 |
| 158 | Ga0157369_10752459 | 3300013105 | Bacteria | 1002 |
| 159 | Ga0157369_11387706 | 3300013105 | Bacteria | 715 |
| 160 | Ga0157374_10001675 | 3300013296 | Bacteria | 18564 |
| 161 | Ga0157374_10019513 | 3300013296 | Bacteria | 6001 |
| 162 | Ga0157374_10023310 | 3300013296 | Bacteria | 5536 |
| 163 | Ga0157374_10027788 | 3300013296 | Bacteria | 5107 |
| 164 | Ga0157374_10078178 | 3300013296 | Bacteria | 3133 |
| 165 | Ga0157374_10446192 | 3300013296 | Bacteria | 1295 |
| 166 | Ga0157378_10020257 | 3300013297 | Bacteria | 5850 |
| 167 | Ga0157378_10451300 | 3300013297 | Bacteria | 1276 |
| 168 | Ga0163162_10016723 | 3300013306 | Bacteria | 7170 |
| 169 | Ga0163162_10151141 | 3300013306 | Bacteria | 2440 |
| 170 | Ga0163162_11279332 | 3300013306 | Bacteria | 833 |
| 171 | Ga0157372_10005542 | 3300013307 | Bacteria | 13422 |
| 172 | Ga0157372_10026285 | 3300013307 | Bacteria | 6333 |
| 173 | Ga0157372_10067003 | 3300013307 | Bacteria | 4034 |
| 174 | Ga0157372_10081466 | 3300013307 | Bacteria | 3664 |
| 175 | Ga0157372_10144970 | 3300013307 | Bacteria | 2738 |
| 176 | Ga0157372_10154477 | 3300013307 | Bacteria | 2650 |
| 177 | Ga0157372_10206258 | 3300013307 | Bacteria | 2278 |
| 178 | Ga0157372_10702449 | 3300013307 | Unclassified | 1177 |
| 179 | Ga0157372_10812889 | 3300013307 | Bacteria | 1086 |
| 180 | Ga0157372_10999009 | 3300013307 | Bacteria | 969 |
| 181 | Ga0157372_11334515 | 3300013307 | Bacteria | 827 |
| 182 | Ga0157372_11350344 | 3300013307 | Bacteria | 822 |
| 183 | Ga0157375_10386631 | 3300013308 | Bacteria | 1566 |
| 184 | Ga0157375_10563550 | 3300013308 | Unclassified | 1300 |
| 185 | Ga0163163_10013034 | 3300014325 | Bacteria | 7590 |
| 186 | Ga0157380_10038914 | 3300014326 | Bacteria | 3695 |
| 187 | Ga0157377_10021622 | 3300014745 | Bacteria | 3386 |
| 188 | Ga0157376_10900266 | 3300014969 | Unclassified | 903 |
| 189 | Ga0206356_11653086 | 3300020070 | Bacteria | 670 |
| 190 | Ga0209436_104011 | 3300025208 | Bacteria | 3724 |
| 191 | Ga0209646_1000045 | 3300025246 | Bacteria | 333765 |
| 192 | Ga0209646_1002910 | 3300025246 | Bacteria | 3568 |
| 193 | Ga0209026_1000075 | 3300025250 | Bacteria | 202874 |
| 194 | Ga0209130_1000915 | 3300025284 | Bacteria | 23743 |
| 195 | Ga0209758_1005408 | 3300025297 | Bacteria | 9866 |
| 196 | Ga0207426_1000073 | 3300025302 | Bacteria | 323756 |
| 197 | Ga0207426_1000236 | 3300025302 | Bacteria | 125348 |
| 198 | Ga0207656_10124563 | 3300025321 | Unclassified | 1203 |
| 199 | Ga0207680_10035952 | 3300025903 | Bacteria | 2849 |
| 200 | Ga0207647_10000949 | 3300025904 | Bacteria | 22419 |
| 201 | Ga0207647_10019524 | 3300025904 | Bacteria | 4556 |
| 202 | Ga0207705_10550841 | 3300025909 | Bacteria | 897 |
| 203 | Ga0207654_10011230 | 3300025911 | Bacteria | 4565 |
| 204 | Ga0207654_10032051 | 3300025911 | Bacteria | 2899 |
| 205 | Ga0207654_10366178 | 3300025911 | Bacteria | 995 |
| 206 | Ga0207654_10560261 | 3300025911 | Bacteria | 812 |
| 207 | Ga0207707_10436752 | 3300025912 | Bacteria | 1121 |
| 208 | Ga0207695_10000021 | 3300025913 | Bacteria | 679399 |
| 209 | Ga0207695_10000039 | 3300025913 | Bacteria | 454801 |
| 210 | Ga0207695_10000982 | 3300025913 | Bacteria | 50708 |
| 211 | Ga0207695_10066857 | 3300025913 | Bacteria | 3689 |
| 212 | Ga0207695_10067837 | 3300025913 | Bacteria | 3657 |
| 213 | Ga0207695_10169755 | 3300025913 | Bacteria | 2108 |
| 214 | Ga0207695_10215884 | 3300025913 | Bacteria | 1827 |
| 215 | Ga0207671_10000424 | 3300025914 | Bacteria | 58429 |
| 216 | Ga0207671_10002130 | 3300025914 | Bacteria | 21609 |
| 217 | Ga0207671_10002759 | 3300025914 | Bacteria | 18342 |
| 218 | Ga0207671_10023057 | 3300025914 | Bacteria | 4697 |
| 219 | Ga0207671_10077374 | 3300025914 | Bacteria | 2490 |
| 220 | Ga0207671_10114567 | 3300025914 | Bacteria | 2055 |
| 221 | Ga0207662_10567962 | 3300025918 | Bacteria | 787 |
| 222 | Ga0207657_10004992 | 3300025919 | Bacteria | 13947 |
| 223 | Ga0207649_10183785 | 3300025920 | Unclassified | 1465 |
| 224 | Ga0207649_10191877 | 3300025920 | Bacteria | 1437 |
| 225 | Ga0207649_10207145 | 3300025920 | Bacteria | 1389 |
| 226 | Ga0207652_10031118 | 3300025921 | Bacteria | 4479 |
| 227 | Ga0207652_10240660 | 3300025921 | Bacteria | 1631 |
| 228 | Ga0207694_10048130 | 3300025924 | Bacteria | 3299 |
| 229 | Ga0207694_10800206 | 3300025924 | Bacteria | 796 |
| 230 | Ga0207650_10001164 | 3300025925 | Bacteria | 19325 |
| 231 | Ga0207650_10089075 | 3300025925 | Bacteria | 2355 |
| 232 | Ga0207650_10109201 | 3300025925 | Unclassified | 2139 |
| 233 | Ga0207650_10363660 | 3300025925 | Unclassified | 1192 |
| 234 | Ga0207659_10106278 | 3300025926 | Unclassified | 2125 |
| 235 | Ga0207659_10392493 | 3300025926 | Bacteria | 1159 |
| 236 | Ga0207644_10544516 | 3300025931 | Bacteria | 960 |
| 237 | Ga0207690_10011088 | 3300025932 | Bacteria | 5375 |
| 238 | Ga0207690_10924208 | 3300025932 | Bacteria | 724 |
| 239 | Ga0207706_10007504 | 3300025933 | Bacteria | 10089 |
| 240 | Ga0207704_10971224 | 3300025938 | Unclassified | 717 |
| 241 | Ga0207691_10213706 | 3300025940 | Unclassified | 1674 |
| 242 | Ga0207691_10342950 | 3300025940 | Bacteria | 1279 |
| 243 | Ga0207691_10569472 | 3300025940 | Unclassified | 960 |
| 244 | Ga0207689_10203970 | 3300025942 | Bacteria | 1632 |
| 245 | Ga0207689_10474581 | 3300025942 | Bacteria | 1047 |
| 246 | Ga0207661_10083922 | 3300025944 | Bacteria | 2637 |
| 247 | Ga0207661_10751690 | 3300025944 | Unclassified | 897 |
| 248 | Ga0207679_10033771 | 3300025945 | Bacteria | 3603 |
| 249 | Ga0207679_10933464 | 3300025945 | Unclassified | 794 |
| 250 | Ga0207667_10004578 | 3300025949 | Bacteria | 16953 |
| 251 | Ga0207667_10009515 | 3300025949 | Bacteria | 11435 |
| 252 | Ga0207667_10247233 | 3300025949 | Unclassified | 1825 |
| 253 | Ga0207667_11116782 | 3300025949 | Bacteria | 771 |
| 254 | Ga0207651_10069166 | 3300025960 | Bacteria | 2492 |
| 255 | Ga0207651_10167628 | 3300025960 | Bacteria | 1729 |
| 256 | Ga0207651_10689834 | 3300025960 | Unclassified | 899 |
| 257 | Ga0207640_10128591 | 3300025981 | Bacteria | 1827 |
| 258 | Ga0207658_10059734 | 3300025986 | Bacteria | 2842 |
| 259 | Ga0207658_10854346 | 3300025986 | Bacteria | 828 |
| 260 | Ga0207677_10037523 | 3300026023 | Bacteria | 3168 |
| 261 | Ga0207677_10248423 | 3300026023 | Unclassified | 1443 |
| 262 | Ga0207639_10004585 | 3300026041 | Bacteria | 9301 |
| 263 | Ga0207639_10032669 | 3300026041 | Bacteria | 3833 |
| 264 | Ga0207639_10121869 | 3300026041 | Bacteria | 2144 |
| 265 | Ga0207639_10278340 | 3300026041 | Bacteria | 1470 |
| 266 | Ga0207639_11075582 | 3300026041 | Bacteria | 754 |
| 267 | Ga0207678_10847527 | 3300026067 | Bacteria | 807 |
| 268 | Ga0207702_10099342 | 3300026078 | Bacteria | 2565 |
| 269 | Ga0207702_10156386 | 3300026078 | Bacteria | 2078 |
| 270 | Ga0207641_10085072 | 3300026088 | Bacteria | 2755 |
| 271 | Ga0207648_10021754 | 3300026089 | Bacteria | 5763 |
| 272 | Ga0207648_10861740 | 3300026089 | Bacteria | 845 |
| 273 | Ga0207676_10257700 | 3300026095 | Bacteria | 1573 |
| 274 | Ga0207676_10717891 | 3300026095 | Bacteria | 970 |
| 275 | Ga0207676_11095542 | 3300026095 | Bacteria | 787 |
| 276 | Ga0207674_10004689 | 3300026116 | Bacteria | 16408 |
| 277 | Ga0207674_10029388 | 3300026116 | Bacteria | 5786 |
| 278 | Ga0207674_10073413 | 3300026116 | Unclassified | 3435 |
| 279 | Ga0207674_10160306 | 3300026116 | Bacteria | 2204 |
| 280 | Ga0207674_10415741 | 3300026116 | Bacteria | 1299 |
| 281 | Ga0207674_10717172 | 3300026116 | Bacteria | 965 |
| 282 | Ga0207675_100194783 | 3300026118 | Bacteria | 1945 |
| 283 | Ga0207675_100759727 | 3300026118 | Bacteria | 981 |
| 284 | Ga0207683_10291555 | 3300026121 | Bacteria | 1492 |
| 285 | Ga0207698_10001608 | 3300026142 | Bacteria | 13148 |
| 286 | Ga0207698_10037457 | 3300026142 | Bacteria | 3572 |
| 287 | Ga0207698_10063846 | 3300026142 | Bacteria | 2884 |
| 288 | Ga0207698_10064305 | 3300026142 | Bacteria | 2875 |
| 289 | Ga0207698_10064831 | 3300026142 | Bacteria | 2865 |
| 290 | Ga0207698_10191776 | 3300026142 | Unclassified | 1821 |
| 291 | Ga0207698_10258136 | 3300026142 | Unclassified | 1599 |
| 292 | Ga0207698_10262869 | 3300026142 | Bacteria | 1586 |
| 293 | Ga0209968_1031823 | 3300027526 | Bacteria | 884 |
| 294 | Ga0209999_1016392 | 3300027543 | Unclassified | 1348 |
| 295 | Ga0268266_10000010 | 3300028379 | Bacteria | 1030233 |
| 296 | Ga0268264_10000052 | 3300028381 | Bacteria | 321218 |
| 297 | Ga0268264_10001431 | 3300028381 | Bacteria | 22308 |
| 298 | Ga0268264_10204210 | 3300028381 | Unclassified | 1810 |
| 299 | Ga0307517_10133681 | 3300028786 | Bacteria | 1774 |
| 300 | Ga0307511_10001606 | 3300030521 | Bacteria | 23990 |
| 301 | Ga0265327_10000054 | 3300031251 | Bacteria | 250337 |
| 302 | Ga0265327_10063702 | 3300031251 | Bacteria | 1871 |
| 303 | Ga0307513_10028247 | 3300031456 | Bacteria | 6417 |
| 304 | Ga0307509_10390766 | 3300031507 | Bacteria | 1101 |
| 305 | Ga0307516_10001143 | 3300031730 | Bacteria | 37055 |
| 306 | Ga0307516_10414771 | 3300031730 | Bacteria | 1005 |
| 307 | Ga0307406_10068183 | 3300031901 | Bacteria | 2322 |
| 308 | Ga0307407_10261945 | 3300031903 | Bacteria | 1190 |
| 309 | Ga0307416_100022237 | 3300032002 | Unclassified | 4573 |
| 310 | Ga0307416_101898748 | 3300032002 | Unclassified | 699 |
| 311 | Ga0307414_10562331 | 3300032004 | Bacteria | 1018 |
| 312 | Ga0307415_100059941 | 3300032126 | Bacteria | 2627 |
| 313 | Ga0307510_10000869 | 3300033180 | Bacteria | 31741 |
| 314 | Ga0373935_0583871 | 3300035692 | Unclassified | 816 |
| 315 | Ga0373927_0110428 | 3300035695 | Bacteria | 1791 |
| 316 | Ga0395900_0473941 | 3300037418 | Bacteria | 1205 |
| 317 | Ga0395905_0004912 | 3300037471 | Bacteria | 13770 |
| 318 | Ga0395905_1154029 | 3300037471 | Unclassified | 678 |
| 319 | Ga0395901_1318307 | 3300038443 | Bacteria | 683 |
| 320 | Ga0436365_1876803 | 3300039437 | Bacteria | 22992 |
| 321 | Ga0439436_0053945 | 3300041404 | Bacteria | 1131 |
| 322 | Ga0439439_0015814 | 3300041406 | Bacteria | 1844 |
| 323 | Ga0439439_0065488 | 3300041406 | Bacteria | 969 |
| 324 | Ga0451841_1322386 | 3300041498 | Bacteria | 3266 |
| 325 | Ga0439431_0002975 | 3300041997 | Bacteria | 3719 |
| 326 | Ga0439433_0052526 | 3300041999 | Bacteria | 963 |
| 327 | Ga0439445_0002757 | 3300042004 | Bacteria | 3917 |
| 328 | Ga0439449_0011275 | 3300042007 | Bacteria | 3366 |
| 329 | Ga0439449_0028173 | 3300042007 | Bacteria | 2094 |
| 330 | Ga0451577_0066392 | 3300042876 | Bacteria | 3218 |
| 331 | Ga0466972_0000348 | 3300044658 | Bacteria | 25310 |
| 332 | Ga0466972_0000422 | 3300044658 | Bacteria | 21982 |
| 333 | Ga0466972_0015986 | 3300044658 | Bacteria | 3751 |
| 334 | Ga0466965_0371490 | 3300044683 | Bacteria | 786 |
| 335 | Ga0466961_0246328 | 3300044693 | Bacteria | 1098 |
| 336 | Ga0453684_0030904 | 3300044712 | Bacteria | 7551 |
| 337 | Ga0453684_0235965 | 3300044712 | Bacteria | 2108 |
| 338 | Ga0466968_0087801 | 3300044735 | Bacteria | 1374 |
| 339 | Ga0466968_0107144 | 3300044735 | Bacteria | 1253 |
| 340 | Ga0466970_0001701 | 3300044765 | Bacteria | 10578 |
| 341 | Ga0466957_0000134 | 3300044842 | Bacteria | 31410 |
| 342 | Ga0466957_0008275 | 3300044842 | Bacteria | 5912 |
| 343 | Ga0466957_0225471 | 3300044842 | Unclassified | 1239 |
| 344 | Ga0466957_0649260 | 3300044842 | Bacteria | 742 |
| 345 | Ga0466959_0033328 | 3300045049 | Bacteria | 3809 |
| 346 | Ga0466959_0123511 | 3300045049 | Unclassified | 1839 |
| 347 | Ga0451576_0857981 | 3300045051 | Bacteria | 953 |
| 348 | Ga0466967_0112998 | 3300045976 | Bacteria | 2498 |
| 349 | Ga0466967_0694321 | 3300045976 | Bacteria | 1008 |
| 350 | Ga0466967_1278548 | 3300045976 | Bacteria | 731 |
| 351 | Ga0495638_0049942 | 3300046460 | Bacteria | 2614 |
| 352 | Ga0495638_0173026 | 3300046460 | Unclassified | 1238 |
| 353 | Ga0495606_0022321 | 3300046507 | Bacteria | 4613 |
| 354 | Ga0495632_0288114 | 3300046519 | Bacteria | 730 |
| 355 | Ga0495648_0003458 | 3300046524 | Bacteria | 13894 |
| 356 | Ga0495645_0508859 | 3300046543 | Bacteria | 752 |
| 357 | Ga0495667_0668061 | 3300046559 | Bacteria | 645 |
| 358 | Ga0495611_0000135 | 3300046648 | Bacteria | 51495 |
| 359 | Ga0495625_0437049 | 3300046660 | Bacteria | 811 |
| 360 | Ga0495672_0085000 | 3300047320 | Bacteria | 1754 |
| 361 | Ga0495687_000039 | 3300047443 | Bacteria | 245077 |
| 362 | Ga0495686_0000046 | 3300047472 | Bacteria | 281963 |
| 363 | Ga0501296_024271 | 3300049519 | Bacteria | 790 |
| 364 | Ga0501299_036102 | 3300049522 | Bacteria | 974 |
| 365 | Ga0501300_015121 | 3300049523 | Bacteria | 1127 |
| 366 | Ga0501032_0004185 | 3300049569 | Bacteria | 10930 |
| 367 | Ga0501033_0602689 | 3300049570 | Unclassified | 753 |
| 368 | Ga0501034_0002222 | 3300049571 | Bacteria | 23945 |
| 369 | Ga0501034_0244708 | 3300049571 | Bacteria | 1739 |
| 370 | Ga0501034_0258868 | 3300049571 | Bacteria | 1683 |
| 371 | Ga0501034_0692804 | 3300049571 | Bacteria | 918 |
| 372 | Ga0501036_0132545 | 3300049572 | Bacteria | 2103 |
| 373 | Ga0501037_0003388 | 3300049573 | Bacteria | 11590 |
| 374 | Ga0501038_0017914 | 3300049574 | Bacteria | 6399 |
| 375 | Ga0501039_0054580 | 3300049575 | Bacteria | 3093 |
| 376 | Ga0501043_0011232 | 3300049579 | Bacteria | 7015 |
| 377 | Ga0501043_0111049 | 3300049579 | Bacteria | 2152 |
| 378 | Ga0501043_0469827 | 3300049579 | Bacteria | 943 |
| 379 | Ga0501046_0241186 | 3300049580 | Unclassified | 1333 |
| 380 | Ga0501047_0005548 | 3300049581 | Bacteria | 11874 |
| 381 | Ga0501047_0011539 | 3300049581 | Bacteria | 8364 |
| 382 | Ga0501047_0127838 | 3300049581 | Bacteria | 2421 |
| 383 | Ga0501048_0302343 | 3300049582 | Bacteria | 1138 |
| 384 | Ga0501070_0776838 | 3300049586 | Unclassified | 753 |
| 385 | Ga0501198_006405 | 3300049649 | Unclassified | 1676 |
| 386 | Ga0501202_000389 | 3300049652 | Bacteria | 6109 |
| 387 | Ga0501202_010986 | 3300049652 | Bacteria | 1689 |
| 388 | Ga0501202_036121 | 3300049652 | Bacteria | 1051 |
| 389 | Ga0501217_001947 | 3300049661 | Bacteria | 3968 |
| 390 | Ga0501217_061298 | 3300049661 | Unclassified | 1005 |
| 391 | Ga0501235_009031 | 3300049669 | Bacteria | 2176 |
| 392 | Ga0501242_021935 | 3300049674 | Bacteria | 827 |
| 393 | Ga0501247_006031 | 3300049677 | Unclassified | 1364 |
| 394 | Ga0501247_018730 | 3300049677 | Bacteria | 886 |
| 395 | Ga0501251_048391 | 3300049681 | Bacteria | 666 |
| 396 | Ga0501252_000918 | 3300049682 | Bacteria | 2545 |
| 397 | Ga0501257_004349 | 3300049686 | Bacteria | 3090 |
| 398 | Ga0501257_025953 | 3300049686 | Bacteria | 1396 |
| 399 | Ga0501257_079167 | 3300049686 | Bacteria | 846 |
| 400 | Ga0501259_015512 | 3300049688 | Bacteria | 1302 |
| 401 | Ga0501261_003707 | 3300049690 | Bacteria | 1876 |
| 402 | Ga0501219_001135 | 3300049703 | Bacteria | 2960 |
| 403 | Ga0501221_002983 | 3300049704 | Bacteria | 2789 |
| 404 | Ga0501221_038659 | 3300049704 | Unclassified | 1032 |
| 405 | Ga0501225_0010429 | 3300049705 | Bacteria | 2631 |
| 406 | Ga0501225_0023300 | 3300049705 | Bacteria | 1706 |
| 407 | Ga0501234_004557 | 3300049707 | Unclassified | 2181 |
| 408 | Ga0501245_002779 | 3300049708 | Bacteria | 2349 |
| 409 | Ga0501241_001440 | 3300049758 | Bacteria | 4848 |
| 410 | Ga0501241_002792 | 3300049758 | Bacteria | 3355 |
| 411 | Ga0501266_005724 | 3300049763 | Bacteria | 1543 |
| 412 | Ga0501035_0057807 | 3300049822 | Bacteria | 3458 |
| 413 | Ga0501035_0945308 | 3300049822 | Bacteria | 680 |
| 414 | Ga0501044_0007421 | 3300049823 | Bacteria | 12060 |
| 415 | Ga0501044_0019114 | 3300049823 | Bacteria | 7335 |
| 416 | Ga0501284_00048 | 3300050005 | Bacteria | 45450 |
| 417 | nmdc:mga05p37_10412_c1 | 3300050507 | Bacteria | 11036 |
| 418 | nmdc:mga05p37_226138_c1 | 3300050507 | Bacteria | 2256 |
| 419 | Ga0500578_0000462 | 3300053086 | Bacteria | 49481 |
| 420 | Ga0500578_0068941 | 3300053086 | Bacteria | 2254 |
| 421 | Ga0500644_0037686 | 3300053088 | Bacteria | 1582 |
| 422 | Ga0500644_0270397 | 3300053088 | Bacteria | 721 |
| 423 | Ga0500646_0001881 | 3300053090 | Bacteria | 5507 |
| 424 | Ga0500646_0012381 | 3300053090 | Bacteria | 2201 |
| 425 | Ga0500646_0014587 | 3300053090 | Bacteria | 2041 |
| 426 | Ga0500583_0000031 | 3300053092 | Bacteria | 104319 |
| 427 | Ga0500583_0000923 | 3300053092 | Bacteria | 8392 |
| 428 | Ga0500583_0053552 | 3300053092 | Bacteria | 1881 |
| 429 | Ga0500651_0144626 | 3300053093 | Bacteria | 1431 |
| 430 | Ga0500650_0030255 | 3300053098 | Bacteria | 2455 |
| 431 | Ga0500556_0050095 | 3300053104 | Bacteria | 1508 |
| 432 | Ga0500562_028456 | 3300053108 | Bacteria | 1469 |
| 433 | Ga0500642_0306581 | 3300053130 | Bacteria | 715 |
| 434 | Ga0500652_007986 | 3300053131 | Bacteria | 3502 |
| 435 | Ga0500652_091507 | 3300053131 | Bacteria | 1270 |
| 436 | Ga0500655_008622 | 3300053133 | Unclassified | 1836 |
| 437 | Ga0500568_0016814 | 3300053139 | Bacteria | 3241 |
| 438 | Ga0500577_0216083 | 3300053142 | Bacteria | 829 |
| 439 | Ga0500588_0033219 | 3300053146 | Bacteria | 1504 |
| 440 | Ga0500589_094264 | 3300053147 | Bacteria | 1312 |
| 441 | Ga0500590_215947 | 3300053148 | Unclassified | 796 |
| 442 | Ga0500603_166509 | 3300053150 | Unclassified | 689 |
| 443 | Ga0500622_0076226 | 3300053156 | Bacteria | 1686 |
| 444 | Ga0500622_0143855 | 3300053156 | Bacteria | 1134 |
| 445 | Ga0500639_040814 | 3300053163 | Bacteria | 2442 |
| 446 | Ga0500636_0034813 | 3300053177 | Bacteria | 2981 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035692 | Ga0373935_0583871 | Ga0373935_0583871_48_575 | 143 |
| 2 | 3300049570 | Ga0501033_0602689 | Ga0501033_0602689_12_512 | 143 |
| 3 | 3300046519 | Ga0495632_0288114 | Ga0495632_0288114_164_712 | 144 |
| 4 | 3300049661 | Ga0501217_061298 | Ga0501217_061298_423_965 | 145 |
| 5 | 3300006358 | Ga0068871_101231515 | Ga0068871_1012315151 | 154 |
| 6 | 3300006881 | Ga0068865_100595392 | Ga0068865_1005953922 | 154 |
| 7 | 3300025938 | Ga0207704_10971224 | Ga0207704_109712241 | 154 |
| 8 | 3300026088 | Ga0207641_10085072 | Ga0207641_100850722 | 154 |
| 9 | iso_pu_bacteria | 2884791551 | 2884791738 | 156 |
| 10 | 3300044683 | Ga0466965_0371490 | Ga0466965_0371490_213_776 | 157 |
| 11 | iso_pu_bacteria | 2738541278 | 2738730516 | 157 |
| 12 | 3300003323 | rootH1_10374198 | rootH1_103741982 | 158 |
| 13 | 3300005335 | Ga0070666_10074210 | Ga0070666_100742101 | 158 |
| 14 | 3300005338 | Ga0068868_101189979 | Ga0068868_1011899791 | 158 |
| 15 | 3300005539 | Ga0068853_100142650 | Ga0068853_1001426502 | 158 |
| 16 | 3300005616 | Ga0068852_100095007 | Ga0068852_1000950073 | 158 |
| 17 | 3300005616 | Ga0068852_100344656 | Ga0068852_1003446563 | 158 |
| 18 | 3300010375 | Ga0105239_10083774 | Ga0105239_100837743 | 158 |
| 19 | 3300013105 | Ga0157369_10192829 | Ga0157369_101928292 | 158 |
| 20 | 3300013296 | Ga0157374_10019513 | Ga0157374_100195135 | 158 |
| 21 | 3300013296 | Ga0157374_10023310 | Ga0157374_100233102 | 158 |
| 22 | 3300013306 | Ga0163162_11279332 | Ga0163162_112793321 | 158 |
| 23 | 3300025246 | Ga0209646_1002910 | Ga0209646_10029102 | 158 |
| 24 | 3300025911 | Ga0207654_10366178 | Ga0207654_103661782 | 158 |
| 25 | 3300025913 | Ga0207695_10169755 | Ga0207695_101697552 | 158 |
| 26 | 3300025921 | Ga0207652_10240660 | Ga0207652_102406602 | 158 |
| 27 | 3300026041 | Ga0207639_10004585 | Ga0207639_100045852 | 158 |
| 28 | 3300026142 | Ga0207698_10258136 | Ga0207698_102581362 | 158 |
| 29 | 3300026142 | Ga0207698_10262869 | Ga0207698_102628692 | 158 |
| 30 | 3300031730 | Ga0307516_10414771 | Ga0307516_104147713 | 158 |
| 31 | 3300039437 | Ga0436365_1876803 | Ga0436365_1876803_20840_21421 | 158 |
| 32 | 3300046660 | Ga0495625_0437049 | Ga0495625_0437049_129_722 | 158 |
| 33 | 3300049569 | Ga0501032_0004185 | Ga0501032_0004185_4592_5161 | 158 |
| 34 | 3300049571 | Ga0501034_0002222 | Ga0501034_0002222_4931_5500 | 158 |
| 35 | 3300049572 | Ga0501036_0132545 | Ga0501036_0132545_457_1026 | 158 |
| 36 | 3300049573 | Ga0501037_0003388 | Ga0501037_0003388_746_1315 | 158 |
| 37 | 3300049574 | Ga0501038_0017914 | Ga0501038_0017914_1005_1574 | 158 |
| 38 | 3300049575 | Ga0501039_0054580 | Ga0501039_0054580_1619_2188 | 158 |
| 39 | 3300049579 | Ga0501043_0011232 | Ga0501043_0011232_3962_4531 | 158 |
| 40 | 3300049581 | Ga0501047_0011539 | Ga0501047_0011539_3787_4356 | 158 |
| 41 | 3300049822 | Ga0501035_0057807 | Ga0501035_0057807_996_1565 | 158 |
| 42 | 3300049823 | Ga0501044_0007421 | Ga0501044_0007421_10174_10743 | 158 |
| 43 | 3300053090 | Ga0500646_0012381 | Ga0500646_0012381_832_1425 | 158 |
| 44 | 3300053092 | Ga0500583_0000923 | Ga0500583_0000923_3593_4186 | 158 |
| 45 | 3300053108 | Ga0500562_028456 | Ga0500562_028456_492_1079 | 158 |
| 46 | 3300053147 | Ga0500589_094264 | Ga0500589_094264_360_953 | 158 |
| 47 | 3300053156 | Ga0500622_0143855 | Ga0500622_0143855_148_741 | 158 |
| 48 | 3300003761 | Ga0055535_1005622 | Ga0055535_10056223 | 159 |
| 49 | 3300003762 | Ga0055542_1003917 | Ga0055542_10039172 | 159 |
| 50 | 3300003794 | Ga0055531_10005359 | Ga0055531_100053598 | 159 |
| 51 | 3300005290 | Ga0065712_10091398 | Ga0065712_100913982 | 159 |
| 52 | 3300005331 | Ga0070670_100086363 | Ga0070670_1000863632 | 159 |
| 53 | 3300005339 | Ga0070660_100257834 | Ga0070660_1002578342 | 159 |
| 54 | 3300005353 | Ga0070669_100583121 | Ga0070669_1005831212 | 159 |
| 55 | 3300005354 | Ga0070675_100014673 | Ga0070675_1000146736 | 159 |
| 56 | 3300005356 | Ga0070674_100196408 | Ga0070674_1001964082 | 159 |
| 57 | 3300005364 | Ga0070673_100475363 | Ga0070673_1004753632 | 159 |
| 58 | 3300005366 | Ga0070659_100000832 | Ga0070659_1000008325 | 159 |
| 59 | 3300005543 | Ga0070672_100101950 | Ga0070672_1001019502 | 159 |
| 60 | 3300005616 | Ga0068852_100005383 | Ga0068852_1000053836 | 159 |
| 61 | 3300005834 | Ga0068851_10214797 | Ga0068851_102147972 | 159 |
| 62 | 3300005840 | Ga0068870_10189405 | Ga0068870_101894052 | 159 |
| 63 | 3300013105 | Ga0157369_10081519 | Ga0157369_100815192 | 159 |
| 64 | 3300014326 | Ga0157380_10038914 | Ga0157380_100389143 | 159 |
| 65 | 3300025904 | Ga0207647_10000949 | Ga0207647_1000094910 | 159 |
| 66 | 3300025925 | Ga0207650_10089075 | Ga0207650_100890753 | 159 |
| 67 | 3300025926 | Ga0207659_10106278 | Ga0207659_101062782 | 159 |
| 68 | 3300025932 | Ga0207690_10011088 | Ga0207690_100110882 | 159 |
| 69 | 3300025940 | Ga0207691_10569472 | Ga0207691_105694722 | 159 |
| 70 | 3300025960 | Ga0207651_10689834 | Ga0207651_106898342 | 159 |
| 71 | 3300026142 | Ga0207698_10037457 | Ga0207698_100374574 | 159 |
| 72 | 3300046543 | Ga0495645_0508859 | Ga0495645_0508859_83_673 | 159 |
| 73 | 3300046559 | Ga0495667_0668061 | Ga0495667_0668061_13_603 | 159 |
| 74 | iso_pu_bacteria | 2896109856 | 2896109997 | 159 |
| 75 | 3300005458 | Ga0070681_10476266 | Ga0070681_104762662 | 160 |
| 76 | 3300005539 | Ga0068853_100161047 | Ga0068853_1001610472 | 160 |
| 77 | 3300005543 | Ga0070672_100209689 | Ga0070672_1002096892 | 160 |
| 78 | 3300005563 | Ga0068855_100256679 | Ga0068855_1002566792 | 160 |
| 79 | 3300005577 | Ga0068857_100125641 | Ga0068857_1001256412 | 160 |
| 80 | 3300005614 | Ga0068856_100173876 | Ga0068856_1001738763 | 160 |
| 81 | 3300005616 | Ga0068852_100096553 | Ga0068852_1000965532 | 160 |
| 82 | 3300005616 | Ga0068852_100263909 | Ga0068852_1002639092 | 160 |
| 83 | 3300005843 | Ga0068860_100045048 | Ga0068860_1000450482 | 160 |
| 84 | 3300009093 | Ga0105240_10000753 | Ga0105240_1000075315 | 160 |
| 85 | 3300009093 | Ga0105240_10059903 | Ga0105240_100599033 | 160 |
| 86 | 3300009093 | Ga0105240_10134524 | Ga0105240_101345243 | 160 |
| 87 | 3300009174 | Ga0105241_10004808 | Ga0105241_100048083 | 160 |
| 88 | 3300009174 | Ga0105241_10590747 | Ga0105241_105907472 | 160 |
| 89 | 3300009545 | Ga0105237_10019925 | Ga0105237_100199252 | 160 |
| 90 | 3300009551 | Ga0105238_10001640 | Ga0105238_1000164012 | 160 |
| 91 | 3300013100 | Ga0157373_10063980 | Ga0157373_100639802 | 160 |
| 92 | 3300013105 | Ga0157369_11387706 | Ga0157369_113877061 | 160 |
| 93 | 3300013307 | Ga0157372_10026285 | Ga0157372_100262852 | 160 |
| 94 | 3300013307 | Ga0157372_10812889 | Ga0157372_108128892 | 160 |
| 95 | 3300025321 | Ga0207656_10124563 | Ga0207656_101245632 | 160 |
| 96 | 3300025911 | Ga0207654_10011230 | Ga0207654_100112302 | 160 |
| 97 | 3300025911 | Ga0207654_10560261 | Ga0207654_105602611 | 160 |
| 98 | 3300025913 | Ga0207695_10000982 | Ga0207695_1000098226 | 160 |
| 99 | 3300025913 | Ga0207695_10067837 | Ga0207695_100678373 | 160 |
| 100 | 3300025914 | Ga0207671_10002130 | Ga0207671_1000213011 | 160 |
| 101 | 3300025920 | Ga0207649_10183785 | Ga0207649_101837851 | 160 |
| 102 | 3300025924 | Ga0207694_10048130 | Ga0207694_100481303 | 160 |
| 103 | 3300025940 | Ga0207691_10213706 | Ga0207691_102137062 | 160 |
| 104 | 3300025944 | Ga0207661_10751690 | Ga0207661_107516902 | 160 |
| 105 | 3300025945 | Ga0207679_10933464 | Ga0207679_109334642 | 160 |
| 106 | 3300025949 | Ga0207667_10247233 | Ga0207667_102472332 | 160 |
| 107 | 3300025960 | Ga0207651_10167628 | Ga0207651_101676282 | 160 |
| 108 | 3300026023 | Ga0207677_10248423 | Ga0207677_102484232 | 160 |
| 109 | 3300026041 | Ga0207639_10121869 | Ga0207639_101218692 | 160 |
| 110 | 3300026095 | Ga0207676_10257700 | Ga0207676_102577002 | 160 |
| 111 | 3300026116 | Ga0207674_10160306 | Ga0207674_101603062 | 160 |
| 112 | 3300026142 | Ga0207698_10064305 | Ga0207698_100643052 | 160 |
| 113 | 3300026142 | Ga0207698_10191776 | Ga0207698_101917762 | 160 |
| 114 | 3300027526 | Ga0209968_1031823 | Ga0209968_10318232 | 160 |
| 115 | 3300027543 | Ga0209999_1016392 | Ga0209999_10163922 | 160 |
| 116 | 3300028381 | Ga0268264_10204210 | Ga0268264_102042102 | 160 |
| 117 | 3300037471 | Ga0395905_1154029 | Ga0395905_1154029_40_615 | 160 |
| 118 | 3300042876 | Ga0451577_0066392 | Ga0451577_0066392_41_610 | 160 |
| 119 | 3300044658 | Ga0466972_0000422 | Ga0466972_0000422_13747_14307 | 160 |
| 120 | 3300044712 | Ga0453684_0235965 | Ga0453684_0235965_1209_1778 | 160 |
| 121 | 3300044735 | Ga0466968_0107144 | Ga0466968_0107144_666_1226 | 160 |
| 122 | 3300044765 | Ga0466970_0001701 | Ga0466970_0001701_5693_6253 | 160 |
| 123 | 3300049519 | Ga0501296_024271 | Ga0501296_024271_60_647 | 160 |
| 124 | 3300049523 | Ga0501300_015121 | Ga0501300_015121_292_909 | 160 |
| 125 | 3300049649 | Ga0501198_006405 | Ga0501198_006405_30_647 | 160 |
| 126 | 3300049652 | Ga0501202_000389 | Ga0501202_000389_2937_3554 | 160 |
| 127 | 3300049661 | Ga0501217_001947 | Ga0501217_001947_242_859 | 160 |
| 128 | 3300049669 | Ga0501235_009031 | Ga0501235_009031_437_1054 | 160 |
| 129 | 3300049682 | Ga0501252_000918 | Ga0501252_000918_1070_1687 | 160 |
| 130 | 3300049686 | Ga0501257_025953 | Ga0501257_025953_189_776 | 160 |
| 131 | 3300049688 | Ga0501259_015512 | Ga0501259_015512_366_953 | 160 |
| 132 | 3300049690 | Ga0501261_003707 | Ga0501261_003707_317_934 | 160 |
| 133 | 3300049704 | Ga0501221_002983 | Ga0501221_002983_686_1303 | 160 |
| 134 | 3300049705 | Ga0501225_0023300 | Ga0501225_0023300_926_1513 | 160 |
| 135 | 3300049707 | Ga0501234_004557 | Ga0501234_004557_1277_1864 | 160 |
| 136 | 3300049708 | Ga0501245_002779 | Ga0501245_002779_495_1082 | 160 |
| 137 | 3300003316 | rootH1_10060251 | rootH1_100602513 | 161 |
| 138 | 3300003316 | rootH1_10096109 | rootH1_100961091 | 161 |
| 139 | 3300003322 | rootL2_10044891 | rootL2_100448914 | 161 |
| 140 | 3300003323 | rootH1_10055347 | rootH1_100553475 | 161 |
| 141 | 3300005367 | Ga0070667_100078976 | Ga0070667_1000789762 | 161 |
| 142 | 3300005548 | Ga0070665_100000074 | Ga0070665_1000000748 | 161 |
| 143 | 3300005563 | Ga0068855_100146363 | Ga0068855_1001463632 | 161 |
| 144 | 3300005577 | Ga0068857_100151253 | Ga0068857_1001512531 | 161 |
| 145 | 3300005614 | Ga0068856_100139226 | Ga0068856_1001392262 | 161 |
| 146 | 3300005843 | Ga0068860_100009185 | Ga0068860_1000091859 | 161 |
| 147 | 3300006195 | Ga0075366_10397399 | Ga0075366_103973991 | 161 |
| 148 | 3300006237 | Ga0097621_100536989 | Ga0097621_1005369892 | 161 |
| 149 | 3300009147 | Ga0114129_10014867 | Ga0114129_1001486710 | 161 |
| 150 | 3300009174 | Ga0105241_10066594 | Ga0105241_100665943 | 161 |
| 151 | 3300009545 | Ga0105237_10000137 | Ga0105237_1000013744 | 161 |
| 152 | 3300009545 | Ga0105237_10000365 | Ga0105237_1000036543 | 161 |
| 153 | 3300009545 | Ga0105237_10057490 | Ga0105237_100574902 | 161 |
| 154 | 3300009551 | Ga0105238_10079019 | Ga0105238_100790192 | 161 |
| 155 | 3300010375 | Ga0105239_10013585 | Ga0105239_100135856 | 161 |
| 156 | 3300013297 | Ga0157378_10451300 | Ga0157378_104513002 | 161 |
| 157 | 3300013307 | Ga0157372_10206258 | Ga0157372_102062582 | 161 |
| 158 | 3300020070 | Ga0206356_11653086 | Ga0206356_116530861 | 161 |
| 159 | 3300025913 | Ga0207695_10215884 | Ga0207695_102158842 | 161 |
| 160 | 3300025914 | Ga0207671_10000424 | Ga0207671_1000042444 | 161 |
| 161 | 3300025914 | Ga0207671_10002759 | Ga0207671_100027599 | 161 |
| 162 | 3300025914 | Ga0207671_10114567 | Ga0207671_101145672 | 161 |
| 163 | 3300025924 | Ga0207694_10800206 | Ga0207694_108002062 | 161 |
| 164 | 3300025949 | Ga0207667_10004578 | Ga0207667_1000457810 | 161 |
| 165 | 3300025986 | Ga0207658_10059734 | Ga0207658_100597342 | 161 |
| 166 | 3300026023 | Ga0207677_10037523 | Ga0207677_100375233 | 161 |
| 167 | 3300026041 | Ga0207639_11075582 | Ga0207639_110755821 | 161 |
| 168 | 3300026067 | Ga0207678_10847527 | Ga0207678_108475271 | 161 |
| 169 | 3300026116 | Ga0207674_10073413 | Ga0207674_100734133 | 161 |
| 170 | 3300028379 | Ga0268266_10000010 | Ga0268266_10000010631 | 161 |
| 171 | 3300028381 | Ga0268264_10001431 | Ga0268264_1000143114 | 161 |
| 172 | 3300033180 | Ga0307510_10000869 | Ga0307510_1000086924 | 161 |
| 173 | 3300035695 | Ga0373927_0110428 | Ga0373927_0110428_641_1237 | 161 |
| 174 | 3300037471 | Ga0395905_0004912 | Ga0395905_0004912_11215_11784 | 161 |
| 175 | 3300041404 | Ga0439436_0053945 | Ga0439436_0053945_12_581 | 161 |
| 176 | 3300041406 | Ga0439439_0015814 | Ga0439439_0015814_1171_1740 | 161 |
| 177 | 3300041406 | Ga0439439_0065488 | Ga0439439_0065488_230_802 | 161 |
| 178 | 3300041498 | Ga0451841_1322386 | Ga0451841_1322386_909_1508 | 161 |
| 179 | 3300041999 | Ga0439433_0052526 | Ga0439433_0052526_314_883 | 161 |
| 180 | 3300042007 | Ga0439449_0011275 | Ga0439449_0011275_742_1314 | 161 |
| 181 | 3300042007 | Ga0439449_0028173 | Ga0439449_0028173_1236_1805 | 161 |
| 182 | 3300044658 | Ga0466972_0000348 | Ga0466972_0000348_24651_25217 | 161 |
| 183 | 3300044658 | Ga0466972_0015986 | Ga0466972_0015986_2452_3021 | 161 |
| 184 | 3300044693 | Ga0466961_0246328 | Ga0466961_0246328_219_785 | 161 |
| 185 | 3300044735 | Ga0466968_0087801 | Ga0466968_0087801_561_1136 | 161 |
| 186 | 3300044842 | Ga0466957_0000134 | Ga0466957_0000134_9275_9841 | 161 |
| 187 | 3300044842 | Ga0466957_0008275 | Ga0466957_0008275_1934_2503 | 161 |
| 188 | 3300045049 | Ga0466959_0033328 | Ga0466959_0033328_1288_1863 | 161 |
| 189 | 3300045976 | Ga0466967_1278548 | Ga0466967_1278548_104_673 | 161 |
| 190 | 3300046460 | Ga0495638_0173026 | Ga0495638_0173026_65_670 | 161 |
| 191 | 3300046507 | Ga0495606_0022321 | Ga0495606_0022321_1939_2538 | 161 |
| 192 | 3300046648 | Ga0495611_0000135 | Ga0495611_0000135_14470_15075 | 161 |
| 193 | 3300047443 | Ga0495687_000039 | Ga0495687_000039_206529_207110 | 161 |
| 194 | 3300047472 | Ga0495686_0000046 | Ga0495686_0000046_114470_115060 | 161 |
| 195 | 3300049571 | Ga0501034_0244708 | Ga0501034_0244708_51_617 | 161 |
| 196 | 3300049571 | Ga0501034_0258868 | Ga0501034_0258868_847_1419 | 161 |
| 197 | 3300049579 | Ga0501043_0111049 | Ga0501043_0111049_435_1007 | 161 |
| 198 | 3300049579 | Ga0501043_0469827 | Ga0501043_0469827_185_751 | 161 |
| 199 | 3300049580 | Ga0501046_0241186 | Ga0501046_0241186_464_1036 | 161 |
| 200 | 3300049581 | Ga0501047_0005548 | Ga0501047_0005548_9006_9572 | 161 |
| 201 | 3300049581 | Ga0501047_0127838 | Ga0501047_0127838_968_1534 | 161 |
| 202 | 3300049582 | Ga0501048_0302343 | Ga0501048_0302343_72_638 | 161 |
| 203 | 3300049758 | Ga0501241_001440 | Ga0501241_001440_23_598 | 161 |
| 204 | 3300049822 | Ga0501035_0945308 | Ga0501035_0945308_42_608 | 161 |
| 205 | 3300049823 | Ga0501044_0019114 | Ga0501044_0019114_1215_1781 | 161 |
| 206 | 3300050507 | nmdc:mga05p37_10412_c1 | nmdc:mga05p37_10412_c1_1364_1948 | 161 |
| 207 | 3300053086 | Ga0500578_0000462 | Ga0500578_0000462_34390_34971 | 161 |
| 208 | 3300053086 | Ga0500578_0068941 | Ga0500578_0068941_597_1184 | 161 |
| 209 | 3300053088 | Ga0500644_0037686 | Ga0500644_0037686_436_1020 | 161 |
| 210 | 3300053090 | Ga0500646_0014587 | Ga0500646_0014587_351_935 | 161 |
| 211 | 3300053093 | Ga0500651_0144626 | Ga0500651_0144626_407_991 | 161 |
| 212 | 3300053098 | Ga0500650_0030255 | Ga0500650_0030255_990_1574 | 161 |
| 213 | 3300053104 | Ga0500556_0050095 | Ga0500556_0050095_632_1216 | 161 |
| 214 | 3300053130 | Ga0500642_0306581 | Ga0500642_0306581_77_664 | 161 |
| 215 | 3300053142 | Ga0500577_0216083 | Ga0500577_0216083_149_733 | 161 |
| 216 | 3300053146 | Ga0500588_0033219 | Ga0500588_0033219_33_632 | 161 |
| 217 | 3300053150 | Ga0500603_166509 | Ga0500603_166509_57_659 | 161 |
| 218 | 3300053163 | Ga0500639_040814 | Ga0500639_040814_1263_1865 | 161 |
| 219 | 3300001979 | JGI24740J21852_10021865 | JGI24740J21852_100218653 | 162 |
| 220 | 3300001990 | JGI24737J22298_10127208 | JGI24737J22298_101272081 | 162 |
| 221 | 3300003323 | rootH1_10265137 | rootH1_102651374 | 162 |
| 222 | 3300005289 | Ga0065704_10001498 | Ga0065704_100014983 | 162 |
| 223 | 3300005327 | Ga0070658_10091083 | Ga0070658_100910832 | 162 |
| 224 | 3300005328 | Ga0070676_10396415 | Ga0070676_103964152 | 162 |
| 225 | 3300005329 | Ga0070683_100046014 | Ga0070683_1000460143 | 162 |
| 226 | 3300005331 | Ga0070670_100234877 | Ga0070670_1002348773 | 162 |
| 227 | 3300005334 | Ga0068869_100396369 | Ga0068869_1003963692 | 162 |
| 228 | 3300005336 | Ga0070680_100166424 | Ga0070680_1001664242 | 162 |
| 229 | 3300005336 | Ga0070680_101190987 | Ga0070680_1011909871 | 162 |
| 230 | 3300005337 | Ga0070682_100025077 | Ga0070682_1000250773 | 162 |
| 231 | 3300005339 | Ga0070660_100023293 | Ga0070660_1000232934 | 162 |
| 232 | 3300005343 | Ga0070687_100167658 | Ga0070687_1001676581 | 162 |
| 233 | 3300005344 | Ga0070661_100052441 | Ga0070661_1000524413 | 162 |
| 234 | 3300005345 | Ga0070692_10554349 | Ga0070692_105543491 | 162 |
| 235 | 3300005354 | Ga0070675_100820413 | Ga0070675_1008204131 | 162 |
| 236 | 3300005355 | Ga0070671_100101961 | Ga0070671_1001019612 | 162 |
| 237 | 3300005364 | Ga0070673_100092153 | Ga0070673_1000921533 | 162 |
| 238 | 3300005364 | Ga0070673_100467087 | Ga0070673_1004670872 | 162 |
| 239 | 3300005366 | Ga0070659_100003144 | Ga0070659_1000031449 | 162 |
| 240 | 3300005455 | Ga0070663_100141848 | Ga0070663_1001418482 | 162 |
| 241 | 3300005456 | Ga0070678_100203881 | Ga0070678_1002038812 | 162 |
| 242 | 3300005457 | Ga0070662_100011837 | Ga0070662_1000118374 | 162 |
| 243 | 3300005458 | Ga0070681_10288233 | Ga0070681_102882331 | 162 |
| 244 | 3300005459 | Ga0068867_100225040 | Ga0068867_1002250401 | 162 |
| 245 | 3300005468 | Ga0070707_100710515 | Ga0070707_1007105152 | 162 |
| 246 | 3300005530 | Ga0070679_100028368 | Ga0070679_1000283685 | 162 |
| 247 | 3300005535 | Ga0070684_100059136 | Ga0070684_1000591363 | 162 |
| 248 | 3300005539 | Ga0068853_100025196 | Ga0068853_1000251964 | 162 |
| 249 | 3300005539 | Ga0068853_100527288 | Ga0068853_1005272881 | 162 |
| 250 | 3300005563 | Ga0068855_100036619 | Ga0068855_1000366195 | 162 |
| 251 | 3300005564 | Ga0070664_100000950 | Ga0070664_1000009506 | 162 |
| 252 | 3300005577 | Ga0068857_100003072 | Ga0068857_1000030729 | 162 |
| 253 | 3300005577 | Ga0068857_100018903 | Ga0068857_1000189033 | 162 |
| 254 | 3300005577 | Ga0068857_100165413 | Ga0068857_1001654132 | 162 |
| 255 | 3300005578 | Ga0068854_100025843 | Ga0068854_1000258432 | 162 |
| 256 | 3300005614 | Ga0068856_100034120 | Ga0068856_1000341203 | 162 |
| 257 | 3300005614 | Ga0068856_100079438 | Ga0068856_1000794382 | 162 |
| 258 | 3300005616 | Ga0068852_100001764 | Ga0068852_1000017643 | 162 |
| 259 | 3300005616 | Ga0068852_100002876 | Ga0068852_1000028766 | 162 |
| 260 | 3300005616 | Ga0068852_100907405 | Ga0068852_1009074052 | 162 |
| 261 | 3300005618 | Ga0068864_100199168 | Ga0068864_1001991682 | 162 |
| 262 | 3300005843 | Ga0068860_100000034 | Ga0068860_100000034147 | 162 |
| 263 | 3300006237 | Ga0097621_100027306 | Ga0097621_1000273064 | 162 |
| 264 | 3300006237 | Ga0097621_100085669 | Ga0097621_1000856692 | 162 |
| 265 | 3300006358 | Ga0068871_100001620 | Ga0068871_10000162013 | 162 |
| 266 | 3300009093 | Ga0105240_10000008 | Ga0105240_10000008370 | 162 |
| 267 | 3300009093 | Ga0105240_10000059 | Ga0105240_10000059178 | 162 |
| 268 | 3300009093 | Ga0105240_10016430 | Ga0105240_100164304 | 162 |
| 269 | 3300009174 | Ga0105241_10075190 | Ga0105241_100751903 | 162 |
| 270 | 3300009174 | Ga0105241_10372371 | Ga0105241_103723712 | 162 |
| 271 | 3300009545 | Ga0105237_10278614 | Ga0105237_102786142 | 162 |
| 272 | 3300009545 | Ga0105237_10352893 | Ga0105237_103528932 | 162 |
| 273 | 3300009551 | Ga0105238_10499119 | Ga0105238_104991192 | 162 |
| 274 | 3300010375 | Ga0105239_10017342 | Ga0105239_100173427 | 162 |
| 275 | 3300013100 | Ga0157373_10010080 | Ga0157373_100100806 | 162 |
| 276 | 3300013102 | Ga0157371_10040631 | Ga0157371_100406313 | 162 |
| 277 | 3300013102 | Ga0157371_10187722 | Ga0157371_101877222 | 162 |
| 278 | 3300013104 | Ga0157370_10010368 | Ga0157370_100103684 | 162 |
| 279 | 3300013104 | Ga0157370_10460370 | Ga0157370_104603701 | 162 |
| 280 | 3300013105 | Ga0157369_10006593 | Ga0157369_100065937 | 162 |
| 281 | 3300013105 | Ga0157369_10243594 | Ga0157369_102435942 | 162 |
| 282 | 3300013105 | Ga0157369_10703765 | Ga0157369_107037652 | 162 |
| 283 | 3300013105 | Ga0157369_10752459 | Ga0157369_107524591 | 162 |
| 284 | 3300013296 | Ga0157374_10001675 | Ga0157374_1000167512 | 162 |
| 285 | 3300013296 | Ga0157374_10078178 | Ga0157374_100781782 | 162 |
| 286 | 3300013296 | Ga0157374_10446192 | Ga0157374_104461922 | 162 |
| 287 | 3300013297 | Ga0157378_10020257 | Ga0157378_100202573 | 162 |
| 288 | 3300013306 | Ga0163162_10016723 | Ga0163162_100167235 | 162 |
| 289 | 3300013306 | Ga0163162_10151141 | Ga0163162_101511413 | 162 |
| 290 | 3300013307 | Ga0157372_10005542 | Ga0157372_100055429 | 162 |
| 291 | 3300013307 | Ga0157372_10154477 | Ga0157372_101544774 | 162 |
| 292 | 3300013307 | Ga0157372_10999009 | Ga0157372_109990092 | 162 |
| 293 | 3300013307 | Ga0157372_11350344 | Ga0157372_113503442 | 162 |
| 294 | 3300013308 | Ga0157375_10386631 | Ga0157375_103866313 | 162 |
| 295 | 3300013308 | Ga0157375_10563550 | Ga0157375_105635502 | 162 |
| 296 | 3300014745 | Ga0157377_10021622 | Ga0157377_100216223 | 162 |
| 297 | 3300014969 | Ga0157376_10900266 | Ga0157376_109002662 | 162 |
| 298 | 3300025903 | Ga0207680_10035952 | Ga0207680_100359523 | 162 |
| 299 | 3300025904 | Ga0207647_10019524 | Ga0207647_100195242 | 162 |
| 300 | 3300025909 | Ga0207705_10550841 | Ga0207705_105508411 | 162 |
| 301 | 3300025911 | Ga0207654_10032051 | Ga0207654_100320513 | 162 |
| 302 | 3300025912 | Ga0207707_10436752 | Ga0207707_104367522 | 162 |
| 303 | 3300025913 | Ga0207695_10000021 | Ga0207695_1000002131 | 162 |
| 304 | 3300025913 | Ga0207695_10000039 | Ga0207695_10000039239 | 162 |
| 305 | 3300025913 | Ga0207695_10066857 | Ga0207695_100668572 | 162 |
| 306 | 3300025914 | Ga0207671_10023057 | Ga0207671_100230572 | 162 |
| 307 | 3300025914 | Ga0207671_10077374 | Ga0207671_100773742 | 162 |
| 308 | 3300025918 | Ga0207662_10567962 | Ga0207662_105679621 | 162 |
| 309 | 3300025919 | Ga0207657_10004992 | Ga0207657_1000499211 | 162 |
| 310 | 3300025920 | Ga0207649_10191877 | Ga0207649_101918771 | 162 |
| 311 | 3300025921 | Ga0207652_10031118 | Ga0207652_100311184 | 162 |
| 312 | 3300025926 | Ga0207659_10392493 | Ga0207659_103924931 | 162 |
| 313 | 3300025931 | Ga0207644_10544516 | Ga0207644_105445161 | 162 |
| 314 | 3300025932 | Ga0207690_10924208 | Ga0207690_109242081 | 162 |
| 315 | 3300025933 | Ga0207706_10007504 | Ga0207706_100075044 | 162 |
| 316 | 3300025942 | Ga0207689_10474581 | Ga0207689_104745811 | 162 |
| 317 | 3300025944 | Ga0207661_10083922 | Ga0207661_100839222 | 162 |
| 318 | 3300025945 | Ga0207679_10033771 | Ga0207679_100337713 | 162 |
| 319 | 3300025949 | Ga0207667_10009515 | Ga0207667_100095159 | 162 |
| 320 | 3300025949 | Ga0207667_11116782 | Ga0207667_111167821 | 162 |
| 321 | 3300025960 | Ga0207651_10069166 | Ga0207651_100691662 | 162 |
| 322 | 3300025981 | Ga0207640_10128591 | Ga0207640_101285912 | 162 |
| 323 | 3300025986 | Ga0207658_10854346 | Ga0207658_108543461 | 162 |
| 324 | 3300026041 | Ga0207639_10032669 | Ga0207639_100326694 | 162 |
| 325 | 3300026041 | Ga0207639_10278340 | Ga0207639_102783401 | 162 |
| 326 | 3300026078 | Ga0207702_10099342 | Ga0207702_100993422 | 162 |
| 327 | 3300026078 | Ga0207702_10156386 | Ga0207702_101563862 | 162 |
| 328 | 3300026089 | Ga0207648_10021754 | Ga0207648_100217542 | 162 |
| 329 | 3300026089 | Ga0207648_10861740 | Ga0207648_108617401 | 162 |
| 330 | 3300026095 | Ga0207676_10717891 | Ga0207676_107178911 | 162 |
| 331 | 3300026095 | Ga0207676_11095542 | Ga0207676_110955421 | 162 |
| 332 | 3300026116 | Ga0207674_10004689 | Ga0207674_100046893 | 162 |
| 333 | 3300026116 | Ga0207674_10029388 | Ga0207674_100293883 | 162 |
| 334 | 3300026118 | Ga0207675_100759727 | Ga0207675_1007597271 | 162 |
| 335 | 3300026121 | Ga0207683_10291555 | Ga0207683_102915552 | 162 |
| 336 | 3300026142 | Ga0207698_10001608 | Ga0207698_100016084 | 162 |
| 337 | 3300026142 | Ga0207698_10063846 | Ga0207698_100638463 | 162 |
| 338 | 3300026142 | Ga0207698_10064831 | Ga0207698_100648313 | 162 |
| 339 | 3300028381 | Ga0268264_10000052 | Ga0268264_10000052161 | 162 |
| 340 | 3300028786 | Ga0307517_10133681 | Ga0307517_101336812 | 162 |
| 341 | 3300030521 | Ga0307511_10001606 | Ga0307511_100016062 | 162 |
| 342 | 3300031456 | Ga0307513_10028247 | Ga0307513_100282476 | 162 |
| 343 | 3300031730 | Ga0307516_10001143 | Ga0307516_100011438 | 162 |
| 344 | 3300031901 | Ga0307406_10068183 | Ga0307406_100681832 | 162 |
| 345 | 3300031903 | Ga0307407_10261945 | Ga0307407_102619452 | 162 |
| 346 | 3300032002 | Ga0307416_100022237 | Ga0307416_1000222374 | 162 |
| 347 | 3300032002 | Ga0307416_101898748 | Ga0307416_1018987481 | 162 |
| 348 | 3300032126 | Ga0307415_100059941 | Ga0307415_1000599413 | 162 |
| 349 | 3300037418 | Ga0395900_0473941 | Ga0395900_0473941_404_937 | 162 |
| 350 | 3300041997 | Ga0439431_0002975 | Ga0439431_0002975_2388_2963 | 162 |
| 351 | 3300042004 | Ga0439445_0002757 | Ga0439445_0002757_1057_1632 | 162 |
| 352 | 3300044712 | Ga0453684_0030904 | Ga0453684_0030904_5404_5973 | 162 |
| 353 | 3300044842 | Ga0466957_0225471 | Ga0466957_0225471_495_1070 | 162 |
| 354 | 3300044842 | Ga0466957_0649260 | Ga0466957_0649260_187_717 | 162 |
| 355 | 3300045049 | Ga0466959_0123511 | Ga0466959_0123511_947_1516 | 162 |
| 356 | 3300045051 | Ga0451576_0857981 | Ga0451576_0857981_11_580 | 162 |
| 357 | 3300045976 | Ga0466967_0112998 | Ga0466967_0112998_1748_2314 | 162 |
| 358 | 3300045976 | Ga0466967_0694321 | Ga0466967_0694321_197_778 | 162 |
| 359 | 3300046460 | Ga0495638_0049942 | Ga0495638_0049942_706_1296 | 162 |
| 360 | 3300046524 | Ga0495648_0003458 | Ga0495648_0003458_9090_9680 | 162 |
| 361 | 3300049522 | Ga0501299_036102 | Ga0501299_036102_171_758 | 162 |
| 362 | 3300049571 | Ga0501034_0692804 | Ga0501034_0692804_163_732 | 162 |
| 363 | 3300049586 | Ga0501070_0776838 | Ga0501070_0776838_167_724 | 162 |
| 364 | 3300049652 | Ga0501202_010986 | Ga0501202_010986_486_1061 | 162 |
| 365 | 3300049652 | Ga0501202_036121 | Ga0501202_036121_276_845 | 162 |
| 366 | 3300049674 | Ga0501242_021935 | Ga0501242_021935_66_635 | 162 |
| 367 | 3300049677 | Ga0501247_006031 | Ga0501247_006031_560_1129 | 162 |
| 368 | 3300049677 | Ga0501247_018730 | Ga0501247_018730_267_842 | 162 |
| 369 | 3300049681 | Ga0501251_048391 | Ga0501251_048391_50_619 | 162 |
| 370 | 3300049686 | Ga0501257_004349 | Ga0501257_004349_2077_2646 | 162 |
| 371 | 3300049686 | Ga0501257_079167 | Ga0501257_079167_165_752 | 162 |
| 372 | 3300049704 | Ga0501221_038659 | Ga0501221_038659_416_985 | 162 |
| 373 | 3300049705 | Ga0501225_0010429 | Ga0501225_0010429_812_1387 | 162 |
| 374 | 3300049763 | Ga0501266_005724 | Ga0501266_005724_141_710 | 162 |
| 375 | 3300053088 | Ga0500644_0270397 | Ga0500644_0270397_76_666 | 162 |
| 376 | 3300053090 | Ga0500646_0001881 | Ga0500646_0001881_2246_2830 | 162 |
| 377 | 3300053092 | Ga0500583_0000031 | Ga0500583_0000031_12984_13586 | 162 |
| 378 | 3300053092 | Ga0500583_0053552 | Ga0500583_0053552_500_1090 | 162 |
| 379 | 3300053133 | Ga0500655_008622 | Ga0500655_008622_828_1415 | 162 |
| 380 | 3300053148 | Ga0500590_215947 | Ga0500590_215947_195_782 | 162 |
| 381 | 3300053156 | Ga0500622_0076226 | Ga0500622_0076226_653_1243 | 162 |
| 382 | 3300001979 | JGI24740J21852_10004081 | JGI24740J21852_100040812 | 163 |
| 383 | 3300002738 | JGI25154J39366_1000008 | JGI25154J39366_1000008224 | 163 |
| 384 | 3300002739 | JGI25158J39367_1011892 | JGI25158J39367_10118922 | 163 |
| 385 | 3300003215 | JGI25153J46596_10001413 | JGI25153J46596_100014134 | 163 |
| 386 | 3300003320 | rootH2_10030144 | rootH2_100301445 | 163 |
| 387 | 3300003323 | rootH1_10038549 | rootH1_100385492 | 163 |
| 388 | 3300003323 | rootH1_10111962 | rootH1_101119622 | 163 |
| 389 | 3300003323 | rootH1_10116642 | rootH1_101166422 | 163 |
| 390 | 3300003354 | JGI25160J50197_1002257 | JGI25160J50197_10022575 | 163 |
| 391 | 3300005262 | Ga0065165_1014717 | Ga0065165_10147172 | 163 |
| 392 | 3300005329 | Ga0070683_100282182 | Ga0070683_1002821822 | 163 |
| 393 | 3300005331 | Ga0070670_100073261 | Ga0070670_1000732612 | 163 |
| 394 | 3300005334 | Ga0068869_100119957 | Ga0068869_1001199573 | 163 |
| 395 | 3300005354 | Ga0070675_100286548 | Ga0070675_1002865482 | 163 |
| 396 | 3300005355 | Ga0070671_100021409 | Ga0070671_1000214095 | 163 |
| 397 | 3300005364 | Ga0070673_100451779 | Ga0070673_1004517792 | 163 |
| 398 | 3300005458 | Ga0070681_10513000 | Ga0070681_105130002 | 163 |
| 399 | 3300005535 | Ga0070684_100108792 | Ga0070684_1001087924 | 163 |
| 400 | 3300005564 | Ga0070664_100465328 | Ga0070664_1004653282 | 163 |
| 401 | 3300005615 | Ga0070702_100459596 | Ga0070702_1004595962 | 163 |
| 402 | 3300005618 | Ga0068864_100630090 | Ga0068864_1006300901 | 163 |
| 403 | 3300006844 | Ga0075428_100386762 | Ga0075428_1003867622 | 163 |
| 404 | 3300006847 | Ga0075431_100044659 | Ga0075431_1000446593 | 163 |
| 405 | 3300006880 | Ga0075429_100058362 | Ga0075429_1000583622 | 163 |
| 406 | 3300009147 | Ga0114129_10068767 | Ga0114129_100687673 | 163 |
| 407 | 3300009545 | Ga0105237_10272495 | Ga0105237_102724952 | 163 |
| 408 | 3300010375 | Ga0105239_10519656 | Ga0105239_105196562 | 163 |
| 409 | 3300013100 | Ga0157373_10185581 | Ga0157373_101855812 | 163 |
| 410 | 3300013102 | Ga0157371_10014609 | Ga0157371_100146091 | 163 |
| 411 | 3300013102 | Ga0157371_10061853 | Ga0157371_100618532 | 163 |
| 412 | 3300013104 | Ga0157370_10287782 | Ga0157370_102877822 | 163 |
| 413 | 3300013296 | Ga0157374_10027788 | Ga0157374_100277886 | 163 |
| 414 | 3300013307 | Ga0157372_10067003 | Ga0157372_100670033 | 163 |
| 415 | 3300013307 | Ga0157372_10081466 | Ga0157372_100814662 | 163 |
| 416 | 3300013307 | Ga0157372_10144970 | Ga0157372_101449704 | 163 |
| 417 | 3300013307 | Ga0157372_10702449 | Ga0157372_107024492 | 163 |
| 418 | 3300013307 | Ga0157372_11334515 | Ga0157372_113345151 | 163 |
| 419 | 3300014325 | Ga0163163_10013034 | Ga0163163_100130346 | 163 |
| 420 | 3300025208 | Ga0209436_104011 | Ga0209436_1040112 | 163 |
| 421 | 3300025246 | Ga0209646_1000045 | Ga0209646_1000045224 | 163 |
| 422 | 3300025250 | Ga0209026_1000075 | Ga0209026_10000759 | 163 |
| 423 | 3300025284 | Ga0209130_1000915 | Ga0209130_100091515 | 163 |
| 424 | 3300025297 | Ga0209758_1005408 | Ga0209758_10054086 | 163 |
| 425 | 3300025302 | Ga0207426_1000073 | Ga0207426_1000073273 | 163 |
| 426 | 3300025302 | Ga0207426_1000236 | Ga0207426_100023625 | 163 |
| 427 | 3300025920 | Ga0207649_10207145 | Ga0207649_102071452 | 163 |
| 428 | 3300025925 | Ga0207650_10001164 | Ga0207650_100011647 | 163 |
| 429 | 3300025925 | Ga0207650_10109201 | Ga0207650_101092013 | 163 |
| 430 | 3300025925 | Ga0207650_10363660 | Ga0207650_103636602 | 163 |
| 431 | 3300025940 | Ga0207691_10342950 | Ga0207691_103429502 | 163 |
| 432 | 3300025942 | Ga0207689_10203970 | Ga0207689_102039701 | 163 |
| 433 | 3300026116 | Ga0207674_10415741 | Ga0207674_104157412 | 163 |
| 434 | 3300026116 | Ga0207674_10717172 | Ga0207674_107171722 | 163 |
| 435 | 3300026118 | Ga0207675_100194783 | Ga0207675_1001947832 | 163 |
| 436 | 3300031251 | Ga0265327_10000054 | Ga0265327_10000054174 | 163 |
| 437 | 3300031251 | Ga0265327_10063702 | Ga0265327_100637021 | 163 |
| 438 | 3300031507 | Ga0307509_10390766 | Ga0307509_103907662 | 163 |
| 439 | 3300032004 | Ga0307414_10562331 | Ga0307414_105623312 | 163 |
| 440 | 3300038443 | Ga0395901_1318307 | Ga0395901_1318307_100_666 | 163 |
| 441 | 3300047320 | Ga0495672_0085000 | Ga0495672_0085000_1146_1724 | 163 |
| 442 | 3300049703 | Ga0501219_001135 | Ga0501219_001135_2267_2830 | 163 |
| 443 | 3300049758 | Ga0501241_002792 | Ga0501241_002792_1526_2089 | 163 |
| 444 | 3300050005 | Ga0501284_00048 | Ga0501284_00048_18613_19176 | 163 |
| 445 | 3300050507 | nmdc:mga05p37_226138_c1 | nmdc:mga05p37_226138_c1_1317_1886 | 163 |
| 446 | 3300053131 | Ga0500652_007986 | Ga0500652_007986_2648_3262 | 163 |
| 447 | 3300053131 | Ga0500652_091507 | Ga0500652_091507_168_743 | 163 |
| 448 | 3300053139 | Ga0500568_0016814 | Ga0500568_0016814_934_1509 | 163 |
| 449 | 3300053177 | Ga0500636_0034813 | Ga0500636_0034813_36_629 | 163 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2i1s-assembly2.cif.gz_B | crystal structure of protein of unknown function mm3350 from methanosarcina mazei go1 | 0.8618 | 2 | 129 |
| 2i1s-assembly1.cif.gz_A | crystal structure of protein of unknown function mm3350 from methanosarcina mazei go1 | 0.856 | 2 | 134 |
| 6fno-assembly2.cif.gz_D | caldiarchaeum subterraneum ubiquitin:rpn11-homolog complex, zinc soak | 0.7506 | 19 | 98 |
| 6hyl-assembly2.cif.gz_B | structure of pcm1 lir motif bound to gabarap | 0.734 | 19 | 84 |
| 3pv1-assembly1.cif.gz_B | crystal structure of the usp15 dusp-ubl domains | 0.7203 | 17 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2i1sA00 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;MM3350-like | 0.856 | 2 | 134 | 3.10.290.30 |
| af_A0A1D6P3J9_634_711_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.7816 | 17 | 92 | 3.10.20.90 |
| af_Q7ZVI8_1_79_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.7468 | 17 | 55 | 3.10.20.90 |
| af_A0A0A1EI90_1200_1299_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.742 | 17 | 59 | 3.10.20.90 |
| af_Q4D4W4_8_98_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.719 | 3 | 47 | 3.10.20.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519UBL2-F1-model_v4 | Plasmid pRiA4b Orf3-like domain-containing protein | 0.9833 | 1 | 105 |
|
| AF-A0A257L6N2-F1-model_v4 | Plasmid pRiA4b Orf3-like domain-containing protein | 0.9682 | 2 | 137 |
|
| AF-A0A4Q3WA00-F1-model_v4 | Plasmid pRiA4b Orf3-like domain-containing protein | 0.9654 | 1 | 119 |
|
| AF-A0A519UBL2-F1-model_v4 | Plasmid pRiA4b Orf3-like domain-containing protein | 0.9651 | 1 | 105 |
|
| AF-A0A4Q5QV42-F1-model_v4 | Plasmid pRiA4b Orf3-like domain-containing protein | 0.9627 | 1 | 147 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar