F446337

General Info

Members Datasets Scaffolds Average Seq Length
449 240 446 174

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100907405|Ga0068852_1009074052
Length 198
Sequence MAILKFRIYFEEDDSVYRDVVIRHKQSFFDLHEAILKSFEFDNKHAATFYRSNDNWQRGREISLEVYEKKYKAAPLLMKETTIGSEIQDPNQKFIYVYDFAKNWSFQVELINVSKEENPKITYPAVIRKEGIPPSQYGTKSLLGERFTDIEEKYVLTKGAEGFGEEGEEGTTDSTSDEFGGEESASEEEAFFFVERTI

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
3 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
156 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
157 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
158 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
159 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
185 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
186 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
200 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
201 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
202 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
203 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
204 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
205 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
206 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
207 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
208 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
209 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
210 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
211 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
212 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
213 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
214 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
215 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
216 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
222 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
223 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
224 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
225 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
226 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
227 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
228 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
229 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
230 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
231 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
234 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
235 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
236 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
237 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
240 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.22
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.13
Nodule 0
Rhizoplane 0
Rhizosphere 85.3
Stem 0
Stem Tuber 0
Unclassified 5.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004081 3300001979 Bacteria 6318
2 JGI24740J21852_10021865 3300001979 Bacteria 2210
3 JGI24737J22298_10127208 3300001990 Bacteria 753
4 JGI25154J39366_1000008 3300002738 Bacteria 315375
5 JGI25158J39367_1011892 3300002739 Bacteria 1153
6 JGI25153J46596_10001413 3300003215 Bacteria 14398
7 rootH1_10060251 3300003316 Bacteria 6452
8 rootH1_10096109 3300003316 Bacteria 1238
9 rootH2_10030144 3300003320 Bacteria 6564
10 rootL2_10044891 3300003322 Bacteria 5631
11 rootH1_10038549 3300003323 Bacteria 10317
12 rootH1_10055347 3300003323 Bacteria 26133
13 rootH1_10111962 3300003323 Bacteria 1603
14 rootH1_10116642 3300003323 Bacteria 1996
15 rootH1_10265137 3300003323 Unclassified 3362
16 rootH1_10374198 3300003323 Bacteria 1934
17 JGI25160J50197_1002257 3300003354 Bacteria 9045
18 Ga0055535_1005622 3300003761 Bacteria 2704
19 Ga0055542_1003917 3300003762 Bacteria 3819
20 Ga0055531_10005359 3300003794 Bacteria 7520
21 Ga0065165_1014717 3300005262 Bacteria 3024
22 Ga0065704_10001498 3300005289 Bacteria 9163
23 Ga0065712_10091398 3300005290 Bacteria 2373
24 Ga0070658_10091083 3300005327 Bacteria 2513
25 Ga0070676_10396415 3300005328 Unclassified 959
26 Ga0070683_100046014 3300005329 Bacteria 4029
27 Ga0070683_100282182 3300005329 Unclassified 1580
28 Ga0070670_100073261 3300005331 Unclassified 2942
29 Ga0070670_100086363 3300005331 Bacteria 2696
30 Ga0070670_100234877 3300005331 Unclassified 1596
31 Ga0068869_100119957 3300005334 Bacteria 2010
32 Ga0068869_100396369 3300005334 Bacteria 1134
33 Ga0070666_10074210 3300005335 Bacteria 2318
34 Ga0070680_100166424 3300005336 Bacteria 1854
35 Ga0070680_101190987 3300005336 Bacteria 659
36 Ga0070682_100025077 3300005337 Bacteria 3556
37 Ga0068868_101189979 3300005338 Bacteria 704
38 Ga0070660_100023293 3300005339 Bacteria 4587
39 Ga0070660_100257834 3300005339 Bacteria 1423
40 Ga0070687_100167658 3300005343 Bacteria 1304
41 Ga0070661_100052441 3300005344 Bacteria 2986
42 Ga0070692_10554349 3300005345 Bacteria 753
43 Ga0070669_100583121 3300005353 Unclassified 935
44 Ga0070675_100014673 3300005354 Bacteria 6180
45 Ga0070675_100286548 3300005354 Bacteria 1449
46 Ga0070675_100820413 3300005354 Bacteria 851
47 Ga0070671_100021409 3300005355 Bacteria 5280
48 Ga0070671_100101961 3300005355 Bacteria 2408
49 Ga0070674_100196408 3300005356 Bacteria 1555
50 Ga0070673_100092153 3300005364 Bacteria 2478
51 Ga0070673_100451779 3300005364 Unclassified 1156
52 Ga0070673_100467087 3300005364 Bacteria 1137
53 Ga0070673_100475363 3300005364 Unclassified 1127
54 Ga0070659_100000832 3300005366 Bacteria 22486
55 Ga0070659_100003144 3300005366 Bacteria 11757
56 Ga0070667_100078976 3300005367 Bacteria 2812
57 Ga0070663_100141848 3300005455 Bacteria 1835
58 Ga0070678_100203881 3300005456 Bacteria 1634
59 Ga0070662_100011837 3300005457 Bacteria 5767
60 Ga0070681_10288233 3300005458 Bacteria 1552
61 Ga0070681_10476266 3300005458 Bacteria 1161
62 Ga0070681_10513000 3300005458 Unclassified 1112
63 Ga0068867_100225040 3300005459 Bacteria 1514
64 Ga0070707_100710515 3300005468 Bacteria 968
65 Ga0070679_100028368 3300005530 Bacteria 5518
66 Ga0070684_100059136 3300005535 Bacteria 3350
67 Ga0070684_100108792 3300005535 Unclassified 2484
68 Ga0068853_100025196 3300005539 Bacteria 4991
69 Ga0068853_100142650 3300005539 Bacteria 2151
70 Ga0068853_100161047 3300005539 Bacteria 2025
71 Ga0068853_100527288 3300005539 Bacteria 1117
72 Ga0070672_100101950 3300005543 Bacteria 2329
73 Ga0070672_100209689 3300005543 Unclassified 1631
74 Ga0070665_100000074 3300005548 Bacteria 192944
75 Ga0068855_100036619 3300005563 Bacteria 5838
76 Ga0068855_100146363 3300005563 Bacteria 2689
77 Ga0068855_100256679 3300005563 Unclassified 1949
78 Ga0070664_100000950 3300005564 Bacteria 22641
79 Ga0070664_100465328 3300005564 Bacteria 1162
80 Ga0068857_100003072 3300005577 Bacteria 13802
81 Ga0068857_100018903 3300005577 Bacteria 6045
82 Ga0068857_100125641 3300005577 Bacteria 2311
83 Ga0068857_100151253 3300005577 Unclassified 2103
84 Ga0068857_100165413 3300005577 Bacteria 2008
85 Ga0068854_100025843 3300005578 Bacteria 4030
86 Ga0068856_100034120 3300005614 Bacteria 4984
87 Ga0068856_100079438 3300005614 Bacteria 3253
88 Ga0068856_100139226 3300005614 Bacteria 2434
89 Ga0068856_100173876 3300005614 Unclassified 2166
90 Ga0070702_100459596 3300005615 Bacteria 925
91 Ga0068852_100001764 3300005616 Bacteria 14723
92 Ga0068852_100002876 3300005616 Bacteria 11944
93 Ga0068852_100005383 3300005616 Bacteria 9151
94 Ga0068852_100095007 3300005616 Bacteria 2676
95 Ga0068852_100096553 3300005616 Bacteria 2657
96 Ga0068852_100263909 3300005616 Unclassified 1654
97 Ga0068852_100344656 3300005616 Bacteria 1453
98 Ga0068852_100907405 3300005616 Bacteria 898
99 Ga0068864_100199168 3300005618 Bacteria 1839
100 Ga0068864_100630090 3300005618 Bacteria 1043
101 Ga0068851_10214797 3300005834 Bacteria 1078
102 Ga0068870_10189405 3300005840 Unclassified 1240
103 Ga0068860_100000034 3300005843 Bacteria 243128
104 Ga0068860_100009185 3300005843 Bacteria 9826
105 Ga0068860_100045048 3300005843 Bacteria 4205
106 Ga0075366_10397399 3300006195 Bacteria 848
107 Ga0097621_100027306 3300006237 Bacteria 4488
108 Ga0097621_100085669 3300006237 Bacteria 2628
109 Ga0097621_100536989 3300006237 Bacteria 1063
110 Ga0068871_100001620 3300006358 Bacteria 15167
111 Ga0068871_101231515 3300006358 Unclassified 703
112 Ga0075428_100386762 3300006844 Bacteria 1500
113 Ga0075431_100044659 3300006847 Bacteria 4569
114 Ga0075429_100058362 3300006880 Unclassified 3360
115 Ga0068865_100595392 3300006881 Unclassified 934
116 Ga0105240_10000008 3300009093 Bacteria 618862
117 Ga0105240_10000059 3300009093 Bacteria 219860
118 Ga0105240_10000753 3300009093 Bacteria 59090
119 Ga0105240_10016430 3300009093 Bacteria 10021
120 Ga0105240_10059903 3300009093 Bacteria 4748
121 Ga0105240_10134524 3300009093 Bacteria 2962
122 Ga0114129_10014867 3300009147 Bacteria 11089
123 Ga0114129_10068767 3300009147 Bacteria 4937
124 Ga0105241_10004808 3300009174 Bacteria 9951
125 Ga0105241_10066594 3300009174 Bacteria 2786
126 Ga0105241_10075190 3300009174 Bacteria 2632
127 Ga0105241_10372371 3300009174 Bacteria 1246
128 Ga0105241_10590747 3300009174 Bacteria 1002
129 Ga0105237_10000137 3300009545 Bacteria 102639
130 Ga0105237_10000365 3300009545 Bacteria 64152
131 Ga0105237_10019925 3300009545 Bacteria 6925
132 Ga0105237_10057490 3300009545 Bacteria 3892
133 Ga0105237_10272495 3300009545 Bacteria 1695
134 Ga0105237_10278614 3300009545 Bacteria 1675
135 Ga0105237_10352893 3300009545 Bacteria 1475
136 Ga0105238_10001640 3300009551 Bacteria 22429
137 Ga0105238_10079019 3300009551 Bacteria 3279
138 Ga0105238_10499119 3300009551 Bacteria 1217
139 Ga0105239_10013585 3300010375 Bacteria 9039
140 Ga0105239_10017342 3300010375 Bacteria 7965
141 Ga0105239_10083774 3300010375 Bacteria 3512
142 Ga0105239_10519656 3300010375 Bacteria 1354
143 Ga0157373_10010080 3300013100 Bacteria 6963
144 Ga0157373_10063980 3300013100 Bacteria 2604
145 Ga0157373_10185581 3300013100 Bacteria 1465
146 Ga0157371_10014609 3300013102 Bacteria 5918
147 Ga0157371_10040631 3300013102 Bacteria 3321
148 Ga0157371_10061853 3300013102 Bacteria 2655
149 Ga0157371_10187722 3300013102 Bacteria 1479
150 Ga0157370_10010368 3300013104 Bacteria 9824
151 Ga0157370_10287782 3300013104 Bacteria 1518
152 Ga0157370_10460370 3300013104 Bacteria 1169
153 Ga0157369_10006593 3300013105 Bacteria 13423
154 Ga0157369_10081519 3300013105 Bacteria 3462
155 Ga0157369_10192829 3300013105 Unclassified 2140
156 Ga0157369_10243594 3300013105 Bacteria 1877
157 Ga0157369_10703765 3300013105 Bacteria 1040
158 Ga0157369_10752459 3300013105 Bacteria 1002
159 Ga0157369_11387706 3300013105 Bacteria 715
160 Ga0157374_10001675 3300013296 Bacteria 18564
161 Ga0157374_10019513 3300013296 Bacteria 6001
162 Ga0157374_10023310 3300013296 Bacteria 5536
163 Ga0157374_10027788 3300013296 Bacteria 5107
164 Ga0157374_10078178 3300013296 Bacteria 3133
165 Ga0157374_10446192 3300013296 Bacteria 1295
166 Ga0157378_10020257 3300013297 Bacteria 5850
167 Ga0157378_10451300 3300013297 Bacteria 1276
168 Ga0163162_10016723 3300013306 Bacteria 7170
169 Ga0163162_10151141 3300013306 Bacteria 2440
170 Ga0163162_11279332 3300013306 Bacteria 833
171 Ga0157372_10005542 3300013307 Bacteria 13422
172 Ga0157372_10026285 3300013307 Bacteria 6333
173 Ga0157372_10067003 3300013307 Bacteria 4034
174 Ga0157372_10081466 3300013307 Bacteria 3664
175 Ga0157372_10144970 3300013307 Bacteria 2738
176 Ga0157372_10154477 3300013307 Bacteria 2650
177 Ga0157372_10206258 3300013307 Bacteria 2278
178 Ga0157372_10702449 3300013307 Unclassified 1177
179 Ga0157372_10812889 3300013307 Bacteria 1086
180 Ga0157372_10999009 3300013307 Bacteria 969
181 Ga0157372_11334515 3300013307 Bacteria 827
182 Ga0157372_11350344 3300013307 Bacteria 822
183 Ga0157375_10386631 3300013308 Bacteria 1566
184 Ga0157375_10563550 3300013308 Unclassified 1300
185 Ga0163163_10013034 3300014325 Bacteria 7590
186 Ga0157380_10038914 3300014326 Bacteria 3695
187 Ga0157377_10021622 3300014745 Bacteria 3386
188 Ga0157376_10900266 3300014969 Unclassified 903
189 Ga0206356_11653086 3300020070 Bacteria 670
190 Ga0209436_104011 3300025208 Bacteria 3724
191 Ga0209646_1000045 3300025246 Bacteria 333765
192 Ga0209646_1002910 3300025246 Bacteria 3568
193 Ga0209026_1000075 3300025250 Bacteria 202874
194 Ga0209130_1000915 3300025284 Bacteria 23743
195 Ga0209758_1005408 3300025297 Bacteria 9866
196 Ga0207426_1000073 3300025302 Bacteria 323756
197 Ga0207426_1000236 3300025302 Bacteria 125348
198 Ga0207656_10124563 3300025321 Unclassified 1203
199 Ga0207680_10035952 3300025903 Bacteria 2849
200 Ga0207647_10000949 3300025904 Bacteria 22419
201 Ga0207647_10019524 3300025904 Bacteria 4556
202 Ga0207705_10550841 3300025909 Bacteria 897
203 Ga0207654_10011230 3300025911 Bacteria 4565
204 Ga0207654_10032051 3300025911 Bacteria 2899
205 Ga0207654_10366178 3300025911 Bacteria 995
206 Ga0207654_10560261 3300025911 Bacteria 812
207 Ga0207707_10436752 3300025912 Bacteria 1121
208 Ga0207695_10000021 3300025913 Bacteria 679399
209 Ga0207695_10000039 3300025913 Bacteria 454801
210 Ga0207695_10000982 3300025913 Bacteria 50708
211 Ga0207695_10066857 3300025913 Bacteria 3689
212 Ga0207695_10067837 3300025913 Bacteria 3657
213 Ga0207695_10169755 3300025913 Bacteria 2108
214 Ga0207695_10215884 3300025913 Bacteria 1827
215 Ga0207671_10000424 3300025914 Bacteria 58429
216 Ga0207671_10002130 3300025914 Bacteria 21609
217 Ga0207671_10002759 3300025914 Bacteria 18342
218 Ga0207671_10023057 3300025914 Bacteria 4697
219 Ga0207671_10077374 3300025914 Bacteria 2490
220 Ga0207671_10114567 3300025914 Bacteria 2055
221 Ga0207662_10567962 3300025918 Bacteria 787
222 Ga0207657_10004992 3300025919 Bacteria 13947
223 Ga0207649_10183785 3300025920 Unclassified 1465
224 Ga0207649_10191877 3300025920 Bacteria 1437
225 Ga0207649_10207145 3300025920 Bacteria 1389
226 Ga0207652_10031118 3300025921 Bacteria 4479
227 Ga0207652_10240660 3300025921 Bacteria 1631
228 Ga0207694_10048130 3300025924 Bacteria 3299
229 Ga0207694_10800206 3300025924 Bacteria 796
230 Ga0207650_10001164 3300025925 Bacteria 19325
231 Ga0207650_10089075 3300025925 Bacteria 2355
232 Ga0207650_10109201 3300025925 Unclassified 2139
233 Ga0207650_10363660 3300025925 Unclassified 1192
234 Ga0207659_10106278 3300025926 Unclassified 2125
235 Ga0207659_10392493 3300025926 Bacteria 1159
236 Ga0207644_10544516 3300025931 Bacteria 960
237 Ga0207690_10011088 3300025932 Bacteria 5375
238 Ga0207690_10924208 3300025932 Bacteria 724
239 Ga0207706_10007504 3300025933 Bacteria 10089
240 Ga0207704_10971224 3300025938 Unclassified 717
241 Ga0207691_10213706 3300025940 Unclassified 1674
242 Ga0207691_10342950 3300025940 Bacteria 1279
243 Ga0207691_10569472 3300025940 Unclassified 960
244 Ga0207689_10203970 3300025942 Bacteria 1632
245 Ga0207689_10474581 3300025942 Bacteria 1047
246 Ga0207661_10083922 3300025944 Bacteria 2637
247 Ga0207661_10751690 3300025944 Unclassified 897
248 Ga0207679_10033771 3300025945 Bacteria 3603
249 Ga0207679_10933464 3300025945 Unclassified 794
250 Ga0207667_10004578 3300025949 Bacteria 16953
251 Ga0207667_10009515 3300025949 Bacteria 11435
252 Ga0207667_10247233 3300025949 Unclassified 1825
253 Ga0207667_11116782 3300025949 Bacteria 771
254 Ga0207651_10069166 3300025960 Bacteria 2492
255 Ga0207651_10167628 3300025960 Bacteria 1729
256 Ga0207651_10689834 3300025960 Unclassified 899
257 Ga0207640_10128591 3300025981 Bacteria 1827
258 Ga0207658_10059734 3300025986 Bacteria 2842
259 Ga0207658_10854346 3300025986 Bacteria 828
260 Ga0207677_10037523 3300026023 Bacteria 3168
261 Ga0207677_10248423 3300026023 Unclassified 1443
262 Ga0207639_10004585 3300026041 Bacteria 9301
263 Ga0207639_10032669 3300026041 Bacteria 3833
264 Ga0207639_10121869 3300026041 Bacteria 2144
265 Ga0207639_10278340 3300026041 Bacteria 1470
266 Ga0207639_11075582 3300026041 Bacteria 754
267 Ga0207678_10847527 3300026067 Bacteria 807
268 Ga0207702_10099342 3300026078 Bacteria 2565
269 Ga0207702_10156386 3300026078 Bacteria 2078
270 Ga0207641_10085072 3300026088 Bacteria 2755
271 Ga0207648_10021754 3300026089 Bacteria 5763
272 Ga0207648_10861740 3300026089 Bacteria 845
273 Ga0207676_10257700 3300026095 Bacteria 1573
274 Ga0207676_10717891 3300026095 Bacteria 970
275 Ga0207676_11095542 3300026095 Bacteria 787
276 Ga0207674_10004689 3300026116 Bacteria 16408
277 Ga0207674_10029388 3300026116 Bacteria 5786
278 Ga0207674_10073413 3300026116 Unclassified 3435
279 Ga0207674_10160306 3300026116 Bacteria 2204
280 Ga0207674_10415741 3300026116 Bacteria 1299
281 Ga0207674_10717172 3300026116 Bacteria 965
282 Ga0207675_100194783 3300026118 Bacteria 1945
283 Ga0207675_100759727 3300026118 Bacteria 981
284 Ga0207683_10291555 3300026121 Bacteria 1492
285 Ga0207698_10001608 3300026142 Bacteria 13148
286 Ga0207698_10037457 3300026142 Bacteria 3572
287 Ga0207698_10063846 3300026142 Bacteria 2884
288 Ga0207698_10064305 3300026142 Bacteria 2875
289 Ga0207698_10064831 3300026142 Bacteria 2865
290 Ga0207698_10191776 3300026142 Unclassified 1821
291 Ga0207698_10258136 3300026142 Unclassified 1599
292 Ga0207698_10262869 3300026142 Bacteria 1586
293 Ga0209968_1031823 3300027526 Bacteria 884
294 Ga0209999_1016392 3300027543 Unclassified 1348
295 Ga0268266_10000010 3300028379 Bacteria 1030233
296 Ga0268264_10000052 3300028381 Bacteria 321218
297 Ga0268264_10001431 3300028381 Bacteria 22308
298 Ga0268264_10204210 3300028381 Unclassified 1810
299 Ga0307517_10133681 3300028786 Bacteria 1774
300 Ga0307511_10001606 3300030521 Bacteria 23990
301 Ga0265327_10000054 3300031251 Bacteria 250337
302 Ga0265327_10063702 3300031251 Bacteria 1871
303 Ga0307513_10028247 3300031456 Bacteria 6417
304 Ga0307509_10390766 3300031507 Bacteria 1101
305 Ga0307516_10001143 3300031730 Bacteria 37055
306 Ga0307516_10414771 3300031730 Bacteria 1005
307 Ga0307406_10068183 3300031901 Bacteria 2322
308 Ga0307407_10261945 3300031903 Bacteria 1190
309 Ga0307416_100022237 3300032002 Unclassified 4573
310 Ga0307416_101898748 3300032002 Unclassified 699
311 Ga0307414_10562331 3300032004 Bacteria 1018
312 Ga0307415_100059941 3300032126 Bacteria 2627
313 Ga0307510_10000869 3300033180 Bacteria 31741
314 Ga0373935_0583871 3300035692 Unclassified 816
315 Ga0373927_0110428 3300035695 Bacteria 1791
316 Ga0395900_0473941 3300037418 Bacteria 1205
317 Ga0395905_0004912 3300037471 Bacteria 13770
318 Ga0395905_1154029 3300037471 Unclassified 678
319 Ga0395901_1318307 3300038443 Bacteria 683
320 Ga0436365_1876803 3300039437 Bacteria 22992
321 Ga0439436_0053945 3300041404 Bacteria 1131
322 Ga0439439_0015814 3300041406 Bacteria 1844
323 Ga0439439_0065488 3300041406 Bacteria 969
324 Ga0451841_1322386 3300041498 Bacteria 3266
325 Ga0439431_0002975 3300041997 Bacteria 3719
326 Ga0439433_0052526 3300041999 Bacteria 963
327 Ga0439445_0002757 3300042004 Bacteria 3917
328 Ga0439449_0011275 3300042007 Bacteria 3366
329 Ga0439449_0028173 3300042007 Bacteria 2094
330 Ga0451577_0066392 3300042876 Bacteria 3218
331 Ga0466972_0000348 3300044658 Bacteria 25310
332 Ga0466972_0000422 3300044658 Bacteria 21982
333 Ga0466972_0015986 3300044658 Bacteria 3751
334 Ga0466965_0371490 3300044683 Bacteria 786
335 Ga0466961_0246328 3300044693 Bacteria 1098
336 Ga0453684_0030904 3300044712 Bacteria 7551
337 Ga0453684_0235965 3300044712 Bacteria 2108
338 Ga0466968_0087801 3300044735 Bacteria 1374
339 Ga0466968_0107144 3300044735 Bacteria 1253
340 Ga0466970_0001701 3300044765 Bacteria 10578
341 Ga0466957_0000134 3300044842 Bacteria 31410
342 Ga0466957_0008275 3300044842 Bacteria 5912
343 Ga0466957_0225471 3300044842 Unclassified 1239
344 Ga0466957_0649260 3300044842 Bacteria 742
345 Ga0466959_0033328 3300045049 Bacteria 3809
346 Ga0466959_0123511 3300045049 Unclassified 1839
347 Ga0451576_0857981 3300045051 Bacteria 953
348 Ga0466967_0112998 3300045976 Bacteria 2498
349 Ga0466967_0694321 3300045976 Bacteria 1008
350 Ga0466967_1278548 3300045976 Bacteria 731
351 Ga0495638_0049942 3300046460 Bacteria 2614
352 Ga0495638_0173026 3300046460 Unclassified 1238
353 Ga0495606_0022321 3300046507 Bacteria 4613
354 Ga0495632_0288114 3300046519 Bacteria 730
355 Ga0495648_0003458 3300046524 Bacteria 13894
356 Ga0495645_0508859 3300046543 Bacteria 752
357 Ga0495667_0668061 3300046559 Bacteria 645
358 Ga0495611_0000135 3300046648 Bacteria 51495
359 Ga0495625_0437049 3300046660 Bacteria 811
360 Ga0495672_0085000 3300047320 Bacteria 1754
361 Ga0495687_000039 3300047443 Bacteria 245077
362 Ga0495686_0000046 3300047472 Bacteria 281963
363 Ga0501296_024271 3300049519 Bacteria 790
364 Ga0501299_036102 3300049522 Bacteria 974
365 Ga0501300_015121 3300049523 Bacteria 1127
366 Ga0501032_0004185 3300049569 Bacteria 10930
367 Ga0501033_0602689 3300049570 Unclassified 753
368 Ga0501034_0002222 3300049571 Bacteria 23945
369 Ga0501034_0244708 3300049571 Bacteria 1739
370 Ga0501034_0258868 3300049571 Bacteria 1683
371 Ga0501034_0692804 3300049571 Bacteria 918
372 Ga0501036_0132545 3300049572 Bacteria 2103
373 Ga0501037_0003388 3300049573 Bacteria 11590
374 Ga0501038_0017914 3300049574 Bacteria 6399
375 Ga0501039_0054580 3300049575 Bacteria 3093
376 Ga0501043_0011232 3300049579 Bacteria 7015
377 Ga0501043_0111049 3300049579 Bacteria 2152
378 Ga0501043_0469827 3300049579 Bacteria 943
379 Ga0501046_0241186 3300049580 Unclassified 1333
380 Ga0501047_0005548 3300049581 Bacteria 11874
381 Ga0501047_0011539 3300049581 Bacteria 8364
382 Ga0501047_0127838 3300049581 Bacteria 2421
383 Ga0501048_0302343 3300049582 Bacteria 1138
384 Ga0501070_0776838 3300049586 Unclassified 753
385 Ga0501198_006405 3300049649 Unclassified 1676
386 Ga0501202_000389 3300049652 Bacteria 6109
387 Ga0501202_010986 3300049652 Bacteria 1689
388 Ga0501202_036121 3300049652 Bacteria 1051
389 Ga0501217_001947 3300049661 Bacteria 3968
390 Ga0501217_061298 3300049661 Unclassified 1005
391 Ga0501235_009031 3300049669 Bacteria 2176
392 Ga0501242_021935 3300049674 Bacteria 827
393 Ga0501247_006031 3300049677 Unclassified 1364
394 Ga0501247_018730 3300049677 Bacteria 886
395 Ga0501251_048391 3300049681 Bacteria 666
396 Ga0501252_000918 3300049682 Bacteria 2545
397 Ga0501257_004349 3300049686 Bacteria 3090
398 Ga0501257_025953 3300049686 Bacteria 1396
399 Ga0501257_079167 3300049686 Bacteria 846
400 Ga0501259_015512 3300049688 Bacteria 1302
401 Ga0501261_003707 3300049690 Bacteria 1876
402 Ga0501219_001135 3300049703 Bacteria 2960
403 Ga0501221_002983 3300049704 Bacteria 2789
404 Ga0501221_038659 3300049704 Unclassified 1032
405 Ga0501225_0010429 3300049705 Bacteria 2631
406 Ga0501225_0023300 3300049705 Bacteria 1706
407 Ga0501234_004557 3300049707 Unclassified 2181
408 Ga0501245_002779 3300049708 Bacteria 2349
409 Ga0501241_001440 3300049758 Bacteria 4848
410 Ga0501241_002792 3300049758 Bacteria 3355
411 Ga0501266_005724 3300049763 Bacteria 1543
412 Ga0501035_0057807 3300049822 Bacteria 3458
413 Ga0501035_0945308 3300049822 Bacteria 680
414 Ga0501044_0007421 3300049823 Bacteria 12060
415 Ga0501044_0019114 3300049823 Bacteria 7335
416 Ga0501284_00048 3300050005 Bacteria 45450
417 nmdc:mga05p37_10412_c1 3300050507 Bacteria 11036
418 nmdc:mga05p37_226138_c1 3300050507 Bacteria 2256
419 Ga0500578_0000462 3300053086 Bacteria 49481
420 Ga0500578_0068941 3300053086 Bacteria 2254
421 Ga0500644_0037686 3300053088 Bacteria 1582
422 Ga0500644_0270397 3300053088 Bacteria 721
423 Ga0500646_0001881 3300053090 Bacteria 5507
424 Ga0500646_0012381 3300053090 Bacteria 2201
425 Ga0500646_0014587 3300053090 Bacteria 2041
426 Ga0500583_0000031 3300053092 Bacteria 104319
427 Ga0500583_0000923 3300053092 Bacteria 8392
428 Ga0500583_0053552 3300053092 Bacteria 1881
429 Ga0500651_0144626 3300053093 Bacteria 1431
430 Ga0500650_0030255 3300053098 Bacteria 2455
431 Ga0500556_0050095 3300053104 Bacteria 1508
432 Ga0500562_028456 3300053108 Bacteria 1469
433 Ga0500642_0306581 3300053130 Bacteria 715
434 Ga0500652_007986 3300053131 Bacteria 3502
435 Ga0500652_091507 3300053131 Bacteria 1270
436 Ga0500655_008622 3300053133 Unclassified 1836
437 Ga0500568_0016814 3300053139 Bacteria 3241
438 Ga0500577_0216083 3300053142 Bacteria 829
439 Ga0500588_0033219 3300053146 Bacteria 1504
440 Ga0500589_094264 3300053147 Bacteria 1312
441 Ga0500590_215947 3300053148 Unclassified 796
442 Ga0500603_166509 3300053150 Unclassified 689
443 Ga0500622_0076226 3300053156 Bacteria 1686
444 Ga0500622_0143855 3300053156 Bacteria 1134
445 Ga0500639_040814 3300053163 Bacteria 2442
446 Ga0500636_0034813 3300053177 Bacteria 2981

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0583871 Ga0373935_0583871_48_575 143
2 3300049570 Ga0501033_0602689 Ga0501033_0602689_12_512 143
3 3300046519 Ga0495632_0288114 Ga0495632_0288114_164_712 144
4 3300049661 Ga0501217_061298 Ga0501217_061298_423_965 145
5 3300006358 Ga0068871_101231515 Ga0068871_1012315151 154
6 3300006881 Ga0068865_100595392 Ga0068865_1005953922 154
7 3300025938 Ga0207704_10971224 Ga0207704_109712241 154
8 3300026088 Ga0207641_10085072 Ga0207641_100850722 154
9 iso_pu_bacteria 2884791551 2884791738 156
10 3300044683 Ga0466965_0371490 Ga0466965_0371490_213_776 157
11 iso_pu_bacteria 2738541278 2738730516 157
12 3300003323 rootH1_10374198 rootH1_103741982 158
13 3300005335 Ga0070666_10074210 Ga0070666_100742101 158
14 3300005338 Ga0068868_101189979 Ga0068868_1011899791 158
15 3300005539 Ga0068853_100142650 Ga0068853_1001426502 158
16 3300005616 Ga0068852_100095007 Ga0068852_1000950073 158
17 3300005616 Ga0068852_100344656 Ga0068852_1003446563 158
18 3300010375 Ga0105239_10083774 Ga0105239_100837743 158
19 3300013105 Ga0157369_10192829 Ga0157369_101928292 158
20 3300013296 Ga0157374_10019513 Ga0157374_100195135 158
21 3300013296 Ga0157374_10023310 Ga0157374_100233102 158
22 3300013306 Ga0163162_11279332 Ga0163162_112793321 158
23 3300025246 Ga0209646_1002910 Ga0209646_10029102 158
24 3300025911 Ga0207654_10366178 Ga0207654_103661782 158
25 3300025913 Ga0207695_10169755 Ga0207695_101697552 158
26 3300025921 Ga0207652_10240660 Ga0207652_102406602 158
27 3300026041 Ga0207639_10004585 Ga0207639_100045852 158
28 3300026142 Ga0207698_10258136 Ga0207698_102581362 158
29 3300026142 Ga0207698_10262869 Ga0207698_102628692 158
30 3300031730 Ga0307516_10414771 Ga0307516_104147713 158
31 3300039437 Ga0436365_1876803 Ga0436365_1876803_20840_21421 158
32 3300046660 Ga0495625_0437049 Ga0495625_0437049_129_722 158
33 3300049569 Ga0501032_0004185 Ga0501032_0004185_4592_5161 158
34 3300049571 Ga0501034_0002222 Ga0501034_0002222_4931_5500 158
35 3300049572 Ga0501036_0132545 Ga0501036_0132545_457_1026 158
36 3300049573 Ga0501037_0003388 Ga0501037_0003388_746_1315 158
37 3300049574 Ga0501038_0017914 Ga0501038_0017914_1005_1574 158
38 3300049575 Ga0501039_0054580 Ga0501039_0054580_1619_2188 158
39 3300049579 Ga0501043_0011232 Ga0501043_0011232_3962_4531 158
40 3300049581 Ga0501047_0011539 Ga0501047_0011539_3787_4356 158
41 3300049822 Ga0501035_0057807 Ga0501035_0057807_996_1565 158
42 3300049823 Ga0501044_0007421 Ga0501044_0007421_10174_10743 158
43 3300053090 Ga0500646_0012381 Ga0500646_0012381_832_1425 158
44 3300053092 Ga0500583_0000923 Ga0500583_0000923_3593_4186 158
45 3300053108 Ga0500562_028456 Ga0500562_028456_492_1079 158
46 3300053147 Ga0500589_094264 Ga0500589_094264_360_953 158
47 3300053156 Ga0500622_0143855 Ga0500622_0143855_148_741 158
48 3300003761 Ga0055535_1005622 Ga0055535_10056223 159
49 3300003762 Ga0055542_1003917 Ga0055542_10039172 159
50 3300003794 Ga0055531_10005359 Ga0055531_100053598 159
51 3300005290 Ga0065712_10091398 Ga0065712_100913982 159
52 3300005331 Ga0070670_100086363 Ga0070670_1000863632 159
53 3300005339 Ga0070660_100257834 Ga0070660_1002578342 159
54 3300005353 Ga0070669_100583121 Ga0070669_1005831212 159
55 3300005354 Ga0070675_100014673 Ga0070675_1000146736 159
56 3300005356 Ga0070674_100196408 Ga0070674_1001964082 159
57 3300005364 Ga0070673_100475363 Ga0070673_1004753632 159
58 3300005366 Ga0070659_100000832 Ga0070659_1000008325 159
59 3300005543 Ga0070672_100101950 Ga0070672_1001019502 159
60 3300005616 Ga0068852_100005383 Ga0068852_1000053836 159
61 3300005834 Ga0068851_10214797 Ga0068851_102147972 159
62 3300005840 Ga0068870_10189405 Ga0068870_101894052 159
63 3300013105 Ga0157369_10081519 Ga0157369_100815192 159
64 3300014326 Ga0157380_10038914 Ga0157380_100389143 159
65 3300025904 Ga0207647_10000949 Ga0207647_1000094910 159
66 3300025925 Ga0207650_10089075 Ga0207650_100890753 159
67 3300025926 Ga0207659_10106278 Ga0207659_101062782 159
68 3300025932 Ga0207690_10011088 Ga0207690_100110882 159
69 3300025940 Ga0207691_10569472 Ga0207691_105694722 159
70 3300025960 Ga0207651_10689834 Ga0207651_106898342 159
71 3300026142 Ga0207698_10037457 Ga0207698_100374574 159
72 3300046543 Ga0495645_0508859 Ga0495645_0508859_83_673 159
73 3300046559 Ga0495667_0668061 Ga0495667_0668061_13_603 159
74 iso_pu_bacteria 2896109856 2896109997 159
75 3300005458 Ga0070681_10476266 Ga0070681_104762662 160
76 3300005539 Ga0068853_100161047 Ga0068853_1001610472 160
77 3300005543 Ga0070672_100209689 Ga0070672_1002096892 160
78 3300005563 Ga0068855_100256679 Ga0068855_1002566792 160
79 3300005577 Ga0068857_100125641 Ga0068857_1001256412 160
80 3300005614 Ga0068856_100173876 Ga0068856_1001738763 160
81 3300005616 Ga0068852_100096553 Ga0068852_1000965532 160
82 3300005616 Ga0068852_100263909 Ga0068852_1002639092 160
83 3300005843 Ga0068860_100045048 Ga0068860_1000450482 160
84 3300009093 Ga0105240_10000753 Ga0105240_1000075315 160
85 3300009093 Ga0105240_10059903 Ga0105240_100599033 160
86 3300009093 Ga0105240_10134524 Ga0105240_101345243 160
87 3300009174 Ga0105241_10004808 Ga0105241_100048083 160
88 3300009174 Ga0105241_10590747 Ga0105241_105907472 160
89 3300009545 Ga0105237_10019925 Ga0105237_100199252 160
90 3300009551 Ga0105238_10001640 Ga0105238_1000164012 160
91 3300013100 Ga0157373_10063980 Ga0157373_100639802 160
92 3300013105 Ga0157369_11387706 Ga0157369_113877061 160
93 3300013307 Ga0157372_10026285 Ga0157372_100262852 160
94 3300013307 Ga0157372_10812889 Ga0157372_108128892 160
95 3300025321 Ga0207656_10124563 Ga0207656_101245632 160
96 3300025911 Ga0207654_10011230 Ga0207654_100112302 160
97 3300025911 Ga0207654_10560261 Ga0207654_105602611 160
98 3300025913 Ga0207695_10000982 Ga0207695_1000098226 160
99 3300025913 Ga0207695_10067837 Ga0207695_100678373 160
100 3300025914 Ga0207671_10002130 Ga0207671_1000213011 160
101 3300025920 Ga0207649_10183785 Ga0207649_101837851 160
102 3300025924 Ga0207694_10048130 Ga0207694_100481303 160
103 3300025940 Ga0207691_10213706 Ga0207691_102137062 160
104 3300025944 Ga0207661_10751690 Ga0207661_107516902 160
105 3300025945 Ga0207679_10933464 Ga0207679_109334642 160
106 3300025949 Ga0207667_10247233 Ga0207667_102472332 160
107 3300025960 Ga0207651_10167628 Ga0207651_101676282 160
108 3300026023 Ga0207677_10248423 Ga0207677_102484232 160
109 3300026041 Ga0207639_10121869 Ga0207639_101218692 160
110 3300026095 Ga0207676_10257700 Ga0207676_102577002 160
111 3300026116 Ga0207674_10160306 Ga0207674_101603062 160
112 3300026142 Ga0207698_10064305 Ga0207698_100643052 160
113 3300026142 Ga0207698_10191776 Ga0207698_101917762 160
114 3300027526 Ga0209968_1031823 Ga0209968_10318232 160
115 3300027543 Ga0209999_1016392 Ga0209999_10163922 160
116 3300028381 Ga0268264_10204210 Ga0268264_102042102 160
117 3300037471 Ga0395905_1154029 Ga0395905_1154029_40_615 160
118 3300042876 Ga0451577_0066392 Ga0451577_0066392_41_610 160
119 3300044658 Ga0466972_0000422 Ga0466972_0000422_13747_14307 160
120 3300044712 Ga0453684_0235965 Ga0453684_0235965_1209_1778 160
121 3300044735 Ga0466968_0107144 Ga0466968_0107144_666_1226 160
122 3300044765 Ga0466970_0001701 Ga0466970_0001701_5693_6253 160
123 3300049519 Ga0501296_024271 Ga0501296_024271_60_647 160
124 3300049523 Ga0501300_015121 Ga0501300_015121_292_909 160
125 3300049649 Ga0501198_006405 Ga0501198_006405_30_647 160
126 3300049652 Ga0501202_000389 Ga0501202_000389_2937_3554 160
127 3300049661 Ga0501217_001947 Ga0501217_001947_242_859 160
128 3300049669 Ga0501235_009031 Ga0501235_009031_437_1054 160
129 3300049682 Ga0501252_000918 Ga0501252_000918_1070_1687 160
130 3300049686 Ga0501257_025953 Ga0501257_025953_189_776 160
131 3300049688 Ga0501259_015512 Ga0501259_015512_366_953 160
132 3300049690 Ga0501261_003707 Ga0501261_003707_317_934 160
133 3300049704 Ga0501221_002983 Ga0501221_002983_686_1303 160
134 3300049705 Ga0501225_0023300 Ga0501225_0023300_926_1513 160
135 3300049707 Ga0501234_004557 Ga0501234_004557_1277_1864 160
136 3300049708 Ga0501245_002779 Ga0501245_002779_495_1082 160
137 3300003316 rootH1_10060251 rootH1_100602513 161
138 3300003316 rootH1_10096109 rootH1_100961091 161
139 3300003322 rootL2_10044891 rootL2_100448914 161
140 3300003323 rootH1_10055347 rootH1_100553475 161
141 3300005367 Ga0070667_100078976 Ga0070667_1000789762 161
142 3300005548 Ga0070665_100000074 Ga0070665_1000000748 161
143 3300005563 Ga0068855_100146363 Ga0068855_1001463632 161
144 3300005577 Ga0068857_100151253 Ga0068857_1001512531 161
145 3300005614 Ga0068856_100139226 Ga0068856_1001392262 161
146 3300005843 Ga0068860_100009185 Ga0068860_1000091859 161
147 3300006195 Ga0075366_10397399 Ga0075366_103973991 161
148 3300006237 Ga0097621_100536989 Ga0097621_1005369892 161
149 3300009147 Ga0114129_10014867 Ga0114129_1001486710 161
150 3300009174 Ga0105241_10066594 Ga0105241_100665943 161
151 3300009545 Ga0105237_10000137 Ga0105237_1000013744 161
152 3300009545 Ga0105237_10000365 Ga0105237_1000036543 161
153 3300009545 Ga0105237_10057490 Ga0105237_100574902 161
154 3300009551 Ga0105238_10079019 Ga0105238_100790192 161
155 3300010375 Ga0105239_10013585 Ga0105239_100135856 161
156 3300013297 Ga0157378_10451300 Ga0157378_104513002 161
157 3300013307 Ga0157372_10206258 Ga0157372_102062582 161
158 3300020070 Ga0206356_11653086 Ga0206356_116530861 161
159 3300025913 Ga0207695_10215884 Ga0207695_102158842 161
160 3300025914 Ga0207671_10000424 Ga0207671_1000042444 161
161 3300025914 Ga0207671_10002759 Ga0207671_100027599 161
162 3300025914 Ga0207671_10114567 Ga0207671_101145672 161
163 3300025924 Ga0207694_10800206 Ga0207694_108002062 161
164 3300025949 Ga0207667_10004578 Ga0207667_1000457810 161
165 3300025986 Ga0207658_10059734 Ga0207658_100597342 161
166 3300026023 Ga0207677_10037523 Ga0207677_100375233 161
167 3300026041 Ga0207639_11075582 Ga0207639_110755821 161
168 3300026067 Ga0207678_10847527 Ga0207678_108475271 161
169 3300026116 Ga0207674_10073413 Ga0207674_100734133 161
170 3300028379 Ga0268266_10000010 Ga0268266_10000010631 161
171 3300028381 Ga0268264_10001431 Ga0268264_1000143114 161
172 3300033180 Ga0307510_10000869 Ga0307510_1000086924 161
173 3300035695 Ga0373927_0110428 Ga0373927_0110428_641_1237 161
174 3300037471 Ga0395905_0004912 Ga0395905_0004912_11215_11784 161
175 3300041404 Ga0439436_0053945 Ga0439436_0053945_12_581 161
176 3300041406 Ga0439439_0015814 Ga0439439_0015814_1171_1740 161
177 3300041406 Ga0439439_0065488 Ga0439439_0065488_230_802 161
178 3300041498 Ga0451841_1322386 Ga0451841_1322386_909_1508 161
179 3300041999 Ga0439433_0052526 Ga0439433_0052526_314_883 161
180 3300042007 Ga0439449_0011275 Ga0439449_0011275_742_1314 161
181 3300042007 Ga0439449_0028173 Ga0439449_0028173_1236_1805 161
182 3300044658 Ga0466972_0000348 Ga0466972_0000348_24651_25217 161
183 3300044658 Ga0466972_0015986 Ga0466972_0015986_2452_3021 161
184 3300044693 Ga0466961_0246328 Ga0466961_0246328_219_785 161
185 3300044735 Ga0466968_0087801 Ga0466968_0087801_561_1136 161
186 3300044842 Ga0466957_0000134 Ga0466957_0000134_9275_9841 161
187 3300044842 Ga0466957_0008275 Ga0466957_0008275_1934_2503 161
188 3300045049 Ga0466959_0033328 Ga0466959_0033328_1288_1863 161
189 3300045976 Ga0466967_1278548 Ga0466967_1278548_104_673 161
190 3300046460 Ga0495638_0173026 Ga0495638_0173026_65_670 161
191 3300046507 Ga0495606_0022321 Ga0495606_0022321_1939_2538 161
192 3300046648 Ga0495611_0000135 Ga0495611_0000135_14470_15075 161
193 3300047443 Ga0495687_000039 Ga0495687_000039_206529_207110 161
194 3300047472 Ga0495686_0000046 Ga0495686_0000046_114470_115060 161
195 3300049571 Ga0501034_0244708 Ga0501034_0244708_51_617 161
196 3300049571 Ga0501034_0258868 Ga0501034_0258868_847_1419 161
197 3300049579 Ga0501043_0111049 Ga0501043_0111049_435_1007 161
198 3300049579 Ga0501043_0469827 Ga0501043_0469827_185_751 161
199 3300049580 Ga0501046_0241186 Ga0501046_0241186_464_1036 161
200 3300049581 Ga0501047_0005548 Ga0501047_0005548_9006_9572 161
201 3300049581 Ga0501047_0127838 Ga0501047_0127838_968_1534 161
202 3300049582 Ga0501048_0302343 Ga0501048_0302343_72_638 161
203 3300049758 Ga0501241_001440 Ga0501241_001440_23_598 161
204 3300049822 Ga0501035_0945308 Ga0501035_0945308_42_608 161
205 3300049823 Ga0501044_0019114 Ga0501044_0019114_1215_1781 161
206 3300050507 nmdc:mga05p37_10412_c1 nmdc:mga05p37_10412_c1_1364_1948 161
207 3300053086 Ga0500578_0000462 Ga0500578_0000462_34390_34971 161
208 3300053086 Ga0500578_0068941 Ga0500578_0068941_597_1184 161
209 3300053088 Ga0500644_0037686 Ga0500644_0037686_436_1020 161
210 3300053090 Ga0500646_0014587 Ga0500646_0014587_351_935 161
211 3300053093 Ga0500651_0144626 Ga0500651_0144626_407_991 161
212 3300053098 Ga0500650_0030255 Ga0500650_0030255_990_1574 161
213 3300053104 Ga0500556_0050095 Ga0500556_0050095_632_1216 161
214 3300053130 Ga0500642_0306581 Ga0500642_0306581_77_664 161
215 3300053142 Ga0500577_0216083 Ga0500577_0216083_149_733 161
216 3300053146 Ga0500588_0033219 Ga0500588_0033219_33_632 161
217 3300053150 Ga0500603_166509 Ga0500603_166509_57_659 161
218 3300053163 Ga0500639_040814 Ga0500639_040814_1263_1865 161
219 3300001979 JGI24740J21852_10021865 JGI24740J21852_100218653 162
220 3300001990 JGI24737J22298_10127208 JGI24737J22298_101272081 162
221 3300003323 rootH1_10265137 rootH1_102651374 162
222 3300005289 Ga0065704_10001498 Ga0065704_100014983 162
223 3300005327 Ga0070658_10091083 Ga0070658_100910832 162
224 3300005328 Ga0070676_10396415 Ga0070676_103964152 162
225 3300005329 Ga0070683_100046014 Ga0070683_1000460143 162
226 3300005331 Ga0070670_100234877 Ga0070670_1002348773 162
227 3300005334 Ga0068869_100396369 Ga0068869_1003963692 162
228 3300005336 Ga0070680_100166424 Ga0070680_1001664242 162
229 3300005336 Ga0070680_101190987 Ga0070680_1011909871 162
230 3300005337 Ga0070682_100025077 Ga0070682_1000250773 162
231 3300005339 Ga0070660_100023293 Ga0070660_1000232934 162
232 3300005343 Ga0070687_100167658 Ga0070687_1001676581 162
233 3300005344 Ga0070661_100052441 Ga0070661_1000524413 162
234 3300005345 Ga0070692_10554349 Ga0070692_105543491 162
235 3300005354 Ga0070675_100820413 Ga0070675_1008204131 162
236 3300005355 Ga0070671_100101961 Ga0070671_1001019612 162
237 3300005364 Ga0070673_100092153 Ga0070673_1000921533 162
238 3300005364 Ga0070673_100467087 Ga0070673_1004670872 162
239 3300005366 Ga0070659_100003144 Ga0070659_1000031449 162
240 3300005455 Ga0070663_100141848 Ga0070663_1001418482 162
241 3300005456 Ga0070678_100203881 Ga0070678_1002038812 162
242 3300005457 Ga0070662_100011837 Ga0070662_1000118374 162
243 3300005458 Ga0070681_10288233 Ga0070681_102882331 162
244 3300005459 Ga0068867_100225040 Ga0068867_1002250401 162
245 3300005468 Ga0070707_100710515 Ga0070707_1007105152 162
246 3300005530 Ga0070679_100028368 Ga0070679_1000283685 162
247 3300005535 Ga0070684_100059136 Ga0070684_1000591363 162
248 3300005539 Ga0068853_100025196 Ga0068853_1000251964 162
249 3300005539 Ga0068853_100527288 Ga0068853_1005272881 162
250 3300005563 Ga0068855_100036619 Ga0068855_1000366195 162
251 3300005564 Ga0070664_100000950 Ga0070664_1000009506 162
252 3300005577 Ga0068857_100003072 Ga0068857_1000030729 162
253 3300005577 Ga0068857_100018903 Ga0068857_1000189033 162
254 3300005577 Ga0068857_100165413 Ga0068857_1001654132 162
255 3300005578 Ga0068854_100025843 Ga0068854_1000258432 162
256 3300005614 Ga0068856_100034120 Ga0068856_1000341203 162
257 3300005614 Ga0068856_100079438 Ga0068856_1000794382 162
258 3300005616 Ga0068852_100001764 Ga0068852_1000017643 162
259 3300005616 Ga0068852_100002876 Ga0068852_1000028766 162
260 3300005616 Ga0068852_100907405 Ga0068852_1009074052 162
261 3300005618 Ga0068864_100199168 Ga0068864_1001991682 162
262 3300005843 Ga0068860_100000034 Ga0068860_100000034147 162
263 3300006237 Ga0097621_100027306 Ga0097621_1000273064 162
264 3300006237 Ga0097621_100085669 Ga0097621_1000856692 162
265 3300006358 Ga0068871_100001620 Ga0068871_10000162013 162
266 3300009093 Ga0105240_10000008 Ga0105240_10000008370 162
267 3300009093 Ga0105240_10000059 Ga0105240_10000059178 162
268 3300009093 Ga0105240_10016430 Ga0105240_100164304 162
269 3300009174 Ga0105241_10075190 Ga0105241_100751903 162
270 3300009174 Ga0105241_10372371 Ga0105241_103723712 162
271 3300009545 Ga0105237_10278614 Ga0105237_102786142 162
272 3300009545 Ga0105237_10352893 Ga0105237_103528932 162
273 3300009551 Ga0105238_10499119 Ga0105238_104991192 162
274 3300010375 Ga0105239_10017342 Ga0105239_100173427 162
275 3300013100 Ga0157373_10010080 Ga0157373_100100806 162
276 3300013102 Ga0157371_10040631 Ga0157371_100406313 162
277 3300013102 Ga0157371_10187722 Ga0157371_101877222 162
278 3300013104 Ga0157370_10010368 Ga0157370_100103684 162
279 3300013104 Ga0157370_10460370 Ga0157370_104603701 162
280 3300013105 Ga0157369_10006593 Ga0157369_100065937 162
281 3300013105 Ga0157369_10243594 Ga0157369_102435942 162
282 3300013105 Ga0157369_10703765 Ga0157369_107037652 162
283 3300013105 Ga0157369_10752459 Ga0157369_107524591 162
284 3300013296 Ga0157374_10001675 Ga0157374_1000167512 162
285 3300013296 Ga0157374_10078178 Ga0157374_100781782 162
286 3300013296 Ga0157374_10446192 Ga0157374_104461922 162
287 3300013297 Ga0157378_10020257 Ga0157378_100202573 162
288 3300013306 Ga0163162_10016723 Ga0163162_100167235 162
289 3300013306 Ga0163162_10151141 Ga0163162_101511413 162
290 3300013307 Ga0157372_10005542 Ga0157372_100055429 162
291 3300013307 Ga0157372_10154477 Ga0157372_101544774 162
292 3300013307 Ga0157372_10999009 Ga0157372_109990092 162
293 3300013307 Ga0157372_11350344 Ga0157372_113503442 162
294 3300013308 Ga0157375_10386631 Ga0157375_103866313 162
295 3300013308 Ga0157375_10563550 Ga0157375_105635502 162
296 3300014745 Ga0157377_10021622 Ga0157377_100216223 162
297 3300014969 Ga0157376_10900266 Ga0157376_109002662 162
298 3300025903 Ga0207680_10035952 Ga0207680_100359523 162
299 3300025904 Ga0207647_10019524 Ga0207647_100195242 162
300 3300025909 Ga0207705_10550841 Ga0207705_105508411 162
301 3300025911 Ga0207654_10032051 Ga0207654_100320513 162
302 3300025912 Ga0207707_10436752 Ga0207707_104367522 162
303 3300025913 Ga0207695_10000021 Ga0207695_1000002131 162
304 3300025913 Ga0207695_10000039 Ga0207695_10000039239 162
305 3300025913 Ga0207695_10066857 Ga0207695_100668572 162
306 3300025914 Ga0207671_10023057 Ga0207671_100230572 162
307 3300025914 Ga0207671_10077374 Ga0207671_100773742 162
308 3300025918 Ga0207662_10567962 Ga0207662_105679621 162
309 3300025919 Ga0207657_10004992 Ga0207657_1000499211 162
310 3300025920 Ga0207649_10191877 Ga0207649_101918771 162
311 3300025921 Ga0207652_10031118 Ga0207652_100311184 162
312 3300025926 Ga0207659_10392493 Ga0207659_103924931 162
313 3300025931 Ga0207644_10544516 Ga0207644_105445161 162
314 3300025932 Ga0207690_10924208 Ga0207690_109242081 162
315 3300025933 Ga0207706_10007504 Ga0207706_100075044 162
316 3300025942 Ga0207689_10474581 Ga0207689_104745811 162
317 3300025944 Ga0207661_10083922 Ga0207661_100839222 162
318 3300025945 Ga0207679_10033771 Ga0207679_100337713 162
319 3300025949 Ga0207667_10009515 Ga0207667_100095159 162
320 3300025949 Ga0207667_11116782 Ga0207667_111167821 162
321 3300025960 Ga0207651_10069166 Ga0207651_100691662 162
322 3300025981 Ga0207640_10128591 Ga0207640_101285912 162
323 3300025986 Ga0207658_10854346 Ga0207658_108543461 162
324 3300026041 Ga0207639_10032669 Ga0207639_100326694 162
325 3300026041 Ga0207639_10278340 Ga0207639_102783401 162
326 3300026078 Ga0207702_10099342 Ga0207702_100993422 162
327 3300026078 Ga0207702_10156386 Ga0207702_101563862 162
328 3300026089 Ga0207648_10021754 Ga0207648_100217542 162
329 3300026089 Ga0207648_10861740 Ga0207648_108617401 162
330 3300026095 Ga0207676_10717891 Ga0207676_107178911 162
331 3300026095 Ga0207676_11095542 Ga0207676_110955421 162
332 3300026116 Ga0207674_10004689 Ga0207674_100046893 162
333 3300026116 Ga0207674_10029388 Ga0207674_100293883 162
334 3300026118 Ga0207675_100759727 Ga0207675_1007597271 162
335 3300026121 Ga0207683_10291555 Ga0207683_102915552 162
336 3300026142 Ga0207698_10001608 Ga0207698_100016084 162
337 3300026142 Ga0207698_10063846 Ga0207698_100638463 162
338 3300026142 Ga0207698_10064831 Ga0207698_100648313 162
339 3300028381 Ga0268264_10000052 Ga0268264_10000052161 162
340 3300028786 Ga0307517_10133681 Ga0307517_101336812 162
341 3300030521 Ga0307511_10001606 Ga0307511_100016062 162
342 3300031456 Ga0307513_10028247 Ga0307513_100282476 162
343 3300031730 Ga0307516_10001143 Ga0307516_100011438 162
344 3300031901 Ga0307406_10068183 Ga0307406_100681832 162
345 3300031903 Ga0307407_10261945 Ga0307407_102619452 162
346 3300032002 Ga0307416_100022237 Ga0307416_1000222374 162
347 3300032002 Ga0307416_101898748 Ga0307416_1018987481 162
348 3300032126 Ga0307415_100059941 Ga0307415_1000599413 162
349 3300037418 Ga0395900_0473941 Ga0395900_0473941_404_937 162
350 3300041997 Ga0439431_0002975 Ga0439431_0002975_2388_2963 162
351 3300042004 Ga0439445_0002757 Ga0439445_0002757_1057_1632 162
352 3300044712 Ga0453684_0030904 Ga0453684_0030904_5404_5973 162
353 3300044842 Ga0466957_0225471 Ga0466957_0225471_495_1070 162
354 3300044842 Ga0466957_0649260 Ga0466957_0649260_187_717 162
355 3300045049 Ga0466959_0123511 Ga0466959_0123511_947_1516 162
356 3300045051 Ga0451576_0857981 Ga0451576_0857981_11_580 162
357 3300045976 Ga0466967_0112998 Ga0466967_0112998_1748_2314 162
358 3300045976 Ga0466967_0694321 Ga0466967_0694321_197_778 162
359 3300046460 Ga0495638_0049942 Ga0495638_0049942_706_1296 162
360 3300046524 Ga0495648_0003458 Ga0495648_0003458_9090_9680 162
361 3300049522 Ga0501299_036102 Ga0501299_036102_171_758 162
362 3300049571 Ga0501034_0692804 Ga0501034_0692804_163_732 162
363 3300049586 Ga0501070_0776838 Ga0501070_0776838_167_724 162
364 3300049652 Ga0501202_010986 Ga0501202_010986_486_1061 162
365 3300049652 Ga0501202_036121 Ga0501202_036121_276_845 162
366 3300049674 Ga0501242_021935 Ga0501242_021935_66_635 162
367 3300049677 Ga0501247_006031 Ga0501247_006031_560_1129 162
368 3300049677 Ga0501247_018730 Ga0501247_018730_267_842 162
369 3300049681 Ga0501251_048391 Ga0501251_048391_50_619 162
370 3300049686 Ga0501257_004349 Ga0501257_004349_2077_2646 162
371 3300049686 Ga0501257_079167 Ga0501257_079167_165_752 162
372 3300049704 Ga0501221_038659 Ga0501221_038659_416_985 162
373 3300049705 Ga0501225_0010429 Ga0501225_0010429_812_1387 162
374 3300049763 Ga0501266_005724 Ga0501266_005724_141_710 162
375 3300053088 Ga0500644_0270397 Ga0500644_0270397_76_666 162
376 3300053090 Ga0500646_0001881 Ga0500646_0001881_2246_2830 162
377 3300053092 Ga0500583_0000031 Ga0500583_0000031_12984_13586 162
378 3300053092 Ga0500583_0053552 Ga0500583_0053552_500_1090 162
379 3300053133 Ga0500655_008622 Ga0500655_008622_828_1415 162
380 3300053148 Ga0500590_215947 Ga0500590_215947_195_782 162
381 3300053156 Ga0500622_0076226 Ga0500622_0076226_653_1243 162
382 3300001979 JGI24740J21852_10004081 JGI24740J21852_100040812 163
383 3300002738 JGI25154J39366_1000008 JGI25154J39366_1000008224 163
384 3300002739 JGI25158J39367_1011892 JGI25158J39367_10118922 163
385 3300003215 JGI25153J46596_10001413 JGI25153J46596_100014134 163
386 3300003320 rootH2_10030144 rootH2_100301445 163
387 3300003323 rootH1_10038549 rootH1_100385492 163
388 3300003323 rootH1_10111962 rootH1_101119622 163
389 3300003323 rootH1_10116642 rootH1_101166422 163
390 3300003354 JGI25160J50197_1002257 JGI25160J50197_10022575 163
391 3300005262 Ga0065165_1014717 Ga0065165_10147172 163
392 3300005329 Ga0070683_100282182 Ga0070683_1002821822 163
393 3300005331 Ga0070670_100073261 Ga0070670_1000732612 163
394 3300005334 Ga0068869_100119957 Ga0068869_1001199573 163
395 3300005354 Ga0070675_100286548 Ga0070675_1002865482 163
396 3300005355 Ga0070671_100021409 Ga0070671_1000214095 163
397 3300005364 Ga0070673_100451779 Ga0070673_1004517792 163
398 3300005458 Ga0070681_10513000 Ga0070681_105130002 163
399 3300005535 Ga0070684_100108792 Ga0070684_1001087924 163
400 3300005564 Ga0070664_100465328 Ga0070664_1004653282 163
401 3300005615 Ga0070702_100459596 Ga0070702_1004595962 163
402 3300005618 Ga0068864_100630090 Ga0068864_1006300901 163
403 3300006844 Ga0075428_100386762 Ga0075428_1003867622 163
404 3300006847 Ga0075431_100044659 Ga0075431_1000446593 163
405 3300006880 Ga0075429_100058362 Ga0075429_1000583622 163
406 3300009147 Ga0114129_10068767 Ga0114129_100687673 163
407 3300009545 Ga0105237_10272495 Ga0105237_102724952 163
408 3300010375 Ga0105239_10519656 Ga0105239_105196562 163
409 3300013100 Ga0157373_10185581 Ga0157373_101855812 163
410 3300013102 Ga0157371_10014609 Ga0157371_100146091 163
411 3300013102 Ga0157371_10061853 Ga0157371_100618532 163
412 3300013104 Ga0157370_10287782 Ga0157370_102877822 163
413 3300013296 Ga0157374_10027788 Ga0157374_100277886 163
414 3300013307 Ga0157372_10067003 Ga0157372_100670033 163
415 3300013307 Ga0157372_10081466 Ga0157372_100814662 163
416 3300013307 Ga0157372_10144970 Ga0157372_101449704 163
417 3300013307 Ga0157372_10702449 Ga0157372_107024492 163
418 3300013307 Ga0157372_11334515 Ga0157372_113345151 163
419 3300014325 Ga0163163_10013034 Ga0163163_100130346 163
420 3300025208 Ga0209436_104011 Ga0209436_1040112 163
421 3300025246 Ga0209646_1000045 Ga0209646_1000045224 163
422 3300025250 Ga0209026_1000075 Ga0209026_10000759 163
423 3300025284 Ga0209130_1000915 Ga0209130_100091515 163
424 3300025297 Ga0209758_1005408 Ga0209758_10054086 163
425 3300025302 Ga0207426_1000073 Ga0207426_1000073273 163
426 3300025302 Ga0207426_1000236 Ga0207426_100023625 163
427 3300025920 Ga0207649_10207145 Ga0207649_102071452 163
428 3300025925 Ga0207650_10001164 Ga0207650_100011647 163
429 3300025925 Ga0207650_10109201 Ga0207650_101092013 163
430 3300025925 Ga0207650_10363660 Ga0207650_103636602 163
431 3300025940 Ga0207691_10342950 Ga0207691_103429502 163
432 3300025942 Ga0207689_10203970 Ga0207689_102039701 163
433 3300026116 Ga0207674_10415741 Ga0207674_104157412 163
434 3300026116 Ga0207674_10717172 Ga0207674_107171722 163
435 3300026118 Ga0207675_100194783 Ga0207675_1001947832 163
436 3300031251 Ga0265327_10000054 Ga0265327_10000054174 163
437 3300031251 Ga0265327_10063702 Ga0265327_100637021 163
438 3300031507 Ga0307509_10390766 Ga0307509_103907662 163
439 3300032004 Ga0307414_10562331 Ga0307414_105623312 163
440 3300038443 Ga0395901_1318307 Ga0395901_1318307_100_666 163
441 3300047320 Ga0495672_0085000 Ga0495672_0085000_1146_1724 163
442 3300049703 Ga0501219_001135 Ga0501219_001135_2267_2830 163
443 3300049758 Ga0501241_002792 Ga0501241_002792_1526_2089 163
444 3300050005 Ga0501284_00048 Ga0501284_00048_18613_19176 163
445 3300050507 nmdc:mga05p37_226138_c1 nmdc:mga05p37_226138_c1_1317_1886 163
446 3300053131 Ga0500652_007986 Ga0500652_007986_2648_3262 163
447 3300053131 Ga0500652_091507 Ga0500652_091507_168_743 163
448 3300053139 Ga0500568_0016814 Ga0500568_0016814_934_1509 163
449 3300053177 Ga0500636_0034813 Ga0500636_0034813_36_629 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07929

PRiA4_ORF3

Plasmid pRiA4b ORF-3-like protein

2

142

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i1s-assembly2.cif.gz_B crystal structure of protein of unknown function mm3350 from methanosarcina mazei go1 0.8618 2 129
2i1s-assembly1.cif.gz_A crystal structure of protein of unknown function mm3350 from methanosarcina mazei go1 0.856 2 134
6fno-assembly2.cif.gz_D caldiarchaeum subterraneum ubiquitin:rpn11-homolog complex, zinc soak 0.7506 19 98
6hyl-assembly2.cif.gz_B structure of pcm1 lir motif bound to gabarap 0.734 19 84
3pv1-assembly1.cif.gz_B crystal structure of the usp15 dusp-ubl domains 0.7203 17 104
ID Description Score Start End Superfamily
2i1sA00 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;MM3350-like 0.856 2 134 3.10.290.30
af_A0A1D6P3J9_634_711_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.7816 17 92 3.10.20.90
af_Q7ZVI8_1_79_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.7468 17 55 3.10.20.90
af_A0A0A1EI90_1200_1299_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.742 17 59 3.10.20.90
af_Q4D4W4_8_98_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.719 3 47 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A519UBL2-F1-model_v4 Plasmid pRiA4b Orf3-like domain-containing protein 0.9833 1 105
AF-A0A257L6N2-F1-model_v4 Plasmid pRiA4b Orf3-like domain-containing protein 0.9682 2 137
AF-A0A4Q3WA00-F1-model_v4 Plasmid pRiA4b Orf3-like domain-containing protein 0.9654 1 119
AF-A0A519UBL2-F1-model_v4 Plasmid pRiA4b Orf3-like domain-containing protein 0.9651 1 105
AF-A0A4Q5QV42-F1-model_v4 Plasmid pRiA4b Orf3-like domain-containing protein 0.9627 1 147

Feature Viewer

pLDDT pTM Quality
87.87 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map