F446299

General Info

Members Datasets Scaffolds Average Seq Length
449 247 443 177

Family's Representative Sequence

Representative Sequence 3300003771|Ga0055526_1004180|Ga0055526_100418010
Length 195
Sequence MSAEAQVAWAQMLVGALSWSELGALMLHFLMLSLLSIGGAITTAPDMHRYLVDERHWLTDQSFTSSIALAQAAPGPNILFVAVLGFNVSGLLGAAAAMAGILLPSTTLVVAATRWARNNREHLGVRAFTVGMAPLTLGLMIATGWLLAAPYLVEPSHRWATLAMIVATVVLTMRTKIGIVWMVLAGGVLGALGVV

Samples

Sample ID Description Type Environment
1 2643221585 Pelomonas sp. Root662 Isolate Unclassified
2 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
3 2643221656 Pelomonas sp. Root405 Isolate Unclassified
4 2738541337 Pelomonas sp. BT06 Isolate Unclassified
5 2831864461 Roseateles noduli HZ7 Isolate Nodule
6 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
149 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
158 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
159 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
160 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
165 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
179 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
201 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
216 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
217 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
218 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
219 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
220 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
226 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
227 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
228 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
232 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
233 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
234 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
235 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
236 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
237 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
240 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
243 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
244 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
245 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0
Isolates 1.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.46
Nodule 0.22
Rhizoplane 4.23
Rhizosphere 82.18
Stem 0
Stem Tuber 0
Unclassified 6.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10010320 3300003316 Bacteria 29974
2 rootH1_10085216 3300003316 Bacteria 1011
3 rootH1_10119123 3300003316 Bacteria 1206
4 rootL2_10000057 3300003322 Bacteria 97630
5 rootL2_10004912 3300003322 Bacteria 2813
6 rootL2_10006108 3300003322 Bacteria 12742
7 rootL2_10008165 3300003322 Bacteria 1976
8 rootH1_10100139 3300003323 Bacteria 1621
9 rootH1_10184542 3300003323 Bacteria 1363
10 JGI25161J50226_1014909 3300003374 Bacteria 859
11 Ga0055526_1004180 3300003771 Bacteria 8782
12 Ga0055543_1001773 3300004625 Bacteria 8044
13 Ga0065165_1000281 3300005262 Bacteria 86863
14 Ga0070658_10081757 3300005327 Bacteria 2654
15 Ga0070676_10017399 3300005328 Bacteria 3980
16 Ga0070676_10070977 3300005328 Bacteria 2091
17 Ga0070676_10100126 3300005328 Bacteria 1789
18 Ga0070670_100001412 3300005331 Bacteria 19300
19 Ga0070677_10101885 3300005333 Bacteria 1267
20 Ga0068869_100000344 3300005334 Bacteria 24865
21 Ga0068869_100083525 3300005334 Bacteria 2389
22 Ga0070680_100560957 3300005336 Bacteria 979
23 Ga0070680_100738503 3300005336 Bacteria 847
24 Ga0070682_100352700 3300005337 Bacteria 1097
25 Ga0068868_100051037 3300005338 Bacteria 3251
26 Ga0068868_100061610 3300005338 Bacteria 2972
27 Ga0068868_100254086 3300005338 Unclassified 1480
28 Ga0068868_100427570 3300005338 Bacteria 1148
29 Ga0070660_100015075 3300005339 Bacteria 5577
30 Ga0070660_101147068 3300005339 Bacteria 658
31 Ga0070689_100001735 3300005340 Bacteria 13949
32 Ga0070689_100535797 3300005340 Bacteria 1007
33 Ga0070691_10019015 3300005341 Bacteria 3166
34 Ga0070691_10342104 3300005341 Bacteria 828
35 Ga0070687_100023358 3300005343 Bacteria 2938
36 Ga0070692_10115114 3300005345 Bacteria 1492
37 Ga0070668_100000854 3300005347 Bacteria 21147
38 Ga0070668_101066442 3300005347 Bacteria 728
39 Ga0070669_100004774 3300005353 Bacteria 9776
40 Ga0070675_100072211 3300005354 Bacteria 2865
41 Ga0070675_100482403 3300005354 Unclassified 1115
42 Ga0070671_100040900 3300005355 Bacteria 3852
43 Ga0070674_100311319 3300005356 Bacteria 1259
44 Ga0070673_100101174 3300005364 Unclassified 2374
45 Ga0070673_100114180 3300005364 Bacteria 2244
46 Ga0070673_100655945 3300005364 Unclassified 961
47 Ga0070673_101424574 3300005364 Unclassified 652
48 Ga0070667_100009725 3300005367 Bacteria 7971
49 Ga0070667_100062162 3300005367 Bacteria 3163
50 Ga0070667_100630395 3300005367 Bacteria 989
51 Ga0070703_10063494 3300005406 Bacteria 1214
52 Ga0070701_10006021 3300005438 Bacteria 5066
53 Ga0070705_100041305 3300005440 Bacteria 2629
54 Ga0070700_100000629 3300005441 Bacteria 17515
55 Ga0070700_100006522 3300005441 Bacteria 6241
56 Ga0070694_100039109 3300005444 Bacteria 3155
57 Ga0070663_100134697 3300005455 Bacteria 1880
58 Ga0070663_100388259 3300005455 Bacteria 1138
59 Ga0070678_100147100 3300005456 Unclassified 1893
60 Ga0070678_100449605 3300005456 Bacteria 1128
61 Ga0070681_10054594 3300005458 Bacteria 3981
62 Ga0070681_11058276 3300005458 Bacteria 732
63 Ga0068867_100000047 3300005459 Bacteria 74014
64 Ga0068867_100001610 3300005459 Bacteria 15686
65 Ga0068867_100004244 3300005459 Bacteria 10087
66 Ga0068867_100062431 3300005459 Bacteria 2768
67 Ga0068867_100079070 3300005459 Bacteria 2475
68 Ga0068867_100955796 3300005459 Bacteria 774
69 Ga0070685_10071949 3300005466 Unclassified 2051
70 Ga0070685_10257257 3300005466 Bacteria 1159
71 Ga0070707_100761513 3300005468 Bacteria 932
72 Ga0070679_100001812 3300005530 Bacteria 19273
73 Ga0070679_100048008 3300005530 Bacteria 4254
74 Ga0070679_100298626 3300005530 Bacteria 1561
75 Ga0070679_100813097 3300005530 Bacteria 878
76 Ga0070684_100072405 3300005535 Bacteria 3034
77 Ga0068853_100011967 3300005539 Bacteria 7057
78 Ga0068853_100073295 3300005539 Bacteria 2985
79 Ga0068853_100123283 3300005539 Bacteria 2314
80 Ga0068853_101189587 3300005539 Unclassified 736
81 Ga0070686_100001090 3300005544 Bacteria 15641
82 Ga0070695_100322553 3300005545 Bacteria 1149
83 Ga0070695_100885394 3300005545 Unclassified 720
84 Ga0070696_100004741 3300005546 Bacteria 9090
85 Ga0070693_100062355 3300005547 Bacteria 2170
86 Ga0070665_100141279 3300005548 Bacteria 2411
87 Ga0070665_100252165 3300005548 Bacteria 1765
88 Ga0070704_100452778 3300005549 Bacteria 1105
89 Ga0068855_100001026 3300005563 Bacteria 34816
90 Ga0068855_100248194 3300005563 Bacteria 1986
91 Ga0068857_100008028 3300005577 Bacteria 9103
92 Ga0068857_100127683 3300005577 Bacteria 2292
93 Ga0068857_100243194 3300005577 Bacteria 1648
94 Ga0068854_100058911 3300005578 Bacteria 2774
95 Ga0068854_100168893 3300005578 Bacteria 1700
96 Ga0068856_100123805 3300005614 Bacteria 2588
97 Ga0068856_100141568 3300005614 Bacteria 2413
98 Ga0068856_100310950 3300005614 Bacteria 1593
99 Ga0070702_100000117 3300005615 Bacteria 24144
100 Ga0070702_100143187 3300005615 Bacteria 1525
101 Ga0068859_100002546 3300005617 Bacteria 18510
102 Ga0068859_100019479 3300005617 Bacteria 6816
103 Ga0068859_100041774 3300005617 Bacteria 4605
104 Ga0068859_100171587 3300005617 Bacteria 2250
105 Ga0068859_100564739 3300005617 Bacteria 1232
106 Ga0068864_100002924 3300005618 Bacteria 14129
107 Ga0068864_100033287 3300005618 Bacteria 4382
108 Ga0068864_100108869 3300005618 Unclassified 2466
109 Ga0068866_10000515 3300005718 Bacteria 17880
110 Ga0068861_100002077 3300005719 Bacteria 12987
111 Ga0068861_100044832 3300005719 Bacteria 3327
112 Ga0068861_100229144 3300005719 Bacteria 1575
113 Ga0068870_10031148 3300005840 Bacteria 2700
114 Ga0068870_10191496 3300005840 Unclassified 1234
115 Ga0068863_100132046 3300005841 Unclassified 2384
116 Ga0068863_100648723 3300005841 Bacteria 1047
117 Ga0068863_101213636 3300005841 Bacteria 760
118 Ga0068858_100000492 3300005842 Bacteria 41287
119 Ga0068858_100007798 3300005842 Bacteria 10334
120 Ga0068858_100075788 3300005842 Unclassified 3125
121 Ga0068858_100146554 3300005842 Bacteria 2217
122 Ga0068860_100758390 3300005843 Bacteria 982
123 Ga0068860_100906571 3300005843 Bacteria 898
124 Ga0068862_100005405 3300005844 Bacteria 10674
125 Ga0068862_100006282 3300005844 Bacteria 9887
126 Ga0068862_100884247 3300005844 Unclassified 877
127 Ga0075366_10006826 3300006195 Bacteria 6278
128 Ga0075366_10280830 3300006195 Bacteria 1018
129 Ga0097621_100002682 3300006237 Bacteria 12178
130 Ga0075370_10062746 3300006353 Bacteria 2118
131 Ga0068871_100002071 3300006358 Bacteria 13572
132 Ga0068871_100027480 3300006358 Bacteria 4451
133 Ga0068865_100000773 3300006881 Bacteria 17950
134 Ga0068865_100073674 3300006881 Bacteria 2429
135 Ga0068865_100091997 3300006881 Unclassified 2203
136 Ga0068865_100271332 3300006881 Bacteria 1347
137 Ga0097620_100002546 3300006931 Bacteria 18510
138 Ga0097620_100019479 3300006931 Bacteria 6816
139 Ga0097620_100041775 3300006931 Bacteria 4605
140 Ga0097620_100171593 3300006931 Bacteria 2250
141 Ga0097620_100564736 3300006931 Bacteria 1232
142 Ga0105240_10003193 3300009093 Bacteria 25753
143 Ga0105240_10009597 3300009093 Bacteria 13694
144 Ga0105240_10549511 3300009093 Bacteria 1278
145 Ga0105245_10000368 3300009098 Bacteria 42262
146 Ga0105245_10055490 3300009098 Bacteria 3558
147 Ga0105245_11241490 3300009098 Bacteria 793
148 Ga0105247_10003423 3300009101 Bacteria 10360
149 Ga0105247_10124346 3300009101 Bacteria 1675
150 Ga0105247_10199421 3300009101 Unclassified 1344
151 Ga0105243_10002735 3300009148 Bacteria 14665
152 Ga0105243_10088185 3300009148 Bacteria 2548
153 Ga0105243_10122102 3300009148 Bacteria 2198
154 Ga0105243_10942748 3300009148 Bacteria 862
155 Ga0105241_10005603 3300009174 Bacteria 9272
156 Ga0105241_10260585 3300009174 Bacteria 1473
157 Ga0105241_10898973 3300009174 Bacteria 822
158 Ga0105242_10007095 3300009176 Bacteria 8653
159 Ga0105242_10729350 3300009176 Bacteria 973
160 Ga0105242_10795224 3300009176 Bacteria 936
161 Ga0105248_10001495 3300009177 Bacteria 26017
162 Ga0105248_10001649 3300009177 Bacteria 24825
163 Ga0105248_10109049 3300009177 Unclassified 3121
164 Ga0105237_10002497 3300009545 Bacteria 22814
165 Ga0105237_10160272 3300009545 Bacteria 2248
166 Ga0105237_11438260 3300009545 Bacteria 696
167 Ga0105238_10006261 3300009551 Bacteria 11823
168 Ga0105249_10106778 3300009553 Bacteria 2642
169 Ga0105239_10001816 3300010375 Bacteria 27990
170 Ga0105239_10021225 3300010375 Bacteria 7161
171 Ga0105239_10195770 3300010375 Bacteria 2263
172 Ga0105246_10123159 3300011119 Bacteria 1924
173 Ga0105246_10248924 3300011119 Bacteria 1409
174 Ga0157369_10403255 3300013105 Bacteria 1418
175 Ga0157374_10114454 3300013296 Bacteria 2597
176 Ga0157374_10175476 3300013296 Bacteria 2092
177 Ga0157378_10002007 3300013297 Bacteria 18205
178 Ga0157378_10184600 3300013297 Bacteria 1964
179 Ga0157378_11004792 3300013297 Bacteria 869
180 Ga0163162_10035556 3300013306 Bacteria 4962
181 Ga0163162_10137002 3300013306 Bacteria 2559
182 Ga0157372_11151193 3300013307 Unclassified 897
183 Ga0157375_10055649 3300013308 Bacteria 3902
184 Ga0157375_10160893 3300013308 Bacteria 2387
185 Ga0157375_10370793 3300013308 Bacteria 1598
186 Ga0157375_10402476 3300013308 Bacteria 1535
187 Ga0157375_10776737 3300013308 Bacteria 1108
188 Ga0163163_10001402 3300014325 Bacteria 20329
189 Ga0163163_10762776 3300014325 Bacteria 1031
190 Ga0157380_10000610 3300014326 Bacteria 22041
191 Ga0157380_10724813 3300014326 Unclassified 1002
192 Ga0157379_10000172 3300014968 Bacteria 48686
193 Ga0157379_10584778 3300014968 Unclassified 1041
194 Ga0157376_10017647 3300014969 Bacteria 5451
195 Ga0157376_10650083 3300014969 Unclassified 1055
196 Ga0213872_10000618 3300021361 Bacteria 26906
197 Ga0213872_10001074 3300021361 Bacteria 18845
198 Ga0213872_10017178 3300021361 Bacteria 3348
199 Ga0209673_1016431 3300025273 Bacteria 2768
200 Ga0209564_1000005 3300025295 Bacteria 1147192
201 Ga0207642_10010931 3300025899 Bacteria 3220
202 Ga0207642_10103293 3300025899 Unclassified 1435
203 Ga0207710_10094865 3300025900 Unclassified 1401
204 Ga0207710_10258466 3300025900 Bacteria 872
205 Ga0207645_10058003 3300025907 Bacteria 2472
206 Ga0207645_10452389 3300025907 Bacteria 867
207 Ga0207643_10068104 3300025908 Bacteria 2044
208 Ga0207705_10520790 3300025909 Bacteria 924
209 Ga0207654_10141194 3300025911 Bacteria 1536
210 Ga0207654_10484403 3300025911 Bacteria 871
211 Ga0207707_10008586 3300025912 Bacteria 8856
212 Ga0207695_10016902 3300025913 Bacteria 8515
213 Ga0207695_10147181 3300025913 Bacteria 2298
214 Ga0207671_10023801 3300025914 Bacteria 4615
215 Ga0207671_10115830 3300025914 Bacteria 2043
216 Ga0207671_10301626 3300025914 Bacteria 1266
217 Ga0207660_10629190 3300025917 Bacteria 875
218 Ga0207662_10057723 3300025918 Bacteria 2320
219 Ga0207657_10114239 3300025919 Bacteria 2227
220 Ga0207657_10885770 3300025919 Bacteria 688
221 Ga0207652_10090657 3300025921 Bacteria 2687
222 Ga0207652_10581586 3300025921 Bacteria 1005
223 Ga0207652_10800495 3300025921 Unclassified 837
224 Ga0207652_11025296 3300025921 Unclassified 724
225 Ga0207646_10461446 3300025922 Bacteria 1146
226 Ga0207681_10004236 3300025923 Bacteria 8858
227 Ga0207681_10345933 3300025923 Bacteria 1189
228 Ga0207694_10171828 3300025924 Bacteria 1755
229 Ga0207650_10016851 3300025925 Bacteria 5111
230 Ga0207659_10151764 3300025926 Bacteria 1810
231 Ga0207687_10005786 3300025927 Bacteria 8182
232 Ga0207687_10038342 3300025927 Bacteria 3274
233 Ga0207687_10796082 3300025927 Bacteria 806
234 Ga0207644_10028602 3300025931 Bacteria 3861
235 Ga0207644_10069311 3300025931 Bacteria 2575
236 Ga0207686_10001174 3300025934 Bacteria 15148
237 Ga0207709_10175363 3300025935 Bacteria 1509
238 Ga0207709_10247997 3300025935 Bacteria 1299
239 Ga0207709_10425728 3300025935 Bacteria 1021
240 Ga0207670_10156491 3300025936 Bacteria 1697
241 Ga0207670_10409325 3300025936 Bacteria 1086
242 Ga0207704_10000449 3300025938 Bacteria 18375
243 Ga0207704_10123929 3300025938 Bacteria 1775
244 Ga0207704_10322242 3300025938 Unclassified 1193
245 Ga0207711_10013200 3300025941 Bacteria 6863
246 Ga0207711_10021688 3300025941 Bacteria 5366
247 Ga0207689_10000075 3300025942 Bacteria 80691
248 Ga0207689_10000088 3300025942 Bacteria 74315
249 Ga0207689_10003137 3300025942 Bacteria 15170
250 Ga0207689_10019375 3300025942 Bacteria 5736
251 Ga0207667_10046696 3300025949 Bacteria 4586
252 Ga0207667_10200945 3300025949 Bacteria 2045
253 Ga0207651_10096487 3300025960 Bacteria 2180
254 Ga0207651_10939471 3300025960 Bacteria 771
255 Ga0207712_10063466 3300025961 Bacteria 2630
256 Ga0207668_10000941 3300025972 Bacteria 17535
257 Ga0207658_10005528 3300025986 Bacteria 8663
258 Ga0207658_10209361 3300025986 Bacteria 1633
259 Ga0207677_10008513 3300026023 Bacteria 5736
260 Ga0207677_10009819 3300026023 Bacteria 5394
261 Ga0207677_10299044 3300026023 Bacteria 1329
262 Ga0207677_10409622 3300026023 Bacteria 1152
263 Ga0207703_10010856 3300026035 Bacteria 7102
264 Ga0207703_10013688 3300026035 Bacteria 6322
265 Ga0207703_10047196 3300026035 Unclassified 3472
266 Ga0207639_10040154 3300026041 Bacteria 3491
267 Ga0207639_10224026 3300026041 Bacteria 1626
268 Ga0207678_10152198 3300026067 Bacteria 1975
269 Ga0207708_10000090 3300026075 Bacteria 71734
270 Ga0207708_10035474 3300026075 Bacteria 3795
271 Ga0207708_10101907 3300026075 Bacteria 2222
272 Ga0207702_10089132 3300026078 Bacteria 2697
273 Ga0207702_10105409 3300026078 Bacteria 2497
274 Ga0207641_10035156 3300026088 Bacteria 4173
275 Ga0207641_10801882 3300026088 Bacteria 931
276 Ga0207648_10000202 3300026089 Bacteria 63315
277 Ga0207648_10001429 3300026089 Bacteria 26298
278 Ga0207648_10046887 3300026089 Unclassified 3788
279 Ga0207648_10104808 3300026089 Bacteria 2481
280 Ga0207676_10004655 3300026095 Bacteria 9716
281 Ga0207676_10021123 3300026095 Bacteria 4774
282 Ga0207676_10092454 3300026095 Unclassified 2488
283 Ga0207674_10005461 3300026116 Bacteria 15097
284 Ga0207674_10032261 3300026116 Bacteria 5496
285 Ga0207674_10346839 3300026116 Bacteria 1435
286 Ga0207675_100001897 3300026118 Bacteria 20889
287 Ga0207675_100011121 3300026118 Bacteria 8433
288 Ga0207675_100032818 3300026118 Bacteria 4837
289 Ga0207675_101104650 3300026118 Bacteria 813
290 Ga0207683_10797303 3300026121 Bacteria 877
291 Ga0209371_1021943 3300027312 Bacteria 1537
292 Ga0268266_10142346 3300028379 Bacteria 2153
293 Ga0268266_10442224 3300028379 Bacteria 1235
294 Ga0268265_10006025 3300028380 Bacteria 8249
295 Ga0268265_10006089 3300028380 Bacteria 8191
296 Ga0268265_10801805 3300028380 Unclassified 918
297 Ga0268264_10006452 3300028381 Bacteria 9876
298 Ga0268264_10007073 3300028381 Bacteria 9403
299 Ga0268264_11187495 3300028381 Bacteria 772
300 Ga0307517_10000150 3300028786 Bacteria 110446
301 Ga0307517_10138965 3300028786 Bacteria 1714
302 Ga0307515_10017631 3300028794 Bacteria 12990
303 Ga0307515_10095902 3300028794 Bacteria 3644
304 Ga0307515_10401528 3300028794 Bacteria 996
305 Ga0268256_1026721 3300030500 Bacteria 1447
306 Ga0265329_10073394 3300031242 Bacteria 1083
307 Ga0265331_10001374 3300031250 Bacteria 17891
308 Ga0265327_10000078 3300031251 Bacteria 207398
309 Ga0265327_10166224 3300031251 Bacteria 1016
310 Ga0307513_10744393 3300031456 Unclassified 686
311 Ga0307509_10000092 3300031507 Bacteria 124019
312 Ga0307509_10005769 3300031507 Bacteria 17025
313 Ga0307509_10005994 3300031507 Bacteria 16597
314 Ga0307509_10085390 3300031507 Bacteria 3248
315 Ga0307408_100000030 3300031548 Bacteria 223389
316 Ga0307408_100239691 3300031548 Bacteria 1490
317 Ga0307408_100535172 3300031548 Bacteria 1031
318 Ga0307508_10000594 3300031616 Bacteria 43299
319 Ga0307508_10001639 3300031616 Bacteria 24934
320 Ga0307508_10277295 3300031616 Bacteria 1270
321 Ga0307508_10449300 3300031616 Bacteria 881
322 Ga0307516_10139529 3300031730 Bacteria 2195
323 Ga0307516_10233061 3300031730 Bacteria 1544
324 Ga0307507_10122437 3300033179 Bacteria 2074
325 Ga0373948_0001121 3300034817 Bacteria 3631
326 Ga0373959_0115853 3300034820 Bacteria 651
327 Ga0373949_0288856 3300035090 Bacteria 517
328 Ga0373923_0308081 3300035111 Unclassified 750
329 Ga0373939_0000869 3300035114 Bacteria 7476
330 Ga0373960_0001233 3300035121 Bacteria 5605
331 Ga0373960_0049560 3300035121 Unclassified 1242
332 Ga0373942_0191705 3300035207 Bacteria 674
333 Ga0373961_0238238 3300035241 Bacteria 654
334 Ga0373931_0000150 3300035691 Bacteria 30766
335 Ga0373937_0397416 3300036401 Bacteria 1308
336 Ga0395900_0570188 3300037418 Bacteria 1075
337 Ga0395898_1027746 3300037466 Bacteria 759
338 Ga0395905_0000678 3300037471 Bacteria 45181
339 Ga0395905_0029615 3300037471 Bacteria 5159
340 Ga0395905_0099816 3300037471 Bacteria 2726
341 Ga0436361_0008791 3300039447 Bacteria 1664
342 Ga0436361_0371806 3300039447 Bacteria 51714
343 Ga0436361_0507490 3300039447 Bacteria 19202
344 Ga0436361_0513759 3300039447 Bacteria 41887
345 Ga0436361_0794512 3300039447 Bacteria 6538
346 Ga0450890_002146 3300042127 Bacteria 2754
347 Ga0451577_0068516 3300042876 Bacteria 3164
348 Ga0466963_0294861 3300044694 Bacteria 1140
349 Ga0453684_1364278 3300044712 Bacteria 737
350 Ga0451576_0000545 3300045051 Bacteria 80903
351 Ga0451576_0039796 3300045051 Bacteria 4976
352 Ga0495592_0009238 3300046454 Bacteria 7415
353 Ga0495590_0005009 3300046457 Bacteria 5282
354 Ga0495620_0163973 3300046515 Bacteria 863
355 Ga0495632_0097872 3300046519 Bacteria 1384
356 Ga0495648_0165222 3300046524 Bacteria 1140
357 Ga0495625_0477217 3300046660 Bacteria 766
358 Ga0495658_0013961 3300046683 Bacteria 4096
359 Ga0495658_0234840 3300046683 Bacteria 1151
360 Ga0495658_0771687 3300046683 Bacteria 615
361 Ga0495670_0068328 3300046691 Bacteria 1795
362 Ga0495660_0391314 3300046810 Bacteria 610
363 Ga0495676_0175151 3300047321 Bacteria 1507
364 Ga0495593_0014040 3300047673 Bacteria 4560
365 Ga0496101_0342024 3300048904 Bacteria 1175
366 Ga0496101_0799320 3300048904 Bacteria 744
367 Ga0496102_0103684 3300048905 Bacteria 2645
368 Ga0496103_0237852 3300048906 Bacteria 1171
369 Ga0496104_0026843 3300048907 Bacteria 5323
370 Ga0496104_0664344 3300048907 Bacteria 951
371 Ga0496105_0582957 3300048908 Bacteria 870
372 Ga0496106_0003730 3300048909 Bacteria 11366
373 Ga0496106_0073063 3300048909 Bacteria 2623
374 Ga0496106_0349214 3300048909 Bacteria 1188
375 Ga0496108_0229209 3300048911 Bacteria 1615
376 Ga0496108_0367545 3300048911 Bacteria 1256
377 Ga0496108_0723163 3300048911 Bacteria 862
378 Ga0496109_0008085 3300048912 Bacteria 8917
379 Ga0496109_0134443 3300048912 Bacteria 2310
380 Ga0496111_0097453 3300048914 Bacteria 2159
381 Ga0496112_0198476 3300048915 Bacteria 1966
382 Ga0496113_0091989 3300048916 Bacteria 2339
383 Ga0496113_0823150 3300048916 Bacteria 737
384 Ga0496124_0041812 3300048927 Bacteria 3951
385 Ga0501291_050593 3300049514 Bacteria 756
386 Ga0501300_002646 3300049523 Bacteria 2685
387 Ga0501032_0159379 3300049569 Bacteria 1482
388 Ga0501032_0180549 3300049569 Bacteria 1382
389 Ga0501034_0000643 3300049571 Bacteria 54170
390 Ga0501034_0014697 3300049571 Bacteria 8059
391 Ga0501034_0605908 3300049571 Bacteria 1000
392 Ga0501039_0024530 3300049575 Bacteria 4633
393 Ga0501039_0451945 3300049575 Bacteria 1009
394 Ga0501039_0809164 3300049575 Bacteria 731
395 Ga0501040_0870858 3300049576 Bacteria 652
396 Ga0501041_0266058 3300049577 Bacteria 1078
397 Ga0501041_0846745 3300049577 Bacteria 587
398 Ga0501043_0458940 3300049579 Bacteria 956
399 Ga0501068_0181852 3300049584 Bacteria 1329
400 Ga0501071_0425339 3300049587 Bacteria 1015
401 Ga0501072_0157082 3300049588 Bacteria 1813
402 Ga0501073_0005486 3300049589 Bacteria 9504
403 Ga0501074_0148710 3300049590 Bacteria 1675
404 Ga0501076_0308442 3300049592 Bacteria 1298
405 Ga0501076_0319277 3300049592 Bacteria 1274
406 Ga0501077_0160745 3300049593 Bacteria 1426
407 Ga0501199_008275 3300049650 Bacteria 1086
408 Ga0501207_061297 3300049654 Bacteria 690
409 Ga0501222_016930 3300049662 Bacteria 965
410 Ga0501223_013344 3300049663 Bacteria 1637
411 Ga0501255_000334 3300049684 Bacteria 3075
412 Ga0501221_002392 3300049704 Bacteria 3101
413 Ga0501225_0057608 3300049705 Bacteria 1089
414 Ga0501229_000814 3300049706 Bacteria 3527
415 Ga0501079_0204918 3300049741 Bacteria 1541
416 Ga0501079_0288631 3300049741 Bacteria 1283
417 Ga0501080_0037832 3300049742 Bacteria 4505
418 Ga0501262_011055 3300049759 Bacteria 1137
419 Ga0501267_003218 3300049764 Bacteria 1481
420 Ga0501272_011952 3300049769 Bacteria 982
421 Ga0501283_020376 3300049779 Bacteria 1057
422 nmdc:mga0k408_227868_c1 3300050493 Bacteria 1112
423 nmdc:mga0k408_6744_c1 3300050493 Bacteria 6126
424 nmdc:mga07m45_82386_c1 3300050496 Bacteria 1837
425 Ga0500578_0011609 3300053086 Bacteria 5690
426 Ga0500644_0007056 3300053088 Bacteria 2909
427 Ga0500651_0038434 3300053093 Bacteria 3015
428 Ga0500648_205437 3300053097 Unclassified 984
429 Ga0500562_114431 3300053108 Bacteria 735
430 Ga0500594_0009737 3300053118 Bacteria 2218
431 Ga0500559_0000017 3300053136 Bacteria 143646
432 Ga0500568_0223702 3300053139 Bacteria 687
433 Ga0500590_002156 3300053148 Bacteria 8560
434 Ga0500590_026449 3300053148 Bacteria 3010
435 Ga0500604_0239873 3300053151 Bacteria 627
436 Ga0500616_0070706 3300053153 Bacteria 1781
437 Ga0500619_000044 3300053154 Bacteria 38579
438 Ga0500622_0001793 3300053156 Bacteria 16373
439 Ga0500622_0007066 3300053156 Bacteria 6417
440 Ga0500637_0433691 3300053178 Bacteria 672
441 Ga0500645_002006 3300053730 Bacteria 9541
442 Ga0501084_1024754 3300054114 Bacteria 693
443 Ga0501082_0591205 3300060353 Bacteria 971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300034820 Ga0373959_0115853 Ga0373959_0115853_198_632 125
2 3300048916 Ga0496113_0823150 Ga0496113_0823150_263_697 125
3 3300035090 Ga0373949_0288856 Ga0373949_0288856_12_461 130
4 3300037418 Ga0395900_0570188 Ga0395900_0570188_607_1062 131
5 3300031548 Ga0307408_100535172 Ga0307408_1005351722 146
6 3300048907 Ga0496104_0026843 Ga0496104_0026843_2207_2719 150
7 3300009174 Ga0105241_10898973 Ga0105241_108989731 151
8 3300021361 Ga0213872_10001074 Ga0213872_1000107417 151
9 3300039447 Ga0436361_0507490 Ga0436361_0507490_18604_19149 151
10 3300009177 Ga0105248_10001495 Ga0105248_1000149516 152
11 3300025931 Ga0207644_10069311 Ga0207644_100693112 152
12 3300042876 Ga0451577_0068516 Ga0451577_0068516_1457_1981 152
13 3300045051 Ga0451576_0000545 Ga0451576_0000545_41562_42086 152
14 3300048904 Ga0496101_0799320 Ga0496101_0799320_27_545 152
15 3300048911 Ga0496108_0723163 Ga0496108_0723163_145_663 152
16 3300048912 Ga0496109_0134443 Ga0496109_0134443_1514_2032 152
17 3300048915 Ga0496112_0198476 Ga0496112_0198476_1229_1747 152
18 3300048916 Ga0496113_0091989 Ga0496113_0091989_579_1097 152
19 3300025912 Ga0207707_10008586 Ga0207707_100085869 154
20 3300031251 Ga0265327_10166224 Ga0265327_101662242 154
21 3300049571 Ga0501034_0605908 Ga0501034_0605908_233_757 154
22 3300005327 Ga0070658_10081757 Ga0070658_100817571 155
23 3300005328 Ga0070676_10017399 Ga0070676_100173993 155
24 3300005328 Ga0070676_10070977 Ga0070676_100709772 155
25 3300005328 Ga0070676_10100126 Ga0070676_101001261 155
26 3300005331 Ga0070670_100001412 Ga0070670_1000014123 155
27 3300005333 Ga0070677_10101885 Ga0070677_101018851 155
28 3300005334 Ga0068869_100000344 Ga0068869_1000003444 155
29 3300005334 Ga0068869_100083525 Ga0068869_1000835253 155
30 3300005336 Ga0070680_100560957 Ga0070680_1005609571 155
31 3300005336 Ga0070680_100738503 Ga0070680_1007385031 155
32 3300005337 Ga0070682_100352700 Ga0070682_1003527001 155
33 3300005338 Ga0068868_100051037 Ga0068868_1000510373 155
34 3300005338 Ga0068868_100061610 Ga0068868_1000616104 155
35 3300005338 Ga0068868_100254086 Ga0068868_1002540861 155
36 3300005338 Ga0068868_100427570 Ga0068868_1004275702 155
37 3300005339 Ga0070660_100015075 Ga0070660_1000150755 155
38 3300005339 Ga0070660_101147068 Ga0070660_1011470681 155
39 3300005340 Ga0070689_100001735 Ga0070689_1000017355 155
40 3300005340 Ga0070689_100535797 Ga0070689_1005357972 155
41 3300005341 Ga0070691_10019015 Ga0070691_100190152 155
42 3300005341 Ga0070691_10342104 Ga0070691_103421042 155
43 3300005343 Ga0070687_100023358 Ga0070687_1000233583 155
44 3300005345 Ga0070692_10115114 Ga0070692_101151142 155
45 3300005347 Ga0070668_100000854 Ga0070668_1000008549 155
46 3300005347 Ga0070668_101066442 Ga0070668_1010664422 155
47 3300005353 Ga0070669_100004774 Ga0070669_1000047748 155
48 3300005354 Ga0070675_100072211 Ga0070675_1000722113 155
49 3300005354 Ga0070675_100482403 Ga0070675_1004824031 155
50 3300005356 Ga0070674_100311319 Ga0070674_1003113192 155
51 3300005364 Ga0070673_100101174 Ga0070673_1001011743 155
52 3300005364 Ga0070673_100114180 Ga0070673_1001141802 155
53 3300005364 Ga0070673_100655945 Ga0070673_1006559452 155
54 3300005364 Ga0070673_101424574 Ga0070673_1014245741 155
55 3300005367 Ga0070667_100009725 Ga0070667_1000097254 155
56 3300005406 Ga0070703_10063494 Ga0070703_100634941 155
57 3300005438 Ga0070701_10006021 Ga0070701_100060213 155
58 3300005440 Ga0070705_100041305 Ga0070705_1000413052 155
59 3300005441 Ga0070700_100000629 Ga0070700_10000062915 155
60 3300005441 Ga0070700_100006522 Ga0070700_1000065223 155
61 3300005444 Ga0070694_100039109 Ga0070694_1000391093 155
62 3300005455 Ga0070663_100134697 Ga0070663_1001346972 155
63 3300005455 Ga0070663_100388259 Ga0070663_1003882592 155
64 3300005456 Ga0070678_100147100 Ga0070678_1001471001 155
65 3300005456 Ga0070678_100449605 Ga0070678_1004496051 155
66 3300005458 Ga0070681_10054594 Ga0070681_100545942 155
67 3300005458 Ga0070681_11058276 Ga0070681_110582761 155
68 3300005459 Ga0068867_100001610 Ga0068867_10000161016 155
69 3300005459 Ga0068867_100004244 Ga0068867_1000042442 155
70 3300005459 Ga0068867_100062431 Ga0068867_1000624312 155
71 3300005459 Ga0068867_100079070 Ga0068867_1000790702 155
72 3300005459 Ga0068867_100955796 Ga0068867_1009557961 155
73 3300005466 Ga0070685_10071949 Ga0070685_100719492 155
74 3300005466 Ga0070685_10257257 Ga0070685_102572572 155
75 3300005468 Ga0070707_100761513 Ga0070707_1007615131 155
76 3300005530 Ga0070679_100001812 Ga0070679_10000181217 155
77 3300005530 Ga0070679_100048008 Ga0070679_1000480085 155
78 3300005530 Ga0070679_100298626 Ga0070679_1002986262 155
79 3300005530 Ga0070679_100813097 Ga0070679_1008130972 155
80 3300005535 Ga0070684_100072405 Ga0070684_1000724052 155
81 3300005539 Ga0068853_100011967 Ga0068853_1000119677 155
82 3300005539 Ga0068853_100073295 Ga0068853_1000732954 155
83 3300005539 Ga0068853_100123283 Ga0068853_1001232834 155
84 3300005539 Ga0068853_101189587 Ga0068853_1011895871 155
85 3300005544 Ga0070686_100001090 Ga0070686_1000010906 155
86 3300005545 Ga0070695_100322553 Ga0070695_1003225532 155
87 3300005545 Ga0070695_100885394 Ga0070695_1008853941 155
88 3300005546 Ga0070696_100004741 Ga0070696_1000047414 155
89 3300005547 Ga0070693_100062355 Ga0070693_1000623552 155
90 3300005548 Ga0070665_100141279 Ga0070665_1001412793 155
91 3300005549 Ga0070704_100452778 Ga0070704_1004527781 155
92 3300005563 Ga0068855_100001026 Ga0068855_10000102619 155
93 3300005563 Ga0068855_100248194 Ga0068855_1002481942 155
94 3300005577 Ga0068857_100008028 Ga0068857_1000080283 155
95 3300005577 Ga0068857_100127683 Ga0068857_1001276832 155
96 3300005577 Ga0068857_100243194 Ga0068857_1002431942 155
97 3300005578 Ga0068854_100058911 Ga0068854_1000589114 155
98 3300005578 Ga0068854_100168893 Ga0068854_1001688933 155
99 3300005614 Ga0068856_100141568 Ga0068856_1001415684 155
100 3300005614 Ga0068856_100310950 Ga0068856_1003109502 155
101 3300005615 Ga0070702_100000117 Ga0070702_10000011712 155
102 3300005615 Ga0070702_100143187 Ga0070702_1001431872 155
103 3300005617 Ga0068859_100002546 Ga0068859_10000254611 155
104 3300005617 Ga0068859_100019479 Ga0068859_1000194794 155
105 3300005617 Ga0068859_100041774 Ga0068859_1000417743 155
106 3300005617 Ga0068859_100171587 Ga0068859_1001715873 155
107 3300005618 Ga0068864_100002924 Ga0068864_10000292410 155
108 3300005618 Ga0068864_100108869 Ga0068864_1001088693 155
109 3300005718 Ga0068866_10000515 Ga0068866_1000051514 155
110 3300005719 Ga0068861_100002077 Ga0068861_10000207713 155
111 3300005719 Ga0068861_100044832 Ga0068861_1000448323 155
112 3300005719 Ga0068861_100229144 Ga0068861_1002291443 155
113 3300005840 Ga0068870_10031148 Ga0068870_100311482 155
114 3300005840 Ga0068870_10191496 Ga0068870_101914961 155
115 3300005841 Ga0068863_100132046 Ga0068863_1001320463 155
116 3300005841 Ga0068863_101213636 Ga0068863_1012136362 155
117 3300005842 Ga0068858_100000492 Ga0068858_1000004927 155
118 3300005842 Ga0068858_100007798 Ga0068858_1000077982 155
119 3300005842 Ga0068858_100075788 Ga0068858_1000757883 155
120 3300005842 Ga0068858_100146554 Ga0068858_1001465542 155
121 3300005843 Ga0068860_100758390 Ga0068860_1007583901 155
122 3300005843 Ga0068860_100906571 Ga0068860_1009065712 155
123 3300005844 Ga0068862_100005405 Ga0068862_1000054059 155
124 3300005844 Ga0068862_100006282 Ga0068862_10000628210 155
125 3300005844 Ga0068862_100884247 Ga0068862_1008842472 155
126 3300006237 Ga0097621_100002682 Ga0097621_1000026828 155
127 3300006358 Ga0068871_100002071 Ga0068871_10000207110 155
128 3300006358 Ga0068871_100027480 Ga0068871_1000274803 155
129 3300006881 Ga0068865_100000773 Ga0068865_10000077311 155
130 3300006881 Ga0068865_100073674 Ga0068865_1000736744 155
131 3300006881 Ga0068865_100091997 Ga0068865_1000919972 155
132 3300006881 Ga0068865_100271332 Ga0068865_1002713322 155
133 3300006931 Ga0097620_100002546 Ga0097620_10000254611 155
134 3300006931 Ga0097620_100019479 Ga0097620_1000194794 155
135 3300006931 Ga0097620_100041775 Ga0097620_1000417753 155
136 3300006931 Ga0097620_100171593 Ga0097620_1001715932 155
137 3300009093 Ga0105240_10003193 Ga0105240_1000319315 155
138 3300009093 Ga0105240_10009597 Ga0105240_100095976 155
139 3300009093 Ga0105240_10549511 Ga0105240_105495112 155
140 3300009098 Ga0105245_10000368 Ga0105245_1000036831 155
141 3300009098 Ga0105245_11241490 Ga0105245_112414902 155
142 3300009101 Ga0105247_10003423 Ga0105247_100034233 155
143 3300009101 Ga0105247_10199421 Ga0105247_101994212 155
144 3300009148 Ga0105243_10002735 Ga0105243_100027357 155
145 3300009148 Ga0105243_10088185 Ga0105243_100881851 155
146 3300009148 Ga0105243_10122102 Ga0105243_101221024 155
147 3300009148 Ga0105243_10942748 Ga0105243_109427482 155
148 3300009174 Ga0105241_10005603 Ga0105241_100056039 155
149 3300009174 Ga0105241_10260585 Ga0105241_102605852 155
150 3300009176 Ga0105242_10007095 Ga0105242_100070958 155
151 3300009176 Ga0105242_10729350 Ga0105242_107293501 155
152 3300009176 Ga0105242_10795224 Ga0105242_107952242 155
153 3300009177 Ga0105248_10001649 Ga0105248_1000164919 155
154 3300009177 Ga0105248_10109049 Ga0105248_101090493 155
155 3300009545 Ga0105237_10002497 Ga0105237_100024974 155
156 3300009545 Ga0105237_10160272 Ga0105237_101602723 155
157 3300009545 Ga0105237_11438260 Ga0105237_114382602 155
158 3300009551 Ga0105238_10006261 Ga0105238_100062612 155
159 3300009553 Ga0105249_10106778 Ga0105249_101067783 155
160 3300010375 Ga0105239_10001816 Ga0105239_1000181618 155
161 3300010375 Ga0105239_10021225 Ga0105239_100212252 155
162 3300010375 Ga0105239_10195770 Ga0105239_101957704 155
163 3300011119 Ga0105246_10123159 Ga0105246_101231592 155
164 3300013105 Ga0157369_10403255 Ga0157369_104032552 155
165 3300013296 Ga0157374_10114454 Ga0157374_101144544 155
166 3300013296 Ga0157374_10175476 Ga0157374_101754763 155
167 3300013297 Ga0157378_10002007 Ga0157378_1000200715 155
168 3300013297 Ga0157378_10184600 Ga0157378_101846003 155
169 3300013297 Ga0157378_11004792 Ga0157378_110047921 155
170 3300013306 Ga0163162_10035556 Ga0163162_100355565 155
171 3300013306 Ga0163162_10137002 Ga0163162_101370022 155
172 3300013307 Ga0157372_11151193 Ga0157372_111511932 155
173 3300013308 Ga0157375_10055649 Ga0157375_100556492 155
174 3300013308 Ga0157375_10370793 Ga0157375_103707931 155
175 3300013308 Ga0157375_10402476 Ga0157375_104024763 155
176 3300013308 Ga0157375_10776737 Ga0157375_107767372 155
177 3300014325 Ga0163163_10001402 Ga0163163_1000140217 155
178 3300014326 Ga0157380_10000610 Ga0157380_1000061015 155
179 3300014326 Ga0157380_10724813 Ga0157380_107248132 155
180 3300014968 Ga0157379_10000172 Ga0157379_1000017235 155
181 3300014969 Ga0157376_10017647 Ga0157376_100176477 155
182 3300014969 Ga0157376_10650083 Ga0157376_106500832 155
183 3300025899 Ga0207642_10010931 Ga0207642_100109313 155
184 3300025899 Ga0207642_10103293 Ga0207642_101032932 155
185 3300025900 Ga0207710_10094865 Ga0207710_100948652 155
186 3300025900 Ga0207710_10258466 Ga0207710_102584662 155
187 3300025907 Ga0207645_10058003 Ga0207645_100580034 155
188 3300025907 Ga0207645_10452389 Ga0207645_104523892 155
189 3300025908 Ga0207643_10068104 Ga0207643_100681042 155
190 3300025909 Ga0207705_10520790 Ga0207705_105207902 155
191 3300025911 Ga0207654_10141194 Ga0207654_101411942 155
192 3300025911 Ga0207654_10484403 Ga0207654_104844032 155
193 3300025913 Ga0207695_10016902 Ga0207695_100169029 155
194 3300025913 Ga0207695_10147181 Ga0207695_101471811 155
195 3300025914 Ga0207671_10023801 Ga0207671_100238014 155
196 3300025914 Ga0207671_10115830 Ga0207671_101158301 155
197 3300025914 Ga0207671_10301626 Ga0207671_103016262 155
198 3300025917 Ga0207660_10629190 Ga0207660_106291902 155
199 3300025918 Ga0207662_10057723 Ga0207662_100577232 155
200 3300025919 Ga0207657_10114239 Ga0207657_101142392 155
201 3300025919 Ga0207657_10885770 Ga0207657_108857702 155
202 3300025921 Ga0207652_10090657 Ga0207652_100906572 155
203 3300025921 Ga0207652_10581586 Ga0207652_105815862 155
204 3300025921 Ga0207652_10800495 Ga0207652_108004952 155
205 3300025921 Ga0207652_11025296 Ga0207652_110252962 155
206 3300025922 Ga0207646_10461446 Ga0207646_104614462 155
207 3300025923 Ga0207681_10004236 Ga0207681_100042368 155
208 3300025923 Ga0207681_10345933 Ga0207681_103459332 155
209 3300025924 Ga0207694_10171828 Ga0207694_101718282 155
210 3300025925 Ga0207650_10016851 Ga0207650_100168514 155
211 3300025926 Ga0207659_10151764 Ga0207659_101517643 155
212 3300025927 Ga0207687_10005786 Ga0207687_100057868 155
213 3300025927 Ga0207687_10796082 Ga0207687_107960822 155
214 3300025934 Ga0207686_10001174 Ga0207686_100011747 155
215 3300025935 Ga0207709_10175363 Ga0207709_101753631 155
216 3300025935 Ga0207709_10425728 Ga0207709_104257282 155
217 3300025936 Ga0207670_10156491 Ga0207670_101564912 155
218 3300025936 Ga0207670_10409325 Ga0207670_104093252 155
219 3300025938 Ga0207704_10000449 Ga0207704_100004495 155
220 3300025938 Ga0207704_10123929 Ga0207704_101239292 155
221 3300025938 Ga0207704_10322242 Ga0207704_103222422 155
222 3300025941 Ga0207711_10013200 Ga0207711_100132004 155
223 3300025941 Ga0207711_10021688 Ga0207711_100216883 155
224 3300025942 Ga0207689_10000075 Ga0207689_100000754 155
225 3300025942 Ga0207689_10000088 Ga0207689_1000008847 155
226 3300025942 Ga0207689_10003137 Ga0207689_100031376 155
227 3300025942 Ga0207689_10019375 Ga0207689_100193757 155
228 3300025949 Ga0207667_10046696 Ga0207667_100466965 155
229 3300025949 Ga0207667_10200945 Ga0207667_102009452 155
230 3300025960 Ga0207651_10096487 Ga0207651_100964873 155
231 3300025960 Ga0207651_10939471 Ga0207651_109394712 155
232 3300025961 Ga0207712_10063466 Ga0207712_100634662 155
233 3300025972 Ga0207668_10000941 Ga0207668_1000094115 155
234 3300025986 Ga0207658_10005528 Ga0207658_100055287 155
235 3300026023 Ga0207677_10009819 Ga0207677_100098194 155
236 3300026023 Ga0207677_10299044 Ga0207677_102990442 155
237 3300026023 Ga0207677_10409622 Ga0207677_104096222 155
238 3300026035 Ga0207703_10010856 Ga0207703_100108562 155
239 3300026035 Ga0207703_10013688 Ga0207703_100136882 155
240 3300026035 Ga0207703_10047196 Ga0207703_100471964 155
241 3300026041 Ga0207639_10040154 Ga0207639_100401544 155
242 3300026041 Ga0207639_10224026 Ga0207639_102240262 155
243 3300026067 Ga0207678_10152198 Ga0207678_101521983 155
244 3300026075 Ga0207708_10000090 Ga0207708_1000009032 155
245 3300026075 Ga0207708_10035474 Ga0207708_100354744 155
246 3300026075 Ga0207708_10101907 Ga0207708_101019073 155
247 3300026078 Ga0207702_10105409 Ga0207702_101054094 155
248 3300026088 Ga0207641_10035156 Ga0207641_100351562 155
249 3300026089 Ga0207648_10000202 Ga0207648_1000020214 155
250 3300026089 Ga0207648_10001429 Ga0207648_100014294 155
251 3300026089 Ga0207648_10046887 Ga0207648_100468876 155
252 3300026089 Ga0207648_10104808 Ga0207648_101048082 155
253 3300026095 Ga0207676_10004655 Ga0207676_1000465510 155
254 3300026095 Ga0207676_10092454 Ga0207676_100924543 155
255 3300026116 Ga0207674_10005461 Ga0207674_100054613 155
256 3300026116 Ga0207674_10032261 Ga0207674_100322612 155
257 3300026116 Ga0207674_10346839 Ga0207674_103468392 155
258 3300026118 Ga0207675_100001897 Ga0207675_10000189711 155
259 3300026118 Ga0207675_100011121 Ga0207675_1000111217 155
260 3300026118 Ga0207675_100032818 Ga0207675_1000328183 155
261 3300026118 Ga0207675_101104650 Ga0207675_1011046502 155
262 3300026121 Ga0207683_10797303 Ga0207683_107973032 155
263 3300028379 Ga0268266_10142346 Ga0268266_101423461 155
264 3300028379 Ga0268266_10442224 Ga0268266_104422242 155
265 3300028380 Ga0268265_10006025 Ga0268265_100060255 155
266 3300028380 Ga0268265_10006089 Ga0268265_100060891 155
267 3300028380 Ga0268265_10801805 Ga0268265_108018052 155
268 3300028381 Ga0268264_10006452 Ga0268264_1000645211 155
269 3300028381 Ga0268264_10007073 Ga0268264_100070739 155
270 3300028381 Ga0268264_11187495 Ga0268264_111874951 155
271 3300028794 Ga0307515_10401528 Ga0307515_104015282 155
272 3300031242 Ga0265329_10073394 Ga0265329_100733942 155
273 3300035111 Ga0373923_0308081 Ga0373923_0308081_78_605 155
274 3300035121 Ga0373960_0049560 Ga0373960_0049560_323_850 155
275 3300036401 Ga0373937_0397416 Ga0373937_0397416_65_592 155
276 3300046683 Ga0495658_0771687 Ga0495658_0771687_56_583 155
277 3300048905 Ga0496102_0103684 Ga0496102_0103684_1143_1679 155
278 3300048906 Ga0496103_0237852 Ga0496103_0237852_455_991 155
279 3300048907 Ga0496104_0664344 Ga0496104_0664344_11_538 155
280 3300048908 Ga0496105_0582957 Ga0496105_0582957_229_756 155
281 3300048909 Ga0496106_0073063 Ga0496106_0073063_2050_2586 155
282 3300048909 Ga0496106_0349214 Ga0496106_0349214_615_1142 155
283 3300048911 Ga0496108_0229209 Ga0496108_0229209_141_677 155
284 3300048911 Ga0496108_0367545 Ga0496108_0367545_407_934 155
285 3300048912 Ga0496109_0008085 Ga0496109_0008085_4144_4680 155
286 3300048914 Ga0496111_0097453 Ga0496111_0097453_774_1310 155
287 3300049569 Ga0501032_0159379 Ga0501032_0159379_347_877 155
288 3300049569 Ga0501032_0180549 Ga0501032_0180549_437_970 155
289 3300049571 Ga0501034_0000643 Ga0501034_0000643_30489_31025 155
290 3300049571 Ga0501034_0014697 Ga0501034_0014697_420_956 155
291 3300049575 Ga0501039_0024530 Ga0501039_0024530_706_1239 155
292 3300049575 Ga0501039_0451945 Ga0501039_0451945_33_566 155
293 3300049575 Ga0501039_0809164 Ga0501039_0809164_175_708 155
294 3300049576 Ga0501040_0870858 Ga0501040_0870858_19_552 155
295 3300049577 Ga0501041_0266058 Ga0501041_0266058_133_666 155
296 3300049577 Ga0501041_0846745 Ga0501041_0846745_19_552 155
297 3300049579 Ga0501043_0458940 Ga0501043_0458940_111_647 155
298 3300049584 Ga0501068_0181852 Ga0501068_0181852_393_923 155
299 3300049587 Ga0501071_0425339 Ga0501071_0425339_395_928 155
300 3300049588 Ga0501072_0157082 Ga0501072_0157082_202_738 155
301 3300049589 Ga0501073_0005486 Ga0501073_0005486_8831_9361 155
302 3300049590 Ga0501074_0148710 Ga0501074_0148710_966_1496 155
303 3300049592 Ga0501076_0308442 Ga0501076_0308442_678_1202 155
304 3300049592 Ga0501076_0319277 Ga0501076_0319277_458_991 155
305 3300049593 Ga0501077_0160745 Ga0501077_0160745_822_1352 155
306 3300049741 Ga0501079_0204918 Ga0501079_0204918_330_860 155
307 3300049741 Ga0501079_0288631 Ga0501079_0288631_342_866 155
308 3300049742 Ga0501080_0037832 Ga0501080_0037832_3946_4476 155
309 3300053154 Ga0500619_000044 Ga0500619_000044_5027_5554 155
310 3300054114 Ga0501084_1024754 Ga0501084_1024754_108_638 155
311 3300060353 Ga0501082_0591205 Ga0501082_0591205_219_752 155
312 3300003316 rootH1_10119123 rootH1_101191232 156
313 3300003322 rootL2_10004912 rootL2_100049123 156
314 3300005459 Ga0068867_100000047 Ga0068867_10000004743 156
315 3300037466 Ga0395898_1027746 Ga0395898_1027746_110_652 156
316 3300037471 Ga0395905_0029615 Ga0395905_0029615_3552_4100 156
317 3300037471 Ga0395905_0099816 Ga0395905_0099816_446_988 156
318 3300046457 Ga0495590_0005009 Ga0495590_0005009_4006_4551 156
319 3300046810 Ga0495660_0391314 Ga0495660_0391314_54_599 156
320 3300053148 Ga0500590_002156 Ga0500590_002156_6051_6590 156
321 3300053148 Ga0500590_026449 Ga0500590_026449_491_1039 156
322 iso_pu_bacteria 2643221585 2643936689 157
323 iso_pu_bacteria 2643221656 2644318588 157
324 iso_pu_bacteria 2738541337 2739058717 157
325 3300045051 Ga0451576_0039796 Ga0451576_0039796_2081_2620 158
326 iso_pu_bacteria 2643221654 2644305202 158
327 3300031548 Ga0307408_100239691 Ga0307408_1002396912 159
328 3300044712 Ga0453684_1364278 Ga0453684_1364278_43_579 159
329 3300003316 rootH1_10010320 rootH1_1001032016 160
330 3300003316 rootH1_10085216 rootH1_100852161 160
331 3300003322 rootL2_10000057 rootL2_1000005762 160
332 3300003322 rootL2_10006108 rootL2_100061085 160
333 3300003322 rootL2_10008165 rootL2_100081653 160
334 3300003323 rootH1_10100139 rootH1_101001392 160
335 3300003323 rootH1_10184542 rootH1_101845423 160
336 3300003374 JGI25161J50226_1014909 JGI25161J50226_10149091 160
337 3300003771 Ga0055526_1004180 Ga0055526_100418010 160
338 3300004625 Ga0055543_1001773 Ga0055543_10017733 160
339 3300005262 Ga0065165_1000281 Ga0065165_100028120 160
340 3300005355 Ga0070671_100040900 Ga0070671_1000409004 160
341 3300005367 Ga0070667_100062162 Ga0070667_1000621623 160
342 3300005367 Ga0070667_100630395 Ga0070667_1006303952 160
343 3300005548 Ga0070665_100252165 Ga0070665_1002521653 160
344 3300005614 Ga0068856_100123805 Ga0068856_1001238053 160
345 3300005617 Ga0068859_100564739 Ga0068859_1005647391 160
346 3300005618 Ga0068864_100033287 Ga0068864_1000332875 160
347 3300005841 Ga0068863_100648723 Ga0068863_1006487232 160
348 3300006195 Ga0075366_10006826 Ga0075366_100068266 160
349 3300006195 Ga0075366_10280830 Ga0075366_102808302 160
350 3300006353 Ga0075370_10062746 Ga0075370_100627463 160
351 3300006931 Ga0097620_100564736 Ga0097620_1005647362 160
352 3300009098 Ga0105245_10055490 Ga0105245_100554904 160
353 3300009101 Ga0105247_10124346 Ga0105247_101243462 160
354 3300011119 Ga0105246_10248924 Ga0105246_102489243 160
355 3300013308 Ga0157375_10160893 Ga0157375_101608933 160
356 3300014325 Ga0163163_10762776 Ga0163163_107627762 160
357 3300014968 Ga0157379_10584778 Ga0157379_105847782 160
358 3300021361 Ga0213872_10000618 Ga0213872_1000061822 160
359 3300021361 Ga0213872_10017178 Ga0213872_100171783 160
360 3300025273 Ga0209673_1016431 Ga0209673_10164312 160
361 3300025295 Ga0209564_1000005 Ga0209564_1000005243 160
362 3300025927 Ga0207687_10038342 Ga0207687_100383424 160
363 3300025931 Ga0207644_10028602 Ga0207644_100286023 160
364 3300025935 Ga0207709_10247997 Ga0207709_102479971 160
365 3300025986 Ga0207658_10209361 Ga0207658_102093612 160
366 3300026023 Ga0207677_10008513 Ga0207677_100085135 160
367 3300026078 Ga0207702_10089132 Ga0207702_100891322 160
368 3300026088 Ga0207641_10801882 Ga0207641_108018822 160
369 3300026095 Ga0207676_10021123 Ga0207676_100211233 160
370 3300027312 Ga0209371_1021943 Ga0209371_10219431 160
371 3300028786 Ga0307517_10000150 Ga0307517_100001504 160
372 3300028786 Ga0307517_10138965 Ga0307517_101389652 160
373 3300028794 Ga0307515_10017631 Ga0307515_100176314 160
374 3300028794 Ga0307515_10095902 Ga0307515_100959023 160
375 3300030500 Ga0268256_1026721 Ga0268256_10267213 160
376 3300031250 Ga0265331_10001374 Ga0265331_100013749 160
377 3300031251 Ga0265327_10000078 Ga0265327_10000078128 160
378 3300031456 Ga0307513_10744393 Ga0307513_107443931 160
379 3300031507 Ga0307509_10000092 Ga0307509_1000009286 160
380 3300031507 Ga0307509_10005769 Ga0307509_1000576916 160
381 3300031507 Ga0307509_10005994 Ga0307509_1000599410 160
382 3300031507 Ga0307509_10085390 Ga0307509_100853904 160
383 3300031548 Ga0307408_100000030 Ga0307408_10000003039 160
384 3300031616 Ga0307508_10000594 Ga0307508_1000059417 160
385 3300031616 Ga0307508_10001639 Ga0307508_1000163911 160
386 3300031616 Ga0307508_10277295 Ga0307508_102772952 160
387 3300031616 Ga0307508_10449300 Ga0307508_104493001 160
388 3300031730 Ga0307516_10139529 Ga0307516_101395292 160
389 3300031730 Ga0307516_10233061 Ga0307516_102330612 160
390 3300033179 Ga0307507_10122437 Ga0307507_101224371 160
391 3300034817 Ga0373948_0001121 Ga0373948_0001121_1108_1647 160
392 3300035114 Ga0373939_0000869 Ga0373939_0000869_1933_2472 160
393 3300035121 Ga0373960_0001233 Ga0373960_0001233_3919_4458 160
394 3300035207 Ga0373942_0191705 Ga0373942_0191705_83_622 160
395 3300035241 Ga0373961_0238238 Ga0373961_0238238_82_621 160
396 3300035691 Ga0373931_0000150 Ga0373931_0000150_19304_19843 160
397 3300037471 Ga0395905_0000678 Ga0395905_0000678_28257_28799 160
398 3300039447 Ga0436361_0008791 Ga0436361_0008791_1027_1608 160
399 3300039447 Ga0436361_0371806 Ga0436361_0371806_41280_41825 160
400 3300039447 Ga0436361_0513759 Ga0436361_0513759_10877_11422 160
401 3300039447 Ga0436361_0794512 Ga0436361_0794512_2861_3403 160
402 3300042127 Ga0450890_002146 Ga0450890_002146_2187_2741 160
403 3300044694 Ga0466963_0294861 Ga0466963_0294861_89_664 160
404 3300046454 Ga0495592_0009238 Ga0495592_0009238_5584_6129 160
405 3300046515 Ga0495620_0163973 Ga0495620_0163973_128_673 160
406 3300046519 Ga0495632_0097872 Ga0495632_0097872_726_1274 160
407 3300046524 Ga0495648_0165222 Ga0495648_0165222_371_916 160
408 3300046660 Ga0495625_0477217 Ga0495625_0477217_94_642 160
409 3300046683 Ga0495658_0013961 Ga0495658_0013961_3517_4065 160
410 3300046683 Ga0495658_0234840 Ga0495658_0234840_456_1025 160
411 3300046691 Ga0495670_0068328 Ga0495670_0068328_238_861 160
412 3300047321 Ga0495676_0175151 Ga0495676_0175151_883_1452 160
413 3300047673 Ga0495593_0014040 Ga0495593_0014040_3752_4321 160
414 3300048904 Ga0496101_0342024 Ga0496101_0342024_483_1034 160
415 3300048909 Ga0496106_0003730 Ga0496106_0003730_3377_3922 160
416 3300048927 Ga0496124_0041812 Ga0496124_0041812_2119_2682 160
417 3300049514 Ga0501291_050593 Ga0501291_050593_79_618 160
418 3300049523 Ga0501300_002646 Ga0501300_002646_418_957 160
419 3300049650 Ga0501199_008275 Ga0501199_008275_422_961 160
420 3300049654 Ga0501207_061297 Ga0501207_061297_28_567 160
421 3300049662 Ga0501222_016930 Ga0501222_016930_164_703 160
422 3300049663 Ga0501223_013344 Ga0501223_013344_654_1193 160
423 3300049684 Ga0501255_000334 Ga0501255_000334_2292_2831 160
424 3300049704 Ga0501221_002392 Ga0501221_002392_2306_2845 160
425 3300049705 Ga0501225_0057608 Ga0501225_0057608_264_803 160
426 3300049706 Ga0501229_000814 Ga0501229_000814_456_995 160
427 3300049759 Ga0501262_011055 Ga0501262_011055_325_864 160
428 3300049764 Ga0501267_003218 Ga0501267_003218_227_766 160
429 3300049769 Ga0501272_011952 Ga0501272_011952_376_915 160
430 3300049779 Ga0501283_020376 Ga0501283_020376_116_655 160
431 3300050493 nmdc:mga0k408_227868_c1 nmdc:mga0k408_227868_c1_90_635 160
432 3300050493 nmdc:mga0k408_6744_c1 nmdc:mga0k408_6744_c1_2561_3109 160
433 3300050496 nmdc:mga07m45_82386_c1 nmdc:mga07m45_82386_c1_200_745 160
434 3300053086 Ga0500578_0011609 Ga0500578_0011609_2435_2998 160
435 3300053088 Ga0500644_0007056 Ga0500644_0007056_1850_2395 160
436 3300053093 Ga0500651_0038434 Ga0500651_0038434_1992_2537 160
437 3300053097 Ga0500648_205437 Ga0500648_205437_182_730 160
438 3300053108 Ga0500562_114431 Ga0500562_114431_90_635 160
439 3300053118 Ga0500594_0009737 Ga0500594_0009737_1271_1816 160
440 3300053136 Ga0500559_0000017 Ga0500559_0000017_41145_41690 160
441 3300053139 Ga0500568_0223702 Ga0500568_0223702_17_562 160
442 3300053151 Ga0500604_0239873 Ga0500604_0239873_22_567 160
443 3300053153 Ga0500616_0070706 Ga0500616_0070706_661_1206 160
444 3300053156 Ga0500622_0001793 Ga0500622_0001793_13210_13833 160
445 3300053156 Ga0500622_0007066 Ga0500622_0007066_436_981 160
446 3300053178 Ga0500637_0433691 Ga0500637_0433691_22_570 160
447 3300053730 Ga0500645_002006 Ga0500645_002006_6683_7246 160
448 iso_pu_bacteria 2831864461 2831866512 160
449 iso_pu_bacteria 2886848708 2886854547 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02417

Chromate_transp

Chromate transporter

23

191

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6r0y-assembly1.cif.gz_N thermus thermophilus v/a-type atpase/synthase, rotational state 3 0.1992 4 159
7lq4-assembly1.cif.gz_A rr (rsig)2-(c-di-gmp)2-whig complex 0.1909 4 142
6r0y-assembly1.cif.gz_N thermus thermophilus v/a-type atpase/synthase, rotational state 3 0.1777 4 159
7lq4-assembly1.cif.gz_A rr (rsig)2-(c-di-gmp)2-whig complex 0.1769 4 142
ID Description Score Start End Superfamily
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.4036 47 117 1.20.81.30
af_Q18177_8_222_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3109 5 108 1.20.140.150
af_Q4CM68_117_263_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.3074 1 105 1.20.120.550
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.2788 47 117 1.20.81.30
5osbE02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.2633 2 102 1.20.58.390
ID Description Score Start End GO Terms
AF-A0A7U9A9R9-F1-model_v4 deleted 0.9312 1 97
AF-A0A6P1B007-F1-model_v4 deleted 0.9155 3 90
AF-A0A239AIM3-F1-model_v4 Chromate transporter, chromate ion transporter (CHR) family 0.9154 6 105 GO:0005886
GO:0015109
AF-A0A399SQ28-F1-model_v4 Chromate efflux transporter 0.9126 1 102 GO:0005886
GO:0015109
AF-A0A7J5V7S9-F1-model_v4 Chromate transporter 0.8989 3 95 GO:0005886
GO:0015109

Feature Viewer

pLDDT pTM Quality
79.71 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map