F446334

General Info

Members Datasets Scaffolds Average Seq Length
449 210 898 311

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100218229|Ga0068855_1002182292
Length 361
Sequence MEAAHQNRKGEAHDAPILLTWQLLASPGVPPAVPRAGLRFEVAVVQRYIIRRLLLMIPTLIGVTFIVFILVRSVPGNVVDLISGDYGSMDPKAKAALQKDLGLDQNVAKQYVEWLGKIVRFDFGDSILSSRSVNSELSHRIPITIELGVLAIIISLVIALPIGVISAVRQDSAADYIGRSFAIGLLAAPSFWIAIMLITLASRYFLWGVPPNKYVNFSDDPISNLKFMFVPAFLLGAALAGGVMRFARSSMLEVLRQDYIRTAWSKGLRERVIVVRHGMRNGLIPVITVVGLQLPILVGGSVIIEQIYNIPGMGRYYITAINQHDYPVIQAINIIIALVVVFSNLAVDLLYGVIDPRIRYS

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
132 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
141 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
142 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
153 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
154 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
155 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
167 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
186 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
187 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
203 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
210 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.44
Metatranscriptomes 1.11
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.11
Rhizosphere 98.44
Stem 0
Stem Tuber 0
Unclassified 2.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100218229 3300005563 Bacteria 2140
2 Ga0058862_10142684 3300004803 Unclassified 2105
3 Ga0058862_12844052 3300004803 Bacteria 1948
4 Ga0065715_10094132 3300005293 Bacteria 4433
5 Ga0070676_10000611 3300005328 Bacteria 17407
6 Ga0070690_100013807 3300005330 Bacteria 4784
7 Ga0070690_100265190 3300005330 Bacteria 1220
8 Ga0070670_100011208 3300005331 Bacteria 7662
9 Ga0068869_100000834 3300005334 Bacteria 17598
10 Ga0070680_100002516 3300005336 Bacteria 13584
11 Ga0070680_100124252 3300005336 Bacteria 2155
12 Ga0070680_100162487 3300005336 Bacteria 1877
13 Ga0070682_100000818 3300005337 Bacteria 18170
14 Ga0070660_100001132 3300005339 Bacteria 17980
15 Ga0070691_10002053 3300005341 Bacteria 8886
16 Ga0070661_100003333 3300005344 Bacteria 11089
17 Ga0070692_10001923 3300005345 Bacteria 7848
18 Ga0070692_10061577 3300005345 Bacteria 1979
19 Ga0070669_100036070 3300005353 Bacteria 3582
20 Ga0070669_100180487 3300005353 Bacteria 1651
21 Ga0070673_100248558 3300005364 Bacteria 1549
22 Ga0070659_100000668 3300005366 Bacteria 24945
23 Ga0070667_100061479 3300005367 Bacteria 3180
24 Ga0070703_10000703 3300005406 Bacteria 11325
25 Ga0070705_100001703 3300005440 Bacteria 11465
26 Ga0070705_100066086 3300005440 Bacteria 2168
27 Ga0070705_100176673 3300005440 Bacteria 1442
28 Ga0070694_100009005 3300005444 Bacteria 6115
29 Ga0070694_100036190 3300005444 Unclassified 3269
30 Ga0070694_100062491 3300005444 Bacteria 2544
31 Ga0070694_100085863 3300005444 Bacteria 2198
32 Ga0070708_100032935 3300005445 Bacteria 4499
33 Ga0070708_100067809 3300005445 Bacteria 3205
34 Ga0070708_100120719 3300005445 Bacteria 2418
35 Ga0070708_100132175 3300005445 Bacteria 2310
36 Ga0070663_100001543 3300005455 Bacteria 12691
37 Ga0070663_100032466 3300005455 Bacteria 3599
38 Ga0070662_100002533 3300005457 Bacteria 11266
39 Ga0070681_10015046 3300005458 Bacteria 7696
40 Ga0070681_10060641 3300005458 Bacteria 3758
41 Ga0070681_10093452 3300005458 Bacteria 2956
42 Ga0070681_10332019 3300005458 Bacteria 1430
43 Ga0068867_100001892 3300005459 Bacteria 14568
44 Ga0070706_100005900 3300005467 Bacteria 11604
45 Ga0070706_100008058 3300005467 Bacteria 9828
46 Ga0070706_100014038 3300005467 Bacteria 7401
47 Ga0070706_100018004 3300005467 Bacteria 6516
48 Ga0070707_100001333 3300005468 Bacteria 24321
49 Ga0070707_100010963 3300005468 Bacteria 8443
50 Ga0070707_100022863 3300005468 Bacteria 5911
51 Ga0070707_100257810 3300005468 Bacteria 1697
52 Ga0070707_100313498 3300005468 Bacteria 1524
53 Ga0070698_100007194 3300005471 Bacteria 12056
54 Ga0070698_100031886 3300005471 Bacteria 5462
55 Ga0070698_100072192 3300005471 Bacteria 3460
56 Ga0070698_100077734 3300005471 Bacteria 3317
57 Ga0070699_100001489 3300005518 Bacteria 21469
58 Ga0070699_100022981 3300005518 Bacteria 5371
59 Ga0070699_100025729 3300005518 Bacteria 5072
60 Ga0070699_100116680 3300005518 Bacteria 2346
61 Ga0070699_100235150 3300005518 Bacteria 1634
62 Ga0070679_100010073 3300005530 Bacteria 8956
63 Ga0070679_100085807 3300005530 Bacteria 3135
64 Ga0070679_100120224 3300005530 Bacteria 2612
65 Ga0070697_100013927 3300005536 Bacteria 6314
66 Ga0070697_100014327 3300005536 Bacteria 6230
67 Ga0070697_100069919 3300005536 Bacteria 2877
68 Ga0070697_100327522 3300005536 Bacteria 1320
69 Ga0070697_100346989 3300005536 Bacteria 1282
70 Ga0070697_100497667 3300005536 Bacteria 1065
71 Ga0070686_100034151 3300005544 Bacteria 3131
72 Ga0070695_100000648 3300005545 Bacteria 18479
73 Ga0070695_100005717 3300005545 Bacteria 7329
74 Ga0070695_100031243 3300005545 Bacteria 3320
75 Ga0070695_100050482 3300005545 Bacteria 2666
76 Ga0070693_100000721 3300005547 Bacteria 14564
77 Ga0070693_100182672 3300005547 Bacteria 1351
78 Ga0070704_100000627 3300005549 Bacteria 17041
79 Ga0070704_100010843 3300005549 Bacteria 5559
80 Ga0070704_100042209 3300005549 Bacteria 3154
81 Ga0070704_100090617 3300005549 Bacteria 2278
82 Ga0070704_100092971 3300005549 Bacteria 2253
83 Ga0068855_100003040 3300005563 Bacteria 20547
84 Ga0068855_100031563 3300005563 Bacteria 6327
85 Ga0070664_100020572 3300005564 Bacteria 5434
86 Ga0068857_100074769 3300005577 Bacteria 3020
87 Ga0068857_100293821 3300005577 Bacteria 1497
88 Ga0068854_100027312 3300005578 Bacteria 3933
89 Ga0068856_100011366 3300005614 Bacteria 8636
90 Ga0070702_100099487 3300005615 Bacteria 1781
91 Ga0068859_100013090 3300005617 Bacteria 8335
92 Ga0068859_100050899 3300005617 Bacteria 4162
93 Ga0068864_100040871 3300005618 Bacteria 3965
94 Ga0068861_100006413 3300005719 Bacteria 8011
95 Ga0068870_10000531 3300005840 Bacteria 14369
96 Ga0068863_100049431 3300005841 Bacteria 3988
97 Ga0068863_100073779 3300005841 Bacteria 3228
98 Ga0068863_100296485 3300005841 Bacteria 1568
99 Ga0068858_100268865 3300005842 Bacteria 1622
100 Ga0068860_100004831 3300005843 Bacteria 13725
101 Ga0068860_100017949 3300005843 Bacteria 6891
102 Ga0068860_100146324 3300005843 Bacteria 2274
103 Ga0068862_100002320 3300005844 Bacteria 16989
104 Ga0068862_100002566 3300005844 Bacteria 16051
105 Ga0081455_10000083 3300005937 Bacteria 102126
106 Ga0081455_10030132 3300005937 Bacteria 4935
107 Ga0081540_1009784 3300005983 Bacteria 6563
108 Ga0070712_100001858 3300006175 Bacteria 12859
109 Ga0075428_100033616 3300006844 Bacteria 5660
110 Ga0075428_100048447 3300006844 Bacteria 4664
111 Ga0075428_100134356 3300006844 Bacteria 2690
112 Ga0075428_100485203 3300006844 Bacteria 1323
113 Ga0075430_100000272 3300006846 Bacteria 36618
114 Ga0075430_100230694 3300006846 Bacteria 1535
115 Ga0075431_100000358 3300006847 Bacteria 36176
116 Ga0075431_100141221 3300006847 Bacteria 2482
117 Ga0075431_100267404 3300006847 Bacteria 1734
118 Ga0075431_100288360 3300006847 Bacteria 1661
119 Ga0075433_10000176 3300006852 Bacteria 35427
120 Ga0075433_10000275 3300006852 Bacteria 30321
121 Ga0075433_10013366 3300006852 Bacteria 6672
122 Ga0075433_10150477 3300006852 Bacteria 2070
123 Ga0075434_100009602 3300006871 Bacteria 9033
124 Ga0075434_100014028 3300006871 Bacteria 7649
125 Ga0075434_100048955 3300006871 Bacteria 4194
126 Ga0075434_100050930 3300006871 Bacteria 4113
127 Ga0075434_100059382 3300006871 Bacteria 3802
128 Ga0075434_100089401 3300006871 Bacteria 3081
129 Ga0075434_100235415 3300006871 Bacteria 1851
130 Ga0075429_100001010 3300006880 Bacteria 22416
131 Ga0075429_100136766 3300006880 Bacteria 2144
132 Ga0075436_100018655 3300006914 Bacteria 4749
133 Ga0075436_100082674 3300006914 Bacteria 2227
134 Ga0075436_100092801 3300006914 Bacteria 2099
135 Ga0097620_100013091 3300006931 Bacteria 8335
136 Ga0097620_100050899 3300006931 Bacteria 4162
137 Ga0097620_100052610 3300006931 Bacteria 4094
138 Ga0075435_100003330 3300007076 Bacteria 10901
139 Ga0075435_100005484 3300007076 Bacteria 8866
140 Ga0075435_100012491 3300007076 Bacteria 6292
141 Ga0075435_100014458 3300007076 Bacteria 5899
142 Ga0075435_100023606 3300007076 Bacteria 4759
143 Ga0075435_100306569 3300007076 Bacteria 1358
144 Ga0099794_10004096 3300007265 Bacteria 5674
145 Ga0099794_10065288 3300007265 Bacteria 1775
146 Ga0105240_10010121 3300009093 Bacteria 13272
147 Ga0105240_10018550 3300009093 Bacteria 9339
148 Ga0105240_10135860 3300009093 Bacteria 2945
149 Ga0111539_10000485 3300009094 Bacteria 50343
150 Ga0114129_10005493 3300009147 Bacteria 17919
151 Ga0114129_10006975 3300009147 Bacteria 16076
152 Ga0114129_10023138 3300009147 Bacteria 8813
153 Ga0114129_10056335 3300009147 Bacteria 5506
154 Ga0114129_10130795 3300009147 Bacteria 3447
155 Ga0114129_10160201 3300009147 Bacteria 3075
156 Ga0114129_10161771 3300009147 Bacteria 3057
157 Ga0114129_10184495 3300009147 Bacteria 2836
158 Ga0114129_10186231 3300009147 Bacteria 2821
159 Ga0114129_10337853 3300009147 Bacteria 1998
160 Ga0105241_10000477 3300009174 Bacteria 30210
161 Ga0105237_10110708 3300009545 Bacteria 2738
162 Ga0105249_10019842 3300009553 Bacteria 6002
163 Ga0105249_10030053 3300009553 Bacteria 4908
164 Ga0105249_10183576 3300009553 Bacteria 2037
165 Ga0157373_10000467 3300013100 Bacteria 32139
166 Ga0157369_10225313 3300013105 Bacteria 1961
167 Ga0157372_10001975 3300013307 Bacteria 22276
168 Ga0157372_10134322 3300013307 Bacteria 2849
169 Ga0157375_10073974 3300013308 Bacteria 3427
170 Ga0157380_10122705 3300014326 Bacteria 2203
171 Ga0207653_10001661 3300025885 Bacteria 7135
172 Ga0207688_10011484 3300025901 Bacteria 4821
173 Ga0207647_10039788 3300025904 Bacteria 2964
174 Ga0207645_10001435 3300025907 Bacteria 19521
175 Ga0207643_10000783 3300025908 Bacteria 19372
176 Ga0207684_10003128 3300025910 Bacteria 16305
177 Ga0207684_10009144 3300025910 Bacteria 8769
178 Ga0207684_10012736 3300025910 Bacteria 7296
179 Ga0207684_10013317 3300025910 Bacteria 7115
180 Ga0207684_10027577 3300025910 Bacteria 4837
181 Ga0207684_10034676 3300025910 Bacteria 4287
182 Ga0207684_10045968 3300025910 Bacteria 3704
183 Ga0207684_10104670 3300025910 Bacteria 2420
184 Ga0207654_10005056 3300025911 Bacteria 6652
185 Ga0207707_10000223 3300025912 Bacteria 61090
186 Ga0207707_10029774 3300025912 Bacteria 4775
187 Ga0207707_10035473 3300025912 Bacteria 4362
188 Ga0207707_10158967 3300025912 Bacteria 1976
189 Ga0207695_10148657 3300025913 Bacteria 2284
190 Ga0207671_10120840 3300025914 Bacteria 2002
191 Ga0207693_10011683 3300025915 Bacteria 7104
192 Ga0207660_10000290 3300025917 Bacteria 33221
193 Ga0207660_10096727 3300025917 Bacteria 2199
194 Ga0207660_10142073 3300025917 Bacteria 1836
195 Ga0207660_10165076 3300025917 Bacteria 1711
196 Ga0207657_10000041 3300025919 Bacteria 118810
197 Ga0207652_10000760 3300025921 Bacteria 30993
198 Ga0207652_10190461 3300025921 Bacteria 1845
199 Ga0207646_10002946 3300025922 Bacteria 19730
200 Ga0207646_10020092 3300025922 Bacteria 6194
201 Ga0207646_10020609 3300025922 Bacteria 6107
202 Ga0207646_10029002 3300025922 Bacteria 5033
203 Ga0207646_10100990 3300025922 Bacteria 2586
204 Ga0207646_10260159 3300025922 Bacteria 1568
205 Ga0207681_10022155 3300025923 Bacteria 4048
206 Ga0207690_10000838 3300025932 Bacteria 19690
207 Ga0207706_10001136 3300025933 Bacteria 27091
208 Ga0207706_10188140 3300025933 Bacteria 1812
209 Ga0207670_10005951 3300025936 Bacteria 6732
210 Ga0207711_10054620 3300025941 Bacteria 3428
211 Ga0207689_10000112 3300025942 Bacteria 67234
212 Ga0207679_10000516 3300025945 Bacteria 26348
213 Ga0207667_10001770 3300025949 Bacteria 27188
214 Ga0207667_10341890 3300025949 Bacteria 1527
215 Ga0207651_10015848 3300025960 Bacteria 4395
216 Ga0207712_10027559 3300025961 Bacteria 3795
217 Ga0207712_10395856 3300025961 Bacteria 1160
218 Ga0207640_10161272 3300025981 Bacteria 1659
219 Ga0207658_10060533 3300025986 Bacteria 2826
220 Ga0207703_10223795 3300026035 Bacteria 1684
221 Ga0207639_10004573 3300026041 Bacteria 9312
222 Ga0207678_10001652 3300026067 Bacteria 20435
223 Ga0207678_10049322 3300026067 Bacteria 3639
224 Ga0207708_10021564 3300026075 Bacteria 4859
225 Ga0207702_10000767 3300026078 Bacteria 34082
226 Ga0207641_10037332 3300026088 Bacteria 4057
227 Ga0207641_10227406 3300026088 Bacteria 1732
228 Ga0207641_10394723 3300026088 Bacteria 1327
229 Ga0207648_10009591 3300026089 Bacteria 9261
230 Ga0207676_10060150 3300026095 Bacteria 3003
231 Ga0207676_10089605 3300026095 Bacteria 2522
232 Ga0207674_10004752 3300026116 Bacteria 16286
233 Ga0207674_10021398 3300026116 Bacteria 6963
234 Ga0207675_100012212 3300026118 Bacteria 8023
235 Ga0209981_1002140 3300027378 Bacteria 2514
236 Ga0210000_1007064 3300027462 Bacteria 1640
237 Ga0209995_1003156 3300027471 Bacteria 2619
238 Ga0209968_1001111 3300027526 Bacteria 4102
239 Ga0209999_1000653 3300027543 Bacteria 5564
240 Ga0210002_1008543 3300027617 Bacteria 1560
241 Ga0209983_1000902 3300027665 Bacteria 6526
242 Ga0209588_1008125 3300027671 Bacteria 3105
243 Ga0209971_1000031 3300027682 Bacteria 50315
244 Ga0209966_1000566 3300027695 Bacteria 9168
245 Ga0209998_10000024 3300027717 Bacteria 64123
246 Ga0209974_10002756 3300027876 Bacteria 6373
247 Ga0207428_10000068 3300027907 Bacteria 150215
248 Ga0268265_10006323 3300028380 Bacteria 8027
249 Ga0265326_10017591 3300028558 Bacteria 2061
250 Ga0265338_10000030 3300028800 Bacteria 260974
251 Ga0265324_10022143 3300029957 Bacteria 2274
252 Ga0265330_10038450 3300031235 Unclassified 2128
253 Ga0265331_10107239 3300031250 Bacteria 1282
254 Ga0265316_10031147 3300031344 Bacteria 4364
255 Ga0265316_10044997 3300031344 Bacteria 3507
256 Ga0265316_10049578 3300031344 Unclassified 3307
257 Ga0265316_10049857 3300031344 Bacteria 3296
258 Ga0265316_10109931 3300031344 Bacteria 2088
259 Ga0307408_100175602 3300031548 Bacteria 1714
260 Ga0316575_10041653 3300031665 Bacteria 1817
261 Ga0316579_10012548 3300031691 Bacteria 3628
262 Ga0316576_10029534 3300031727 Bacteria 3877
263 Ga0316578_10016976 3300031728 Bacteria 3952
264 Ga0307416_100022714 3300032002 Bacteria 4535
265 Ga0307415_100001108 3300032126 Bacteria 12563
266 Ga0373959_0008333 3300034820 Bacteria 1762
267 Ga0373940_0006432 3300035088 Bacteria 2605
268 Ga0373940_0010488 3300035088 Bacteria 2179
269 Ga0373949_0003289 3300035090 Bacteria 3884
270 Ga0373951_0005302 3300035091 Bacteria 3001
271 Ga0373952_0033221 3300035092 Bacteria 1157
272 Ga0373942_0011185 3300035207 Bacteria 2124
273 Ga0373961_0008143 3300035241 Bacteria 2547
274 Ga0316574_0002046 3300035398 Bacteria 9958
275 Ga0316582_0186623 3300036647 Bacteria 1412
276 Ga0316584_0002434 3300036712 Bacteria 11775
277 Ga0395900_0002231 3300037418 Bacteria 21601
278 Ga0395898_0003016 3300037466 Bacteria 19099
279 Ga0395901_0001014 3300038443 Bacteria 30390
280 Ga0400489_38905 3300039093 Bacteria 3446
281 Ga0439448_0011629 3300042005 Bacteria 2624
282 Ga0439455_0001027 3300042012 Bacteria 4405
283 Ga0439458_0018670 3300042157 Bacteria 1590
284 Ga0439464_0001974 3300042439 Bacteria 4968
285 Ga0439460_0000326 3300042461 Bacteria 10035
286 Ga0451577_0022443 3300042876 Bacteria 5762
287 Ga0451577_0070791 3300042876 Bacteria 3110
288 Ga0453683_0009988 3300044673 Bacteria 6315
289 Ga0453683_0022123 3300044673 Bacteria 4057
290 Ga0453683_0030904 3300044673 Bacteria 3384
291 Ga0453683_0205149 3300044673 Bacteria 1252
292 Ga0453684_0105038 3300044712 Bacteria 3446
293 Ga0453684_0133015 3300044712 Bacteria 2982
294 Ga0453684_0558703 3300044712 Bacteria 1260
295 Ga0451576_0004199 3300045051 Bacteria 18950
296 Ga0451576_0040499 3300045051 Bacteria 4930
297 Ga0451576_0070612 3300045051 Bacteria 3635
298 Ga0451576_0235921 3300045051 Bacteria 1910
299 Ga0495580_0000018 3300046472 Bacteria 92458
300 Ga0495580_0045680 3300046472 Bacteria 3110
301 Ga0495580_0072407 3300046472 Bacteria 2407
302 Ga0495659_0033930 3300046664 Bacteria 1793
303 Ga0496102_0013413 3300048905 Bacteria 7097
304 Ga0496102_0029996 3300048905 Bacteria 4867
305 Ga0496109_0087065 3300048912 Bacteria 2885
306 Ga0496110_0112576 3300048913 Bacteria 2447
307 Ga0496112_0058495 3300048915 Bacteria 3796
308 Ga0496116_0001499 3300048919 Bacteria 25999
309 Ga0501298_020232 3300049521 Unclassified 1239
310 Ga0501033_0112093 3300049570 Bacteria 1985
311 Ga0501033_0226071 3300049570 Bacteria 1331
312 Ga0501037_0068666 3300049573 Bacteria 2581
313 Ga0501039_0011397 3300049575 Bacteria 6769
314 Ga0501039_0187791 3300049575 Bacteria 1625
315 Ga0501039_0373086 3300049575 Bacteria 1121
316 Ga0501040_0010208 3300049576 Bacteria 6141
317 Ga0501040_0154618 3300049576 Bacteria 1620
318 Ga0501040_0369205 3300049576 Bacteria 1029
319 Ga0501041_0006780 3300049577 Bacteria 6712
320 Ga0501041_0019056 3300049577 Bacteria 4091
321 Ga0501041_0186824 3300049577 Bacteria 1298
322 Ga0501041_0195974 3300049577 Bacteria 1266
323 Ga0501042_0048413 3300049578 Bacteria 3031
324 Ga0501042_0065281 3300049578 Bacteria 2601
325 Ga0501042_0299276 3300049578 Bacteria 1162
326 Ga0501043_0108796 3300049579 Bacteria 2177
327 Ga0501043_0162641 3300049579 Bacteria 1744
328 Ga0501043_0373616 3300049579 Bacteria 1080
329 Ga0501046_0009997 3300049580 Bacteria 8172
330 Ga0501046_0057816 3300049580 Bacteria 3042
331 Ga0501046_0085926 3300049580 Bacteria 2425
332 Ga0501046_0113125 3300049580 Bacteria 2072
333 Ga0501046_0136320 3300049580 Bacteria 1859
334 Ga0501048_0009176 3300049582 Bacteria 7436
335 Ga0501068_0070786 3300049584 Bacteria 2128
336 Ga0501068_0077854 3300049584 Bacteria 2031
337 Ga0501071_0055529 3300049587 Bacteria 2859
338 Ga0501072_0001695 3300049588 Bacteria 16416
339 Ga0501072_0125458 3300049588 Bacteria 2045
340 Ga0501072_0156968 3300049588 Bacteria 1814
341 Ga0501073_0179419 3300049589 Bacteria 1466
342 Ga0501074_0005819 3300049590 Bacteria 8891
343 Ga0501074_0019760 3300049590 Bacteria 4893
344 Ga0501074_0074077 3300049590 Bacteria 2445
345 Ga0501075_0014009 3300049591 Bacteria 5739
346 Ga0501075_0048479 3300049591 Bacteria 3192
347 Ga0501075_0074513 3300049591 Bacteria 2567
348 Ga0501076_0007845 3300049592 Bacteria 7779
349 Ga0501076_0010713 3300049592 Bacteria 6815
350 Ga0501076_0023390 3300049592 Bacteria 4763
351 Ga0501076_0043746 3300049592 Bacteria 3530
352 Ga0501076_0154148 3300049592 Bacteria 1869
353 Ga0501076_0356607 3300049592 Bacteria 1201
354 Ga0501077_0023462 3300049593 Bacteria 3913
355 Ga0501077_0038867 3300049593 Bacteria 3030
356 Ga0501077_0038958 3300049593 Bacteria 3027
357 Ga0501077_0078569 3300049593 Bacteria 2091
358 Ga0501217_015161 3300049661 Unclassified 1752
359 Ga0501221_044275 3300049704 Unclassified 982
360 Ga0501234_009867 3300049707 Unclassified 1490
361 Ga0501079_0000976 3300049741 Bacteria 19702
362 Ga0501079_0008038 3300049741 Bacteria 7993
363 Ga0501079_0049731 3300049741 Bacteria 3236
364 Ga0501079_0115972 3300049741 Bacteria 2082
365 Ga0501079_0127573 3300049741 Bacteria 1979
366 Ga0501079_0146132 3300049741 Bacteria 1842
367 Ga0501079_0172529 3300049741 Bacteria 1686
368 Ga0501081_0000568 3300049743 Bacteria 21026
369 Ga0501081_0000736 3300049743 Bacteria 19096
370 Ga0501081_0002200 3300049743 Bacteria 12263
371 Ga0501081_0037418 3300049743 Bacteria 3310
372 Ga0501081_0054320 3300049743 Bacteria 2768
373 Ga0501083_0157973 3300049744 Bacteria 1484
374 Ga0501045_0001094 3300049824 Bacteria 17919
375 Ga0501045_0052743 3300049824 Bacteria 2970
376 Ga0501045_0114396 3300049824 Bacteria 2001
377 Ga0501045_0242539 3300049824 Bacteria 1341
378 nmdc:mga05p37_156864_c1 3300050507 Bacteria 2781
379 nmdc:mga05p37_204408_c1 3300050507 Bacteria 2390
380 nmdc:mga05p37_213685_c1 3300050507 Bacteria 2330
381 nmdc:mga05p37_314892_c1 3300050507 Bacteria 1854
382 nmdc:mga05p37_3715_c1 3300050507 Bacteria 17858
383 nmdc:mga05p37_390398_c1 3300050507 Bacteria 1628
384 nmdc:mga05p37_44886_c1 3300050507 Bacteria 5437
385 nmdc:mga05p37_57400_c1 3300050507 Bacteria 4795
386 nmdc:mga05p37_61704_c1 3300050507 Bacteria 4614
387 nmdc:mga05p37_677114_c1 3300050507 Bacteria 1150
388 nmdc:mga05p37_83014_c1 3300050507 Bacteria 3948
389 nmdc:mga09592_35581_c1 3300050508 Bacteria 4169
390 nmdc:mga09592_40285_c1 3300050508 Bacteria 3924
391 nmdc:mga0qj67_346_c1 3300050509 Bacteria 31896
392 nmdc:mga0qj67_78643_c1 3300050509 Bacteria 2640
393 nmdc:mga06r32_2219_c1 3300050510 Bacteria 17389
394 nmdc:mga06r32_237447_c1 3300050510 Bacteria 1810
395 nmdc:mga06r32_25552_c1 3300050510 Bacteria 5494
396 nmdc:mga06r32_426120_c1 3300050510 Bacteria 1308
397 nmdc:mga06r32_503352_c1 3300050510 Bacteria 1188
398 nmdc:mga08y16_10019_c1 3300050511 Bacteria 9947
399 nmdc:mga08y16_140006_c1 3300050511 Bacteria 2515
400 nmdc:mga08y16_285900_c1 3300050511 Unclassified 1700
401 nmdc:mga0n895_185801_c1 3300050512 Bacteria 2109
402 nmdc:mga0n895_194090_c1 3300050512 Bacteria 2062
403 nmdc:mga0n895_215360_c1 3300050512 Bacteria 1950
404 nmdc:mga0n895_234231_c1 3300050512 Bacteria 1864
405 nmdc:mga0n895_4289_c1 3300050512 Bacteria 11673
406 nmdc:mga0n895_511874_c1 3300050512 Bacteria 1208
407 nmdc:mga0n895_5800_c1 3300050512 Bacteria 10371
408 nmdc:mga0n895_94186_c1 3300050512 Bacteria 2999
409 nmdc:mga0rr50_10778_c1 3300050513 Bacteria 5825
410 nmdc:mga0rr50_109483_c1 3300050513 Bacteria 2184
411 nmdc:mga0rr50_193335_c1 3300050513 Bacteria 1669
412 nmdc:mga0rr50_4479_c1 3300050513 Bacteria 8224
413 nmdc:mga0rr50_6240_c1 3300050513 Bacteria 7228
414 nmdc:mga08x19_127067_c1 3300050514 Bacteria 1713
415 nmdc:mga08x19_133906_c1 3300050514 Bacteria 1669
416 nmdc:mga08x19_15264_c1 3300050514 Bacteria 4671
417 nmdc:mga08x19_84699_c1 3300050514 Bacteria 2086
418 nmdc:mga0a205_1485_c1 3300050515 Bacteria 20000
419 nmdc:mga0a205_176934_c1 3300050515 Bacteria 2029
420 nmdc:mga0a205_19942_c1 3300050515 Bacteria 6326
421 nmdc:mga0a205_209_c1 3300050515 Bacteria 41023
422 nmdc:mga0a205_3103_c1 3300050515 Bacteria 14736
423 nmdc:mga0a205_37189_c1 3300050515 Bacteria 4681
424 nmdc:mga0a205_540483_c1 3300050515 Unclassified 1021
425 nmdc:mga0a205_76702_c1 3300050515 Bacteria 3230
426 Ga0501084_0007413 3300054114 Bacteria 9043
427 Ga0501084_0012547 3300054114 Bacteria 7019
428 Ga0501084_0047845 3300054114 Bacteria 3581
429 Ga0501084_0062222 3300054114 Bacteria 3124
430 Ga0501084_0229178 3300054114 Bacteria 1568
431 Ga0590071_033981 3300059421 Bacteria 1219
432 Ga0590075_012671 3300059424 Bacteria 2050
433 Ga0587085_012557 3300059506 Unclassified 1164
434 Ga0587076_000400 3300059645 Bacteria 3443
435 Ga0587079_000469 3300059647 Bacteria 3567
436 Ga0501082_0001632 3300060353 Bacteria 19773
437 Ga0501082_0027600 3300060353 Bacteria 4887
438 Ga0501082_0049430 3300060353 Bacteria 3627
439 Ga0501082_0162288 3300060353 Bacteria 1942
440 Ga0501082_0202335 3300060353 Bacteria 1728
441 Ga0530510_0000468 3300061734 Bacteria 25872
442 Ga0530510_0002615 3300061734 Bacteria 12389
443 Ga0530510_0003609 3300061734 Bacteria 10654
444 Ga0530510_0030411 3300061734 Bacteria 3879
445 Ga0530510_0041921 3300061734 Bacteria 3305
446 Ga0530510_0092087 3300061734 Bacteria 2212
447 Ga0530510_0158120 3300061734 Bacteria 1676
448 2904757409 2904755435 Bacteria 7986759
449 3001896913 3001892409 Bacteria 6328293
450 Ga0068855_100218229
451 Ga0058862_10142684
452 Ga0058862_12844052
453 Ga0065715_10094132
454 Ga0070676_10000611
455 Ga0070690_100013807
456 Ga0070690_100265190
457 Ga0070670_100011208
458 Ga0068869_100000834
459 Ga0070680_100002516
460 Ga0070680_100124252
461 Ga0070680_100162487
462 Ga0070682_100000818
463 Ga0070660_100001132
464 Ga0070691_10002053
465 Ga0070661_100003333
466 Ga0070692_10001923
467 Ga0070692_10061577
468 Ga0070669_100036070
469 Ga0070669_100180487
470 Ga0070673_100248558
471 Ga0070659_100000668
472 Ga0070667_100061479
473 Ga0070703_10000703
474 Ga0070705_100001703
475 Ga0070705_100066086
476 Ga0070705_100176673
477 Ga0070694_100009005
478 Ga0070694_100036190
479 Ga0070694_100062491
480 Ga0070694_100085863
481 Ga0070708_100032935
482 Ga0070708_100067809
483 Ga0070708_100120719
484 Ga0070708_100132175
485 Ga0070663_100001543
486 Ga0070663_100032466
487 Ga0070662_100002533
488 Ga0070681_10015046
489 Ga0070681_10060641
490 Ga0070681_10093452
491 Ga0070681_10332019
492 Ga0068867_100001892
493 Ga0070706_100005900
494 Ga0070706_100008058
495 Ga0070706_100014038
496 Ga0070706_100018004
497 Ga0070707_100001333
498 Ga0070707_100010963
499 Ga0070707_100022863
500 Ga0070707_100257810
501 Ga0070707_100313498
502 Ga0070698_100007194
503 Ga0070698_100031886
504 Ga0070698_100072192
505 Ga0070698_100077734
506 Ga0070699_100001489
507 Ga0070699_100022981
508 Ga0070699_100025729
509 Ga0070699_100116680
510 Ga0070699_100235150
511 Ga0070679_100010073
512 Ga0070679_100085807
513 Ga0070679_100120224
514 Ga0070697_100013927
515 Ga0070697_100014327
516 Ga0070697_100069919
517 Ga0070697_100327522
518 Ga0070697_100346989
519 Ga0070697_100497667
520 Ga0070686_100034151
521 Ga0070695_100000648
522 Ga0070695_100005717
523 Ga0070695_100031243
524 Ga0070695_100050482
525 Ga0070693_100000721
526 Ga0070693_100182672
527 Ga0070704_100000627
528 Ga0070704_100010843
529 Ga0070704_100042209
530 Ga0070704_100090617
531 Ga0070704_100092971
532 Ga0068855_100003040
533 Ga0068855_100031563
534 Ga0070664_100020572
535 Ga0068857_100074769
536 Ga0068857_100293821
537 Ga0068854_100027312
538 Ga0068856_100011366
539 Ga0070702_100099487
540 Ga0068859_100013090
541 Ga0068859_100050899
542 Ga0068864_100040871
543 Ga0068861_100006413
544 Ga0068870_10000531
545 Ga0068863_100049431
546 Ga0068863_100073779
547 Ga0068863_100296485
548 Ga0068858_100268865
549 Ga0068860_100004831
550 Ga0068860_100017949
551 Ga0068860_100146324
552 Ga0068862_100002320
553 Ga0068862_100002566
554 Ga0081455_10000083
555 Ga0081455_10030132
556 Ga0081540_1009784
557 Ga0070712_100001858
558 Ga0075428_100033616
559 Ga0075428_100048447
560 Ga0075428_100134356
561 Ga0075428_100485203
562 Ga0075430_100000272
563 Ga0075430_100230694
564 Ga0075431_100000358
565 Ga0075431_100141221
566 Ga0075431_100267404
567 Ga0075431_100288360
568 Ga0075433_10000176
569 Ga0075433_10000275
570 Ga0075433_10013366
571 Ga0075433_10150477
572 Ga0075434_100009602
573 Ga0075434_100014028
574 Ga0075434_100048955
575 Ga0075434_100050930
576 Ga0075434_100059382
577 Ga0075434_100089401
578 Ga0075434_100235415
579 Ga0075429_100001010
580 Ga0075429_100136766
581 Ga0075436_100018655
582 Ga0075436_100082674
583 Ga0075436_100092801
584 Ga0097620_100013091
585 Ga0097620_100050899
586 Ga0097620_100052610
587 Ga0075435_100003330
588 Ga0075435_100005484
589 Ga0075435_100012491
590 Ga0075435_100014458
591 Ga0075435_100023606
592 Ga0075435_100306569
593 Ga0099794_10004096
594 Ga0099794_10065288
595 Ga0105240_10010121
596 Ga0105240_10018550
597 Ga0105240_10135860
598 Ga0111539_10000485
599 Ga0114129_10005493
600 Ga0114129_10006975
601 Ga0114129_10023138
602 Ga0114129_10056335
603 Ga0114129_10130795
604 Ga0114129_10160201
605 Ga0114129_10161771
606 Ga0114129_10184495
607 Ga0114129_10186231
608 Ga0114129_10337853
609 Ga0105241_10000477
610 Ga0105237_10110708
611 Ga0105249_10019842
612 Ga0105249_10030053
613 Ga0105249_10183576
614 Ga0157373_10000467
615 Ga0157369_10225313
616 Ga0157372_10001975
617 Ga0157372_10134322
618 Ga0157375_10073974
619 Ga0157380_10122705
620 Ga0207653_10001661
621 Ga0207688_10011484
622 Ga0207647_10039788
623 Ga0207645_10001435
624 Ga0207643_10000783
625 Ga0207684_10003128
626 Ga0207684_10009144
627 Ga0207684_10012736
628 Ga0207684_10013317
629 Ga0207684_10027577
630 Ga0207684_10034676
631 Ga0207684_10045968
632 Ga0207684_10104670
633 Ga0207654_10005056
634 Ga0207707_10000223
635 Ga0207707_10029774
636 Ga0207707_10035473
637 Ga0207707_10158967
638 Ga0207695_10148657
639 Ga0207671_10120840
640 Ga0207693_10011683
641 Ga0207660_10000290
642 Ga0207660_10096727
643 Ga0207660_10142073
644 Ga0207660_10165076
645 Ga0207657_10000041
646 Ga0207652_10000760
647 Ga0207652_10190461
648 Ga0207646_10002946
649 Ga0207646_10020092
650 Ga0207646_10020609
651 Ga0207646_10029002
652 Ga0207646_10100990
653 Ga0207646_10260159
654 Ga0207681_10022155
655 Ga0207690_10000838
656 Ga0207706_10001136
657 Ga0207706_10188140
658 Ga0207670_10005951
659 Ga0207711_10054620
660 Ga0207689_10000112
661 Ga0207679_10000516
662 Ga0207667_10001770
663 Ga0207667_10341890
664 Ga0207651_10015848
665 Ga0207712_10027559
666 Ga0207712_10395856
667 Ga0207640_10161272
668 Ga0207658_10060533
669 Ga0207703_10223795
670 Ga0207639_10004573
671 Ga0207678_10001652
672 Ga0207678_10049322
673 Ga0207708_10021564
674 Ga0207702_10000767
675 Ga0207641_10037332
676 Ga0207641_10227406
677 Ga0207641_10394723
678 Ga0207648_10009591
679 Ga0207676_10060150
680 Ga0207676_10089605
681 Ga0207674_10004752
682 Ga0207674_10021398
683 Ga0207675_100012212
684 Ga0209981_1002140
685 Ga0210000_1007064
686 Ga0209995_1003156
687 Ga0209968_1001111
688 Ga0209999_1000653
689 Ga0210002_1008543
690 Ga0209983_1000902
691 Ga0209588_1008125
692 Ga0209971_1000031
693 Ga0209966_1000566
694 Ga0209998_10000024
695 Ga0209974_10002756
696 Ga0207428_10000068
697 Ga0268265_10006323
698 Ga0265326_10017591
699 Ga0265338_10000030
700 Ga0265324_10022143
701 Ga0265330_10038450
702 Ga0265331_10107239
703 Ga0265316_10031147
704 Ga0265316_10044997
705 Ga0265316_10049578
706 Ga0265316_10049857
707 Ga0265316_10109931
708 Ga0307408_100175602
709 Ga0316575_10041653
710 Ga0316579_10012548
711 Ga0316576_10029534
712 Ga0316578_10016976
713 Ga0307416_100022714
714 Ga0307415_100001108
715 Ga0373959_0008333
716 Ga0373940_0006432
717 Ga0373940_0010488
718 Ga0373949_0003289
719 Ga0373951_0005302
720 Ga0373952_0033221
721 Ga0373942_0011185
722 Ga0373961_0008143
723 Ga0316574_0002046
724 Ga0316582_0186623
725 Ga0316584_0002434
726 Ga0395900_0002231
727 Ga0395898_0003016
728 Ga0395901_0001014
729 Ga0400489_38905
730 Ga0439448_0011629
731 Ga0439455_0001027
732 Ga0439458_0018670
733 Ga0439464_0001974
734 Ga0439460_0000326
735 Ga0451577_0022443
736 Ga0451577_0070791
737 Ga0453683_0009988
738 Ga0453683_0022123
739 Ga0453683_0030904
740 Ga0453683_0205149
741 Ga0453684_0105038
742 Ga0453684_0133015
743 Ga0453684_0558703
744 Ga0451576_0004199
745 Ga0451576_0040499
746 Ga0451576_0070612
747 Ga0451576_0235921
748 Ga0495580_0000018
749 Ga0495580_0045680
750 Ga0495580_0072407
751 Ga0495659_0033930
752 Ga0496102_0013413
753 Ga0496102_0029996
754 Ga0496109_0087065
755 Ga0496110_0112576
756 Ga0496112_0058495
757 Ga0496116_0001499
758 Ga0501298_020232
759 Ga0501033_0112093
760 Ga0501033_0226071
761 Ga0501037_0068666
762 Ga0501039_0011397
763 Ga0501039_0187791
764 Ga0501039_0373086
765 Ga0501040_0010208
766 Ga0501040_0154618
767 Ga0501040_0369205
768 Ga0501041_0006780
769 Ga0501041_0019056
770 Ga0501041_0186824
771 Ga0501041_0195974
772 Ga0501042_0048413
773 Ga0501042_0065281
774 Ga0501042_0299276
775 Ga0501043_0108796
776 Ga0501043_0162641
777 Ga0501043_0373616
778 Ga0501046_0009997
779 Ga0501046_0057816
780 Ga0501046_0085926
781 Ga0501046_0113125
782 Ga0501046_0136320
783 Ga0501048_0009176
784 Ga0501068_0070786
785 Ga0501068_0077854
786 Ga0501071_0055529
787 Ga0501072_0001695
788 Ga0501072_0125458
789 Ga0501072_0156968
790 Ga0501073_0179419
791 Ga0501074_0005819
792 Ga0501074_0019760
793 Ga0501074_0074077
794 Ga0501075_0014009
795 Ga0501075_0048479
796 Ga0501075_0074513
797 Ga0501076_0007845
798 Ga0501076_0010713
799 Ga0501076_0023390
800 Ga0501076_0043746
801 Ga0501076_0154148
802 Ga0501076_0356607
803 Ga0501077_0023462
804 Ga0501077_0038867
805 Ga0501077_0038958
806 Ga0501077_0078569
807 Ga0501217_015161
808 Ga0501221_044275
809 Ga0501234_009867
810 Ga0501079_0000976
811 Ga0501079_0008038
812 Ga0501079_0049731
813 Ga0501079_0115972
814 Ga0501079_0127573
815 Ga0501079_0146132
816 Ga0501079_0172529
817 Ga0501081_0000568
818 Ga0501081_0000736
819 Ga0501081_0002200
820 Ga0501081_0037418
821 Ga0501081_0054320
822 Ga0501083_0157973
823 Ga0501045_0001094
824 Ga0501045_0052743
825 Ga0501045_0114396
826 Ga0501045_0242539
827 nmdc:mga05p37_156864_c1
828 nmdc:mga05p37_204408_c1
829 nmdc:mga05p37_213685_c1
830 nmdc:mga05p37_314892_c1
831 nmdc:mga05p37_3715_c1
832 nmdc:mga05p37_390398_c1
833 nmdc:mga05p37_44886_c1
834 nmdc:mga05p37_57400_c1
835 nmdc:mga05p37_61704_c1
836 nmdc:mga05p37_677114_c1
837 nmdc:mga05p37_83014_c1
838 nmdc:mga09592_35581_c1
839 nmdc:mga09592_40285_c1
840 nmdc:mga0qj67_346_c1
841 nmdc:mga0qj67_78643_c1
842 nmdc:mga06r32_2219_c1
843 nmdc:mga06r32_237447_c1
844 nmdc:mga06r32_25552_c1
845 nmdc:mga06r32_426120_c1
846 nmdc:mga06r32_503352_c1
847 nmdc:mga08y16_10019_c1
848 nmdc:mga08y16_140006_c1
849 nmdc:mga08y16_285900_c1
850 nmdc:mga0n895_185801_c1
851 nmdc:mga0n895_194090_c1
852 nmdc:mga0n895_215360_c1
853 nmdc:mga0n895_234231_c1
854 nmdc:mga0n895_4289_c1
855 nmdc:mga0n895_511874_c1
856 nmdc:mga0n895_5800_c1
857 nmdc:mga0n895_94186_c1
858 nmdc:mga0rr50_10778_c1
859 nmdc:mga0rr50_109483_c1
860 nmdc:mga0rr50_193335_c1
861 nmdc:mga0rr50_4479_c1
862 nmdc:mga0rr50_6240_c1
863 nmdc:mga08x19_127067_c1
864 nmdc:mga08x19_133906_c1
865 nmdc:mga08x19_15264_c1
866 nmdc:mga08x19_84699_c1
867 nmdc:mga0a205_1485_c1
868 nmdc:mga0a205_176934_c1
869 nmdc:mga0a205_19942_c1
870 nmdc:mga0a205_209_c1
871 nmdc:mga0a205_3103_c1
872 nmdc:mga0a205_37189_c1
873 nmdc:mga0a205_540483_c1
874 nmdc:mga0a205_76702_c1
875 Ga0501084_0007413
876 Ga0501084_0012547
877 Ga0501084_0047845
878 Ga0501084_0062222
879 Ga0501084_0229178
880 Ga0590071_033981
881 Ga0590075_012671
882 Ga0587085_012557
883 Ga0587076_000400
884 Ga0587079_000469
885 Ga0501082_0001632
886 Ga0501082_0027600
887 Ga0501082_0049430
888 Ga0501082_0162288
889 Ga0501082_0202335
890 Ga0530510_0000468
891 Ga0530510_0002615
892 Ga0530510_0003609
893 Ga0530510_0030411
894 Ga0530510_0041921
895 Ga0530510_0092087
896 Ga0530510_0158120
897 2904757409
898 3001896913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

159

360

0.99

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

45

148

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8083 92 311
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.8076 90 309
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7778 92 311
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.7616 92 301
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7411 90 306
ID Description Score Start End Superfamily
af_P0AFH2_84_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9411 87 309 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9383 91 311 1.10.3720.10
af_P75798_87_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9379 91 311 1.10.3720.10
af_P0AFH2_84_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9328 87 309 1.10.3720.10
af_Q2FZR7_83_297_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.93 87 309 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A315X6F0-F1-model_v4 Glutathione ABC transporter permease GsiC 0.9763 1 317 GO:0005886
GO:0071916
AF-A0A6I4ZC96-F1-model_v4 ABC transporter permease 0.976 1 317 GO:0005886
GO:0055085
AF-A0A315X6F0-F1-model_v4 Glutathione ABC transporter permease GsiC 0.9733 1 317 GO:0005886
GO:0071916
AF-A0A556PSE8-F1-model_v4 ABC transporter permease 0.9732 1 317 GO:0005886
GO:0055085
AF-A0A7X3R518-F1-model_v4 ABC transporter permease 0.9729 1 317 GO:0005886
GO:0071916

Map