F446317

General Info

Members Datasets Scaffolds Average Seq Length
449 237 898 410

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100035142|Ga0070714_1000351423
Length 439
Sequence VGSRRGRAAVGFLIGGKQLLHFALDTSNVQELLPLTARIDQGALSLGGVAAGALAADHGTPLVVYCEETIRAQARAYAAAAPGARVVYGTKAFANVAILRVLAEEGVGADVSTLGELAFAGAAGIPGDRILFHGNNKSDEELGAAAVAGATVVLDAPDEAERAAAAGVSRVLVRLTPGVEAHTHQSIRTAHDESKFGLPSEGALGVIRDALARGLDVAGVHFHVGSQLARVDESRVAVQRLLAFCERAESELGWKPQVLDIGGGLGIRYTHDEQVPEIGEFVTPLVAALPRDVQVILEPGRSLVGRAGVTLYRVGVVKESGGVCYVAIDGGMSDNPRPQLYDARYEALLANRADELADGVYRIAGKHCESGDVLIQAAELPRPRRGDLLAVPATGAYTLAMGSTYNGVPRPAVVMVRNGEARLIRRRQSVEDLLRYEDG

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
106 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
107 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
108 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.8
Rhizosphere 89.98
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100035142 3300005435 Bacteria 4199
2 Ga0070658_10012463 3300005327 Bacteria 6820
3 Ga0070658_10031843 3300005327 Bacteria 4237
4 Ga0070658_10043601 3300005327 Bacteria 3623
5 Ga0070676_10087670 3300005328 Bacteria 1900
6 Ga0070683_100002796 3300005329 Bacteria 13953
7 Ga0070683_100002839 3300005329 Bacteria 13863
8 Ga0070683_100003940 3300005329 Bacteria 12143
9 Ga0070683_100005418 3300005329 Bacteria 10655
10 Ga0070683_100095712 3300005329 Bacteria 2792
11 Ga0070683_100156787 3300005329 Bacteria 2159
12 Ga0070670_100003080 3300005331 Bacteria 13788
13 Ga0070670_100004293 3300005331 Bacteria 11932
14 Ga0070670_100171983 3300005331 Bacteria 1879
15 Ga0070680_100046205 3300005336 Bacteria 3541
16 Ga0070660_100070146 3300005339 Bacteria 2734
17 Ga0070660_100120597 3300005339 Bacteria 2092
18 Ga0070689_100062132 3300005340 Bacteria 2906
19 Ga0070691_10019115 3300005341 Bacteria 3160
20 Ga0070691_10043059 3300005341 Bacteria 2138
21 Ga0070671_100034621 3300005355 Bacteria 4181
22 Ga0070674_100022537 3300005356 Bacteria 4063
23 Ga0070688_100010940 3300005365 Bacteria 5025
24 Ga0070659_100035832 3300005366 Bacteria 3866
25 Ga0070714_100002463 3300005435 Bacteria 13653
26 Ga0070713_100008672 3300005436 Bacteria 7230
27 Ga0070701_10014859 3300005438 Bacteria 3579
28 Ga0070711_100077557 3300005439 Bacteria 2358
29 Ga0070700_100003553 3300005441 Bacteria 8052
30 Ga0070708_100074097 3300005445 Bacteria 3070
31 Ga0070678_100013932 3300005456 Bacteria 5057
32 Ga0070678_100091374 3300005456 Bacteria 2336
33 Ga0070678_100180621 3300005456 Bacteria 1727
34 Ga0070678_100226483 3300005456 Bacteria 1557
35 Ga0070662_100040087 3300005457 Bacteria 3333
36 Ga0070681_10004627 3300005458 Bacteria 13137
37 Ga0070681_10137355 3300005458 Bacteria 2375
38 Ga0070681_10233865 3300005458 Bacteria 1752
39 Ga0070685_10011176 3300005466 Bacteria 4695
40 Ga0070706_100216791 3300005467 Bacteria 1786
41 Ga0070707_100191925 3300005468 Bacteria 1992
42 Ga0070698_100012956 3300005471 Bacteria 8827
43 Ga0070698_100016741 3300005471 Bacteria 7733
44 Ga0070698_100041185 3300005471 Bacteria 4743
45 Ga0070698_100179175 3300005471 Bacteria 2058
46 Ga0070699_100116920 3300005518 Bacteria 2344
47 Ga0070679_100008896 3300005530 Bacteria 9475
48 Ga0070684_100000098 3300005535 Bacteria 56167
49 Ga0070684_100005855 3300005535 Bacteria 9460
50 Ga0070684_100044522 3300005535 Bacteria 3839
51 Ga0070684_100049209 3300005535 Bacteria 3658
52 Ga0070684_100081349 3300005535 Bacteria 2866
53 Ga0070684_100106196 3300005535 Bacteria 2513
54 Ga0070696_100137222 3300005546 Bacteria 1784
55 Ga0070693_100010537 3300005547 Bacteria 4635
56 Ga0068855_100014351 3300005563 Bacteria 9539
57 Ga0068855_100016766 3300005563 Bacteria 8809
58 Ga0070664_100063415 3300005564 Bacteria 3151
59 Ga0070664_100134772 3300005564 Bacteria 2171
60 Ga0068857_100000511 3300005577 Bacteria 27856
61 Ga0068857_100001704 3300005577 Bacteria 17673
62 Ga0068857_100051766 3300005577 Bacteria 3644
63 Ga0068856_100064672 3300005614 Bacteria 3614
64 Ga0068856_100111898 3300005614 Bacteria 2728
65 Ga0070702_100024170 3300005615 Bacteria 3238
66 Ga0068852_100053494 3300005616 Bacteria 3475
67 Ga0068864_100067258 3300005618 Bacteria 3111
68 Ga0068861_100245912 3300005719 Bacteria 1524
69 Ga0081538_10030480 3300005981 Bacteria 3661
70 Ga0081540_1002299 3300005983 Bacteria 15682
71 Ga0081539_10001235 3300005985 Bacteria 45514
72 Ga0081539_10004677 3300005985 Bacteria 14853
73 Ga0070717_10012353 3300006028 Bacteria 6508
74 Ga0070715_10043231 3300006163 Bacteria 1898
75 Ga0070716_100013308 3300006173 Bacteria 4191
76 Ga0070712_100021560 3300006175 Bacteria 4233
77 Ga0070712_100038765 3300006175 Bacteria 3258
78 Ga0075428_100012885 3300006844 Bacteria 9303
79 Ga0075428_100026951 3300006844 Bacteria 6365
80 Ga0075430_100068974 3300006846 Bacteria 2967
81 Ga0075430_100070099 3300006846 Bacteria 2940
82 Ga0075433_10083860 3300006852 Bacteria 2813
83 Ga0075434_100007132 3300006871 Bacteria 10328
84 Ga0075434_100031502 3300006871 Bacteria 5228
85 Ga0075434_100185891 3300006871 Bacteria 2098
86 Ga0075429_100092340 3300006880 Bacteria 2640
87 Ga0068865_100077654 3300006881 Bacteria 2374
88 Ga0075436_100126464 3300006914 Bacteria 1791
89 Ga0075435_100005572 3300007076 Bacteria 8813
90 Ga0105240_10006949 3300009093 Bacteria 16532
91 Ga0105240_10019215 3300009093 Bacteria 9134
92 Ga0105240_10101430 3300009093 Bacteria 3500
93 Ga0111539_10038710 3300009094 Bacteria 5755
94 Ga0111539_10060301 3300009094 Bacteria 4496
95 Ga0111539_10114016 3300009094 Bacteria 3170
96 Ga0111539_10401261 3300009094 Bacteria 1597
97 Ga0105245_10003978 3300009098 Bacteria 13140
98 Ga0105245_10006802 3300009098 Bacteria 10028
99 Ga0105245_10083639 3300009098 Bacteria 2922
100 Ga0105245_10159563 3300009098 Bacteria 2139
101 Ga0105245_10177837 3300009098 Bacteria 2031
102 Ga0114129_10033926 3300009147 Bacteria 7209
103 Ga0114129_10076728 3300009147 Bacteria 4651
104 Ga0114129_10426658 3300009147 Bacteria 1743
105 Ga0114129_10449406 3300009147 Bacteria 1690
106 Ga0105248_10095167 3300009177 Bacteria 3354
107 Ga0105239_10182395 3300010375 Bacteria 2349
108 Ga0105246_10040347 3300011119 Bacteria 3150
109 Ga0157370_10021874 3300013104 Bacteria 6370
110 Ga0157369_10001510 3300013105 Bacteria 28541
111 Ga0157369_10016583 3300013105 Bacteria 8281
112 Ga0157369_10089493 3300013105 Bacteria 3286
113 Ga0157374_10042572 3300013296 Bacteria 4189
114 Ga0157374_10123958 3300013296 Bacteria 2496
115 Ga0157372_10152260 3300013307 Bacteria 2670
116 Ga0157372_10195934 3300013307 Bacteria 2340
117 Ga0157375_10025403 3300013308 Bacteria 5503
118 Ga0157375_10239466 3300013308 Bacteria 1974
119 Ga0182008_10001310 3300014497 Bacteria 17009
120 Ga0182008_10048104 3300014497 Bacteria 2118
121 Ga0182007_10009424 3300015262 Bacteria 3936
122 Ga0206356_10641622 3300020070 Bacteria 4663
123 Ga0206353_10362684 3300020082 Bacteria 2263
124 Ga0206353_11618066 3300020082 Bacteria 3056
125 Ga0207692_10003035 3300025898 Bacteria 6509
126 Ga0207688_10000691 3300025901 Bacteria 16661
127 Ga0207688_10001614 3300025901 Bacteria 11890
128 Ga0207699_10041821 3300025906 Bacteria 2650
129 Ga0207645_10039509 3300025907 Bacteria 3024
130 Ga0207707_10009743 3300025912 Bacteria 8335
131 Ga0207707_10028893 3300025912 Bacteria 4846
132 Ga0207707_10033199 3300025912 Bacteria 4517
133 Ga0207707_10222238 3300025912 Bacteria 1644
134 Ga0207695_10026636 3300025913 Bacteria 6451
135 Ga0207695_10044216 3300025913 Bacteria 4739
136 Ga0207693_10019077 3300025915 Bacteria 5458
137 Ga0207693_10019083 3300025915 Bacteria 5458
138 Ga0207663_10004473 3300025916 Bacteria 6955
139 Ga0207660_10145970 3300025917 Bacteria 1813
140 Ga0207657_10006625 3300025919 Bacteria 11987
141 Ga0207657_10036298 3300025919 Bacteria 4412
142 Ga0207657_10202534 3300025919 Bacteria 1596
143 Ga0207652_10022320 3300025921 Bacteria 5235
144 Ga0207652_10140912 3300025921 Bacteria 2156
145 Ga0207646_10156794 3300025922 Bacteria 2054
146 Ga0207650_10005635 3300025925 Bacteria 8549
147 Ga0207659_10029099 3300025926 Bacteria 3761
148 Ga0207664_10015602 3300025929 Bacteria 5520
149 Ga0207664_10016719 3300025929 Bacteria 5358
150 Ga0207664_10051370 3300025929 Bacteria 3255
151 Ga0207644_10203369 3300025931 Bacteria 1563
152 Ga0207706_10069213 3300025933 Bacteria 3104
153 Ga0207709_10027474 3300025935 Bacteria 3279
154 Ga0207665_10000531 3300025939 Bacteria 25686
155 Ga0207691_10026390 3300025940 Bacteria 5450
156 Ga0207689_10033981 3300025942 Bacteria 4235
157 Ga0207661_10001403 3300025944 Bacteria 16228
158 Ga0207661_10002194 3300025944 Bacteria 13476
159 Ga0207661_10005897 3300025944 Bacteria 8646
160 Ga0207661_10073221 3300025944 Bacteria 2805
161 Ga0207679_10017637 3300025945 Bacteria 4766
162 Ga0207679_10034969 3300025945 Bacteria 3551
163 Ga0207679_10045767 3300025945 Bacteria 3167
164 Ga0207679_10089836 3300025945 Bacteria 2372
165 Ga0207667_10203260 3300025949 Bacteria 2032
166 Ga0207677_10002338 3300026023 Bacteria 9954
167 Ga0207677_10047108 3300026023 Bacteria 2892
168 Ga0207678_10055865 3300026067 Bacteria 3400
169 Ga0207708_10007016 3300026075 Bacteria 8326
170 Ga0207702_10035766 3300026078 Bacteria 4152
171 Ga0207702_10045566 3300026078 Bacteria 3689
172 Ga0207702_10084111 3300026078 Bacteria 2769
173 Ga0207702_10177341 3300026078 Bacteria 1959
174 Ga0207676_10013279 3300026095 Bacteria 5917
175 Ga0207674_10008262 3300026116 Bacteria 12056
176 Ga0207674_10021611 3300026116 Bacteria 6927
177 Ga0207674_10038012 3300026116 Bacteria 5001
178 Ga0207674_10075877 3300026116 Bacteria 3371
179 Ga0207674_10222398 3300026116 Bacteria 1836
180 Ga0207675_100110090 3300026118 Bacteria 2599
181 Ga0207683_10012757 3300026121 Bacteria 7172
182 Ga0207683_10155929 3300026121 Bacteria 2062
183 Ga0207683_10228855 3300026121 Bacteria 1695
184 Ga0207683_10257984 3300026121 Unclassified 1592
185 Ga0207698_10035033 3300026142 Bacteria 3668
186 Ga0207698_10055473 3300026142 Bacteria 3054
187 Ga0207428_10013418 3300027907 Bacteria 7159
188 Ga0268266_10194865 3300028379 Bacteria 1851
189 Ga0265326_10004010 3300028558 Bacteria 4764
190 Ga0265319_1001851 3300028563 Bacteria 12058
191 Ga0265319_1019248 3300028563 Bacteria 2553
192 Ga0265334_10000884 3300028573 Bacteria 14971
193 Ga0265334_10005432 3300028573 Bacteria 5567
194 Ga0265318_10000561 3300028577 Bacteria 26198
195 Ga0265318_10002993 3300028577 Bacteria 8728
196 Ga0265336_10023917 3300028666 Bacteria 1934
197 Ga0265338_10004482 3300028800 Bacteria 18833
198 Ga0265338_10010651 3300028800 Bacteria 10747
199 Ga0265338_10024325 3300028800 Bacteria 6190
200 Ga0265338_10057134 3300028800 Bacteria 3453
201 Ga0265338_10108540 3300028800 Bacteria 2241
202 Ga0265330_10027984 3300031235 Bacteria 2543
203 Ga0265330_10032878 3300031235 Bacteria 2323
204 Ga0265332_10003270 3300031238 Bacteria 7874
205 Ga0265320_10010107 3300031240 Bacteria 5640
206 Ga0265325_10002855 3300031241 Bacteria 11521
207 Ga0265325_10059787 3300031241 Bacteria 1937
208 Ga0265329_10011405 3300031242 Bacteria 3229
209 Ga0265340_10002903 3300031247 Bacteria 9758
210 Ga0265340_10026059 3300031247 Bacteria 2958
211 Ga0265339_10003650 3300031249 Bacteria 10742
212 Ga0265339_10036161 3300031249 Bacteria 2765
213 Ga0265339_10043574 3300031249 Bacteria 2480
214 Ga0265327_10012029 3300031251 Bacteria 5884
215 Ga0265327_10030106 3300031251 Bacteria 3074
216 Ga0265316_10019855 3300031344 Bacteria 5737
217 Ga0265316_10020524 3300031344 Bacteria 5622
218 Ga0265316_10027194 3300031344 Bacteria 4741
219 Ga0265313_10002358 3300031595 Bacteria 16470
220 Ga0265314_10003240 3300031711 Bacteria 15912
221 Ga0265314_10003852 3300031711 Bacteria 14305
222 Ga0265314_10012973 3300031711 Bacteria 6766
223 Ga0265342_10051886 3300031712 Bacteria 2445
224 Ga0316583_10049108 3300032133 Bacteria 1485
225 Ga0373936_0021046 3300035113 Bacteria 2537
226 Ga0373943_0014592 3300035170 Bacteria 3560
227 Ga0373946_0014825 3300035171 Bacteria 2945
228 Ga0373933_0118364 3300035724 Bacteria 1657
229 Ga0373937_0000190 3300036401 Bacteria 60066
230 Ga0395899_0001264 3300037312 Bacteria 21985
231 Ga0395899_0088615 3300037312 Bacteria 2244
232 Ga0395900_0002857 3300037418 Bacteria 18833
233 Ga0395900_0008249 3300037418 Bacteria 10725
234 Ga0395900_0049785 3300037418 Bacteria 4317
235 Ga0395900_0060557 3300037418 Bacteria 3895
236 Ga0395900_0132058 3300037418 Bacteria 2558
237 Ga0395898_0005912 3300037466 Bacteria 13149
238 Ga0395898_0015913 3300037466 Bacteria 7708
239 Ga0395898_0074226 3300037466 Bacteria 3285
240 Ga0395898_0341061 3300037466 Bacteria 1429
241 Ga0395905_0000568 3300037471 Bacteria 50013
242 Ga0395905_0013666 3300037471 Bacteria 7776
243 Ga0395905_0031981 3300037471 Bacteria 4950
244 Ga0395905_0100809 3300037471 Bacteria 2711
245 Ga0395905_0203494 3300037471 Bacteria 1856
246 Ga0395901_0001508 3300038443 Bacteria 24209
247 Ga0395901_0027120 3300038443 Bacteria 5883
248 Ga0439461_0002465 3300041410 Bacteria 2957
249 Ga0451853_1932493 3300041512 Bacteria 2440
250 Ga0450910_012331 3300042147 Bacteria 1235
251 Ga0439446_0002537 3300042156 Bacteria 4393
252 Ga0439434_0005358 3300042435 Bacteria 3755
253 Ga0466969_0000517 3300044656 Bacteria 21223
254 Ga0466965_0021083 3300044683 Bacteria 3136
255 Ga0466966_0000658 3300044684 Bacteria 22011
256 Ga0466961_0014555 3300044693 Bacteria 5054
257 Ga0466961_0080462 3300044693 Bacteria 2062
258 Ga0466963_0000990 3300044694 Bacteria 14635
259 Ga0466963_0001446 3300044694 Bacteria 12797
260 Ga0466963_0005744 3300044694 Bacteria 7293
261 Ga0466963_0006201 3300044694 Bacteria 7062
262 Ga0466963_0019200 3300044694 Bacteria 4283
263 Ga0466963_0021726 3300044694 Bacteria 4052
264 Ga0466963_0024378 3300044694 Bacteria 3851
265 Ga0466963_0031466 3300044694 Bacteria 3430
266 Ga0466964_0001161 3300044706 Bacteria 8907
267 Ga0466971_0021347 3300044719 Bacteria 2883
268 Ga0466968_0000648 3300044735 Bacteria 11908
269 Ga0466968_0040089 3300044735 Bacteria 1974
270 Ga0466970_0010368 3300044765 Bacteria 4730
271 Ga0466957_0016208 3300044842 Bacteria 4357
272 Ga0466957_0065238 3300044842 Bacteria 2242
273 Ga0466957_0093620 3300044842 Bacteria 1886
274 Ga0466960_0033379 3300044901 Bacteria 2391
275 Ga0466959_0000993 3300045049 Bacteria 16897
276 Ga0466959_0035839 3300045049 Bacteria 3665
277 Ga0466959_0116377 3300045049 Bacteria 1904
278 Ga0466958_0010940 3300045836 Bacteria 5097
279 Ga0466958_0037339 3300045836 Bacteria 2911
280 Ga0466958_0052147 3300045836 Bacteria 2478
281 Ga0466958_0086439 3300045836 Bacteria 1935
282 Ga0466967_0003700 3300045976 Bacteria 10070
283 Ga0466967_0024125 3300045976 Bacteria 4995
284 Ga0466967_0034977 3300045976 Bacteria 4271
285 Ga0466967_0036693 3300045976 Bacteria 4187
286 Ga0466967_0048762 3300045976 Bacteria 3700
287 Ga0466967_0055051 3300045976 Bacteria 3503
288 Ga0466967_0072757 3300045976 Bacteria 3082
289 Ga0466967_0089802 3300045976 Bacteria 2790
290 Ga0466967_0091020 3300045976 Bacteria 2772
291 Ga0466967_0154765 3300045976 Bacteria 2146
292 Ga0466967_0160880 3300045976 Unclassified 2107
293 Ga0466967_0204121 3300045976 Unclassified 1873
294 Ga0466967_0258151 3300045976 Bacteria 1667
295 Ga0495592_0000206 3300046454 Bacteria 50513
296 Ga0495629_0081236 3300046459 Bacteria 2262
297 Ga0495641_0002336 3300046461 Bacteria 15072
298 Ga0495651_0000001 3300046462 Bacteria 210544
299 Ga0495653_0000365 3300046463 Bacteria 36511
300 Ga0495653_0013327 3300046463 Bacteria 6700
301 Ga0495580_0050010 3300046472 Bacteria 2956
302 Ga0495582_0014516 3300046473 Bacteria 4327
303 Ga0495582_0015541 3300046473 Bacteria 4181
304 Ga0495662_0001461 3300046476 Bacteria 11698
305 Ga0495664_0155661 3300046477 Bacteria 1386
306 Ga0495584_0074853 3300046491 Bacteria 1702
307 Ga0495608_0003507 3300046511 Bacteria 11241
308 Ga0495618_0002253 3300046514 Bacteria 12515
309 Ga0495618_0018683 3300046514 Bacteria 4257
310 Ga0495628_0000047 3300046516 Bacteria 97852
311 Ga0495630_0002781 3300046517 Bacteria 12142
312 Ga0495666_0001601 3300046526 Bacteria 11141
313 Ga0495652_0000291 3300046529 Bacteria 59608
314 Ga0495665_0000431 3300046531 Bacteria 21350
315 Ga0495640_0050749 3300046533 Bacteria 2855
316 Ga0495586_0004812 3300046535 Bacteria 7215
317 Ga0495586_0039381 3300046535 Bacteria 2541
318 Ga0495587_0000540 3300046536 Bacteria 26236
319 Ga0495645_0000039 3300046543 Bacteria 94569
320 Ga0495634_0006091 3300046642 Bacteria 9193
321 Ga0495634_0139004 3300046642 Bacteria 1543
322 Ga0495659_0003050 3300046664 Bacteria 5374
323 Ga0495657_0075294 3300046675 Bacteria 2194
324 Ga0495599_0000063 3300046678 Bacteria 73690
325 Ga0495599_0062155 3300046678 Bacteria 2333
326 Ga0495623_0000214 3300046679 Bacteria 36993
327 Ga0495623_0142547 3300046679 Bacteria 1424
328 Ga0495646_0003212 3300046680 Bacteria 10157
329 Ga0495647_0000087 3300046681 Bacteria 22819
330 Ga0495658_0000999 3300046683 Bacteria 14933
331 Ga0495658_0009016 3300046683 Bacteria 4959
332 Ga0495624_0000454 3300046690 Bacteria 32267
333 Ga0495600_0001321 3300046809 Bacteria 13688
334 Ga0495581_0018049 3300047315 Bacteria 4098
335 Ga0495604_0000004 3300047317 Bacteria 456385
336 Ga0495674_0286790 3300047319 Bacteria 1347
337 Ga0495676_0005677 3300047321 Bacteria 11437
338 Ga0495676_0011449 3300047321 Bacteria 8008
339 Ga0495675_0000075 3300047444 Bacteria 69347
340 Ga0495675_0112284 3300047444 Bacteria 1701
341 Ga0495602_0136794 3300048088 Bacteria 1945
342 Ga0495614_0008055 3300048089 Bacteria 4683
343 Ga0496100_0002343 3300048903 Bacteria 9583
344 Ga0496100_0128467 3300048903 Bacteria 1782
345 Ga0496101_0248829 3300048904 Bacteria 1384
346 Ga0496102_0013755 3300048905 Bacteria 7018
347 Ga0496102_0026542 3300048905 Bacteria 5168
348 Ga0496102_0027385 3300048905 Bacteria 5090
349 Ga0496102_0313731 3300048905 Bacteria 1477
350 Ga0496103_0103594 3300048906 Bacteria 1803
351 Ga0496104_0083090 3300048907 Bacteria 3054
352 Ga0496104_0292775 3300048907 Bacteria 1540
353 Ga0496105_0044251 3300048908 Bacteria 3671
354 Ga0496105_0052323 3300048908 Bacteria 3373
355 Ga0496105_0055982 3300048908 Bacteria 3256
356 Ga0496106_0075136 3300048909 Bacteria 2588
357 Ga0496107_0004354 3300048910 Bacteria 9587
358 Ga0496107_0031577 3300048910 Bacteria 3781
359 Ga0496107_0037403 3300048910 Bacteria 3483
360 Ga0496107_0180207 3300048910 Bacteria 1569
361 Ga0496107_0194314 3300048910 Bacteria 1508
362 Ga0496108_0015303 3300048911 Bacteria 6258
363 Ga0496108_0047319 3300048911 Bacteria 3595
364 Ga0496109_0023761 3300048912 Bacteria 5440
365 Ga0496109_0077096 3300048912 Bacteria 3067
366 Ga0496110_0012673 3300048913 Bacteria 6938
367 Ga0496110_0083017 3300048913 Bacteria 2858
368 Ga0496112_0001071 3300048915 Bacteria 20230
369 Ga0496112_0003677 3300048915 Bacteria 12788
370 Ga0496112_0019392 3300048915 Bacteria 6420
371 Ga0496112_0054313 3300048915 Bacteria 3935
372 Ga0496112_0083682 3300048915 Bacteria 3156
373 Ga0496112_0083763 3300048915 Bacteria 3154
374 Ga0496112_0292845 3300048915 Bacteria 1574
375 Ga0496113_0045283 3300048916 Bacteria 3262
376 Ga0496113_0133514 3300048916 Bacteria 1949
377 Ga0496114_0002759 3300048917 Bacteria 13438
378 Ga0496114_0023303 3300048917 Bacteria 5051
379 Ga0496114_0058432 3300048917 Bacteria 3220
380 Ga0496114_0101063 3300048917 Bacteria 2461
381 Ga0496114_0146165 3300048917 Bacteria 2049
382 Ga0496114_0169984 3300048917 Bacteria 1899
383 Ga0496115_0030452 3300048918 Bacteria 4245
384 Ga0496115_0039616 3300048918 Bacteria 3743
385 Ga0496115_0143405 3300048918 Bacteria 1970
386 Ga0496115_0200558 3300048918 Bacteria 1648
387 Ga0501031_0000624 3300049568 Bacteria 20907
388 Ga0501031_0010531 3300049568 Bacteria 6020
389 Ga0501039_0291142 3300049575 Bacteria 1284
390 Ga0501040_0003671 3300049576 Bacteria 9940
391 Ga0501041_0024013 3300049577 Bacteria 3658
392 Ga0501042_0000265 3300049578 Bacteria 25490
393 Ga0501042_0021914 3300049578 Bacteria 4459
394 Ga0501046_0020235 3300049580 Bacteria 5508
395 Ga0501046_0021278 3300049580 Bacteria 5354
396 Ga0501046_0033894 3300049580 Bacteria 4124
397 Ga0501048_0011593 3300049582 Bacteria 6573
398 Ga0501067_0015629 3300049583 Bacteria 4200
399 Ga0501067_0048172 3300049583 Bacteria 2363
400 Ga0501067_0059882 3300049583 Bacteria 2107
401 Ga0501069_0000767 3300049585 Bacteria 15020
402 Ga0501069_0007689 3300049585 Bacteria 5654
403 Ga0501069_0015229 3300049585 Bacteria 4121
404 Ga0501071_0001012 3300049587 Bacteria 15477
405 Ga0501071_0002558 3300049587 Bacteria 11091
406 Ga0501072_0002483 3300049588 Bacteria 13814
407 Ga0501072_0010986 3300049588 Bacteria 6905
408 Ga0501073_0046724 3300049589 Bacteria 3043
409 Ga0501073_0101213 3300049589 Bacteria 2001
410 Ga0501075_0005345 3300049591 Bacteria 8783
411 Ga0501075_0015795 3300049591 Bacteria 5427
412 Ga0501075_0054537 3300049591 Bacteria 3008
413 Ga0501076_0000330 3300049592 Bacteria 29312
414 Ga0501076_0275345 3300049592 Bacteria 1378
415 Ga0501077_0003749 3300049593 Bacteria 9146
416 Ga0501079_0001382 3300049741 Bacteria 17096
417 Ga0501079_0004260 3300049741 Bacteria 10613
418 Ga0501080_0000972 3300049742 Bacteria 23429
419 Ga0501080_0045173 3300049742 Bacteria 4100
420 Ga0501080_0066295 3300049742 Bacteria 3358
421 Ga0501081_0002440 3300049743 Bacteria 11739
422 Ga0501081_0003558 3300049743 Bacteria 9955
423 Ga0501081_0037925 3300049743 Bacteria 3290
424 Ga0501083_0003233 3300049744 Bacteria 11364
425 Ga0501083_0030435 3300049744 Bacteria 3709
426 Ga0501045_0002155 3300049824 Bacteria 13327
427 Ga0501045_0003476 3300049824 Bacteria 10781
428 Ga0501045_0006061 3300049824 Bacteria 8375
429 nmdc:mga05p37_123272_c1 3300050507 Bacteria 3183
430 nmdc:mga05p37_460542_c1 3300050507 Bacteria 1470
431 nmdc:mga05p37_5166_c1 3300050507 Bacteria 14287
432 nmdc:mga09592_41968_c1 3300050508 Bacteria 3849
433 nmdc:mga0qj67_121087_c1 3300050509 Unclassified 2116
434 nmdc:mga08y16_77201_c1 3300050511 Bacteria 3473
435 nmdc:mga0n895_166062_c1 3300050512 Bacteria 2239
436 nmdc:mga0n895_37273_c1 3300050512 Bacteria 4703
437 nmdc:mga0n895_4497_c1 3300050512 Bacteria 11467
438 nmdc:mga08x19_6800_c1 3300050514 Bacteria 6792
439 nmdc:mga0a205_72699_c1 3300050515 Bacteria 3322
440 nmdc:mga0a205_78818_c1 3300050515 Bacteria 3182
441 Ga0495601_0000148 3300053077 Bacteria 40030
442 Ga0495601_0034890 3300053077 Bacteria 3138
443 Ga0495619_0002163 3300053085 Bacteria 13019
444 Ga0495619_0005535 3300053085 Bacteria 8014
445 Ga0501084_0003270 3300054114 Bacteria 13109
446 Ga0501084_0005671 3300054114 Bacteria 10248
447 Ga0501082_0009476 3300060353 Bacteria 8384
448 Ga0501082_0097704 3300060353 Bacteria 2539
449 Ga0530510_0013072 3300061734 Bacteria 5837
450 Ga0070714_100035142
451 Ga0070658_10012463
452 Ga0070658_10031843
453 Ga0070658_10043601
454 Ga0070676_10087670
455 Ga0070683_100002796
456 Ga0070683_100002839
457 Ga0070683_100003940
458 Ga0070683_100005418
459 Ga0070683_100095712
460 Ga0070683_100156787
461 Ga0070670_100003080
462 Ga0070670_100004293
463 Ga0070670_100171983
464 Ga0070680_100046205
465 Ga0070660_100070146
466 Ga0070660_100120597
467 Ga0070689_100062132
468 Ga0070691_10019115
469 Ga0070691_10043059
470 Ga0070671_100034621
471 Ga0070674_100022537
472 Ga0070688_100010940
473 Ga0070659_100035832
474 Ga0070714_100002463
475 Ga0070713_100008672
476 Ga0070701_10014859
477 Ga0070711_100077557
478 Ga0070700_100003553
479 Ga0070708_100074097
480 Ga0070678_100013932
481 Ga0070678_100091374
482 Ga0070678_100180621
483 Ga0070678_100226483
484 Ga0070662_100040087
485 Ga0070681_10004627
486 Ga0070681_10137355
487 Ga0070681_10233865
488 Ga0070685_10011176
489 Ga0070706_100216791
490 Ga0070707_100191925
491 Ga0070698_100012956
492 Ga0070698_100016741
493 Ga0070698_100041185
494 Ga0070698_100179175
495 Ga0070699_100116920
496 Ga0070679_100008896
497 Ga0070684_100000098
498 Ga0070684_100005855
499 Ga0070684_100044522
500 Ga0070684_100049209
501 Ga0070684_100081349
502 Ga0070684_100106196
503 Ga0070696_100137222
504 Ga0070693_100010537
505 Ga0068855_100014351
506 Ga0068855_100016766
507 Ga0070664_100063415
508 Ga0070664_100134772
509 Ga0068857_100000511
510 Ga0068857_100001704
511 Ga0068857_100051766
512 Ga0068856_100064672
513 Ga0068856_100111898
514 Ga0070702_100024170
515 Ga0068852_100053494
516 Ga0068864_100067258
517 Ga0068861_100245912
518 Ga0081538_10030480
519 Ga0081540_1002299
520 Ga0081539_10001235
521 Ga0081539_10004677
522 Ga0070717_10012353
523 Ga0070715_10043231
524 Ga0070716_100013308
525 Ga0070712_100021560
526 Ga0070712_100038765
527 Ga0075428_100012885
528 Ga0075428_100026951
529 Ga0075430_100068974
530 Ga0075430_100070099
531 Ga0075433_10083860
532 Ga0075434_100007132
533 Ga0075434_100031502
534 Ga0075434_100185891
535 Ga0075429_100092340
536 Ga0068865_100077654
537 Ga0075436_100126464
538 Ga0075435_100005572
539 Ga0105240_10006949
540 Ga0105240_10019215
541 Ga0105240_10101430
542 Ga0111539_10038710
543 Ga0111539_10060301
544 Ga0111539_10114016
545 Ga0111539_10401261
546 Ga0105245_10003978
547 Ga0105245_10006802
548 Ga0105245_10083639
549 Ga0105245_10159563
550 Ga0105245_10177837
551 Ga0114129_10033926
552 Ga0114129_10076728
553 Ga0114129_10426658
554 Ga0114129_10449406
555 Ga0105248_10095167
556 Ga0105239_10182395
557 Ga0105246_10040347
558 Ga0157370_10021874
559 Ga0157369_10001510
560 Ga0157369_10016583
561 Ga0157369_10089493
562 Ga0157374_10042572
563 Ga0157374_10123958
564 Ga0157372_10152260
565 Ga0157372_10195934
566 Ga0157375_10025403
567 Ga0157375_10239466
568 Ga0182008_10001310
569 Ga0182008_10048104
570 Ga0182007_10009424
571 Ga0206356_10641622
572 Ga0206353_10362684
573 Ga0206353_11618066
574 Ga0207692_10003035
575 Ga0207688_10000691
576 Ga0207688_10001614
577 Ga0207699_10041821
578 Ga0207645_10039509
579 Ga0207707_10009743
580 Ga0207707_10028893
581 Ga0207707_10033199
582 Ga0207707_10222238
583 Ga0207695_10026636
584 Ga0207695_10044216
585 Ga0207693_10019077
586 Ga0207693_10019083
587 Ga0207663_10004473
588 Ga0207660_10145970
589 Ga0207657_10006625
590 Ga0207657_10036298
591 Ga0207657_10202534
592 Ga0207652_10022320
593 Ga0207652_10140912
594 Ga0207646_10156794
595 Ga0207650_10005635
596 Ga0207659_10029099
597 Ga0207664_10015602
598 Ga0207664_10016719
599 Ga0207664_10051370
600 Ga0207644_10203369
601 Ga0207706_10069213
602 Ga0207709_10027474
603 Ga0207665_10000531
604 Ga0207691_10026390
605 Ga0207689_10033981
606 Ga0207661_10001403
607 Ga0207661_10002194
608 Ga0207661_10005897
609 Ga0207661_10073221
610 Ga0207679_10017637
611 Ga0207679_10034969
612 Ga0207679_10045767
613 Ga0207679_10089836
614 Ga0207667_10203260
615 Ga0207677_10002338
616 Ga0207677_10047108
617 Ga0207678_10055865
618 Ga0207708_10007016
619 Ga0207702_10035766
620 Ga0207702_10045566
621 Ga0207702_10084111
622 Ga0207702_10177341
623 Ga0207676_10013279
624 Ga0207674_10008262
625 Ga0207674_10021611
626 Ga0207674_10038012
627 Ga0207674_10075877
628 Ga0207674_10222398
629 Ga0207675_100110090
630 Ga0207683_10012757
631 Ga0207683_10155929
632 Ga0207683_10228855
633 Ga0207683_10257984
634 Ga0207698_10035033
635 Ga0207698_10055473
636 Ga0207428_10013418
637 Ga0268266_10194865
638 Ga0265326_10004010
639 Ga0265319_1001851
640 Ga0265319_1019248
641 Ga0265334_10000884
642 Ga0265334_10005432
643 Ga0265318_10000561
644 Ga0265318_10002993
645 Ga0265336_10023917
646 Ga0265338_10004482
647 Ga0265338_10010651
648 Ga0265338_10024325
649 Ga0265338_10057134
650 Ga0265338_10108540
651 Ga0265330_10027984
652 Ga0265330_10032878
653 Ga0265332_10003270
654 Ga0265320_10010107
655 Ga0265325_10002855
656 Ga0265325_10059787
657 Ga0265329_10011405
658 Ga0265340_10002903
659 Ga0265340_10026059
660 Ga0265339_10003650
661 Ga0265339_10036161
662 Ga0265339_10043574
663 Ga0265327_10012029
664 Ga0265327_10030106
665 Ga0265316_10019855
666 Ga0265316_10020524
667 Ga0265316_10027194
668 Ga0265313_10002358
669 Ga0265314_10003240
670 Ga0265314_10003852
671 Ga0265314_10012973
672 Ga0265342_10051886
673 Ga0316583_10049108
674 Ga0373936_0021046
675 Ga0373943_0014592
676 Ga0373946_0014825
677 Ga0373933_0118364
678 Ga0373937_0000190
679 Ga0395899_0001264
680 Ga0395899_0088615
681 Ga0395900_0002857
682 Ga0395900_0008249
683 Ga0395900_0049785
684 Ga0395900_0060557
685 Ga0395900_0132058
686 Ga0395898_0005912
687 Ga0395898_0015913
688 Ga0395898_0074226
689 Ga0395898_0341061
690 Ga0395905_0000568
691 Ga0395905_0013666
692 Ga0395905_0031981
693 Ga0395905_0100809
694 Ga0395905_0203494
695 Ga0395901_0001508
696 Ga0395901_0027120
697 Ga0439461_0002465
698 Ga0451853_1932493
699 Ga0450910_012331
700 Ga0439446_0002537
701 Ga0439434_0005358
702 Ga0466969_0000517
703 Ga0466965_0021083
704 Ga0466966_0000658
705 Ga0466961_0014555
706 Ga0466961_0080462
707 Ga0466963_0000990
708 Ga0466963_0001446
709 Ga0466963_0005744
710 Ga0466963_0006201
711 Ga0466963_0019200
712 Ga0466963_0021726
713 Ga0466963_0024378
714 Ga0466963_0031466
715 Ga0466964_0001161
716 Ga0466971_0021347
717 Ga0466968_0000648
718 Ga0466968_0040089
719 Ga0466970_0010368
720 Ga0466957_0016208
721 Ga0466957_0065238
722 Ga0466957_0093620
723 Ga0466960_0033379
724 Ga0466959_0000993
725 Ga0466959_0035839
726 Ga0466959_0116377
727 Ga0466958_0010940
728 Ga0466958_0037339
729 Ga0466958_0052147
730 Ga0466958_0086439
731 Ga0466967_0003700
732 Ga0466967_0024125
733 Ga0466967_0034977
734 Ga0466967_0036693
735 Ga0466967_0048762
736 Ga0466967_0055051
737 Ga0466967_0072757
738 Ga0466967_0089802
739 Ga0466967_0091020
740 Ga0466967_0154765
741 Ga0466967_0160880
742 Ga0466967_0204121
743 Ga0466967_0258151
744 Ga0495592_0000206
745 Ga0495629_0081236
746 Ga0495641_0002336
747 Ga0495651_0000001
748 Ga0495653_0000365
749 Ga0495653_0013327
750 Ga0495580_0050010
751 Ga0495582_0014516
752 Ga0495582_0015541
753 Ga0495662_0001461
754 Ga0495664_0155661
755 Ga0495584_0074853
756 Ga0495608_0003507
757 Ga0495618_0002253
758 Ga0495618_0018683
759 Ga0495628_0000047
760 Ga0495630_0002781
761 Ga0495666_0001601
762 Ga0495652_0000291
763 Ga0495665_0000431
764 Ga0495640_0050749
765 Ga0495586_0004812
766 Ga0495586_0039381
767 Ga0495587_0000540
768 Ga0495645_0000039
769 Ga0495634_0006091
770 Ga0495634_0139004
771 Ga0495659_0003050
772 Ga0495657_0075294
773 Ga0495599_0000063
774 Ga0495599_0062155
775 Ga0495623_0000214
776 Ga0495623_0142547
777 Ga0495646_0003212
778 Ga0495647_0000087
779 Ga0495658_0000999
780 Ga0495658_0009016
781 Ga0495624_0000454
782 Ga0495600_0001321
783 Ga0495581_0018049
784 Ga0495604_0000004
785 Ga0495674_0286790
786 Ga0495676_0005677
787 Ga0495676_0011449
788 Ga0495675_0000075
789 Ga0495675_0112284
790 Ga0495602_0136794
791 Ga0495614_0008055
792 Ga0496100_0002343
793 Ga0496100_0128467
794 Ga0496101_0248829
795 Ga0496102_0013755
796 Ga0496102_0026542
797 Ga0496102_0027385
798 Ga0496102_0313731
799 Ga0496103_0103594
800 Ga0496104_0083090
801 Ga0496104_0292775
802 Ga0496105_0044251
803 Ga0496105_0052323
804 Ga0496105_0055982
805 Ga0496106_0075136
806 Ga0496107_0004354
807 Ga0496107_0031577
808 Ga0496107_0037403
809 Ga0496107_0180207
810 Ga0496107_0194314
811 Ga0496108_0015303
812 Ga0496108_0047319
813 Ga0496109_0023761
814 Ga0496109_0077096
815 Ga0496110_0012673
816 Ga0496110_0083017
817 Ga0496112_0001071
818 Ga0496112_0003677
819 Ga0496112_0019392
820 Ga0496112_0054313
821 Ga0496112_0083682
822 Ga0496112_0083763
823 Ga0496112_0292845
824 Ga0496113_0045283
825 Ga0496113_0133514
826 Ga0496114_0002759
827 Ga0496114_0023303
828 Ga0496114_0058432
829 Ga0496114_0101063
830 Ga0496114_0146165
831 Ga0496114_0169984
832 Ga0496115_0030452
833 Ga0496115_0039616
834 Ga0496115_0143405
835 Ga0496115_0200558
836 Ga0501031_0000624
837 Ga0501031_0010531
838 Ga0501039_0291142
839 Ga0501040_0003671
840 Ga0501041_0024013
841 Ga0501042_0000265
842 Ga0501042_0021914
843 Ga0501046_0020235
844 Ga0501046_0021278
845 Ga0501046_0033894
846 Ga0501048_0011593
847 Ga0501067_0015629
848 Ga0501067_0048172
849 Ga0501067_0059882
850 Ga0501069_0000767
851 Ga0501069_0007689
852 Ga0501069_0015229
853 Ga0501071_0001012
854 Ga0501071_0002558
855 Ga0501072_0002483
856 Ga0501072_0010986
857 Ga0501073_0046724
858 Ga0501073_0101213
859 Ga0501075_0005345
860 Ga0501075_0015795
861 Ga0501075_0054537
862 Ga0501076_0000330
863 Ga0501076_0275345
864 Ga0501077_0003749
865 Ga0501079_0001382
866 Ga0501079_0004260
867 Ga0501080_0000972
868 Ga0501080_0045173
869 Ga0501080_0066295
870 Ga0501081_0002440
871 Ga0501081_0003558
872 Ga0501081_0037925
873 Ga0501083_0003233
874 Ga0501083_0030435
875 Ga0501045_0002155
876 Ga0501045_0003476
877 Ga0501045_0006061
878 nmdc:mga05p37_123272_c1
879 nmdc:mga05p37_460542_c1
880 nmdc:mga05p37_5166_c1
881 nmdc:mga09592_41968_c1
882 nmdc:mga0qj67_121087_c1
883 nmdc:mga08y16_77201_c1
884 nmdc:mga0n895_166062_c1
885 nmdc:mga0n895_37273_c1
886 nmdc:mga0n895_4497_c1
887 nmdc:mga08x19_6800_c1
888 nmdc:mga0a205_72699_c1
889 nmdc:mga0a205_78818_c1
890 Ga0495601_0000148
891 Ga0495601_0034890
892 Ga0495619_0002163
893 Ga0495619_0005535
894 Ga0501084_0003270
895 Ga0501084_0005671
896 Ga0501082_0009476
897 Ga0501082_0097704
898 Ga0530510_0013072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02784

Orn_Arg_deC_N

Pyridoxal-dependent decarboxylase, pyridoxal binding domain

67

305

0.91

PF00278

Orn_DAP_Arg_deC

Pyridoxal-dependent decarboxylase, C-terminal sheet domain

44

395

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x7n-assembly1.cif.gz_B crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum 0.9419 5 409
2p3e-assembly1.cif.gz_A crystal structure of aq1208 from aquifex aeolicus 0.9327 8 407
2qgh-assembly1.cif.gz_A-2 crystal structure of diaminopimelate decarboxylase from helicobacter pylori complexed with l-lysine 0.9289 24 409
1tuf-assembly1.cif.gz_A crystal structure of diaminopimelate decarboxylase from m. jannaschi 0.927 8 411
1hkw-assembly1.cif.gz_B mycobacterium diaminopimelate dicarboxylase (lysa) 0.9265 5 410
ID Description Score Start End Superfamily
af_Q2FYN4_284_419_2.40.37.10 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;Lyase, Ornithine Decarboxylase; Chain A, domain 1 0.9291 277 406 2.40.37.10
2qghA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9272 40 272 3.20.20.10
af_Q58497_297_438_2.40.37.10 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;Lyase, Ornithine Decarboxylase; Chain A, domain 1 0.9066 274 411 2.40.37.10
2p3eA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9045 40 272 3.20.20.10
2yxxA01 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;Lyase, Ornithine Decarboxylase; Chain A, domain 1 0.898 273 398 2.40.37.10
ID Description Score Start End GO Terms
AF-A0A535ETQ7-F1-model_v4 Orn/DAP/Arg decarboxylase 2 N-terminal domain-containing protein 0.9721 4 138 GO:0008836
GO:0009089
AF-A0A2G6NXP8-F1-model_v4 Diaminopimelate decarboxylase (DAP decarboxylase) (DAPDC) (EC 4.1.1.20) 0.9667 9 411 GO:0008836
GO:0009089
GO:0030170
AF-A0A6G2W080-F1-model_v4 Orn/DAP/Arg decarboxylase 2 N-terminal domain-containing protein 0.9636 1 122 GO:0008836
GO:0009089
AF-A0A523APR1-F1-model_v4 Diaminopimelate decarboxylase 0.9634 9 138 GO:0008836
GO:0009089
AF-A0A7V9I5J9-F1-model_v4 Diaminopimelate decarboxylase (DAP decarboxylase) (DAPDC) (EC 4.1.1.20) 0.9624 44 411 GO:0008836
GO:0009089
GO:0030170

Map