F446199

General Info

Members Datasets Scaffolds Average Seq Length
448 188 448 130

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10513204|Ga0307410_105132042
Length 158
Sequence MDLSVKKAFHPFRAGKMREEATTTGEDAEPKQPRLLLVDDEPALAEFIASVARECGLDPVLTSDDRQFRDRFVEDRPDMVALDLGMPGMDGVELLRFLADQQFAAPVLIISGFDRRVLDSAFRLGEALGLSMAGPLEKPVRLQELEELLYRLKPTLTA

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
161 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
162 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
163 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
164 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
165 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.12
Rhizosphere 98.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000747 3300001989 Bacteria 11825
2 JGI24737J22298_10000070 3300001990 Bacteria 30186
3 JGI24737J22298_10037358 3300001990 Bacteria 1497
4 JGI24737J22298_10135624 3300001990 Bacteria 727
5 JGI24735J21928_10020087 3300002067 Bacteria 2048
6 JGI24745J21846_1009809 3300002073 Bacteria 1087
7 JGI24738J21930_10002454 3300002075 Bacteria 4848
8 JGI24742J22300_10033285 3300002244 Bacteria 905
9 Ga0065715_10141584 3300005293 Bacteria 1846
10 Ga0070658_10118266 3300005327 Bacteria 2200
11 Ga0070658_10155007 3300005327 Bacteria 1920
12 Ga0070658_10620473 3300005327 Bacteria 938
13 Ga0070658_10990642 3300005327 Bacteria 731
14 Ga0070676_10012651 3300005328 Bacteria 4614
15 Ga0070676_10387163 3300005328 Bacteria 970
16 Ga0070683_100726623 3300005329 Bacteria 951
17 Ga0070690_100012991 3300005330 Bacteria 4911
18 Ga0070670_100158556 3300005331 Bacteria 1961
19 Ga0068869_100005977 3300005334 Bacteria 7693
20 Ga0070666_10061455 3300005335 Bacteria 2543
21 Ga0070680_100077190 3300005336 Bacteria 2744
22 Ga0070680_100509195 3300005336 Bacteria 1030
23 Ga0070680_101570932 3300005336 Bacteria 570
24 Ga0070682_100276993 3300005337 Bacteria 1221
25 Ga0068868_100000652 3300005338 Bacteria 23360
26 Ga0068868_100248023 3300005338 Bacteria 1498
27 Ga0070660_100004598 3300005339 Bacteria 9545
28 Ga0070660_100016705 3300005339 Bacteria 5335
29 Ga0070660_100074934 3300005339 Bacteria 2649
30 Ga0070660_100158184 3300005339 Bacteria 1825
31 Ga0070689_100151099 3300005340 Bacteria 1873
32 Ga0070661_100058234 3300005344 Bacteria 2831
33 Ga0070661_100070457 3300005344 Bacteria 2571
34 Ga0070661_100239573 3300005344 Bacteria 1396
35 Ga0070661_100388714 3300005344 Bacteria 1101
36 Ga0070692_10040958 3300005345 Bacteria 2371
37 Ga0070692_10101671 3300005345 Bacteria 1577
38 Ga0070668_100671462 3300005347 Bacteria 912
39 Ga0070668_101311447 3300005347 Bacteria 658
40 Ga0070669_100001264 3300005353 Bacteria 18340
41 Ga0070669_100455739 3300005353 Bacteria 1055
42 Ga0070669_100844261 3300005353 Bacteria 780
43 Ga0070675_100008244 3300005354 Bacteria 8083
44 Ga0070675_100352047 3300005354 Unclassified 1306
45 Ga0070671_100034068 3300005355 Bacteria 4215
46 Ga0070673_100000119 3300005364 Bacteria 36566
47 Ga0070688_100099470 3300005365 Bacteria 1915
48 Ga0070659_100005323 3300005366 Bacteria 9234
49 Ga0070659_100014584 3300005366 Bacteria 5876
50 Ga0070659_100193606 3300005366 Bacteria 1672
51 Ga0070659_100310546 3300005366 Bacteria 1316
52 Ga0070659_100337229 3300005366 Bacteria 1262
53 Ga0070659_100413636 3300005366 Bacteria 1140
54 Ga0070667_100000520 3300005367 Bacteria 38650
55 Ga0070714_101707397 3300005435 Bacteria 615
56 Ga0070694_100073463 3300005444 Bacteria 2362
57 Ga0070663_100005191 3300005455 Bacteria 7713
58 Ga0070663_100387830 3300005455 Unclassified 1139
59 Ga0070663_100577775 3300005455 Bacteria 942
60 Ga0070663_101127573 3300005455 Bacteria 687
61 Ga0070662_100001228 3300005457 Bacteria 15751
62 Ga0070662_100480772 3300005457 Bacteria 1034
63 Ga0070681_10026918 3300005458 Bacteria 5782
64 Ga0070681_10559954 3300005458 Bacteria 1057
65 Ga0070681_10691003 3300005458 Unclassified 936
66 Ga0068867_100003540 3300005459 Bacteria 10977
67 Ga0068867_100008272 3300005459 Bacteria 7346
68 Ga0070679_100123045 3300005530 Bacteria 2578
69 Ga0070679_100210640 3300005530 Bacteria 1907
70 Ga0070679_100297764 3300005530 Bacteria 1564
71 Ga0070679_102210011 3300005530 Bacteria 500
72 Ga0068853_100002954 3300005539 Bacteria 12942
73 Ga0068853_100023524 3300005539 Bacteria 5159
74 Ga0068853_100503272 3300005539 Bacteria 1144
75 Ga0068853_100525640 3300005539 Bacteria 1119
76 Ga0068853_101543639 3300005539 Bacteria 643
77 Ga0070686_100471322 3300005544 Bacteria 969
78 Ga0070695_100109308 3300005545 Bacteria 1874
79 Ga0070696_100020710 3300005546 Bacteria 4456
80 Ga0070693_100072798 3300005547 Bacteria 2028
81 Ga0070693_100468869 3300005547 Bacteria 887
82 Ga0070665_100220961 3300005548 Bacteria 1895
83 Ga0070665_101661569 3300005548 Bacteria 646
84 Ga0068855_100038760 3300005563 Bacteria 5661
85 Ga0068855_101012969 3300005563 Bacteria 872
86 Ga0068855_101074151 3300005563 Bacteria 843
87 Ga0070664_100031466 3300005564 Bacteria 4434
88 Ga0070664_100146483 3300005564 Bacteria 2083
89 Ga0070664_100265441 3300005564 Bacteria 1545
90 Ga0068857_100002348 3300005577 Bacteria 15407
91 Ga0068857_100117415 3300005577 Bacteria 2394
92 Ga0068857_100535444 3300005577 Bacteria 1102
93 Ga0068857_101012962 3300005577 Bacteria 800
94 Ga0068854_100005296 3300005578 Bacteria 8141
95 Ga0068854_100060737 3300005578 Bacteria 2736
96 Ga0068854_100227938 3300005578 Bacteria 1477
97 Ga0068854_100340546 3300005578 Bacteria 1225
98 Ga0068854_100732739 3300005578 Bacteria 856
99 Ga0068856_100015956 3300005614 Bacteria 7262
100 Ga0068856_100407793 3300005614 Bacteria 1379
101 Ga0068856_100442393 3300005614 Bacteria 1320
102 Ga0068856_102408809 3300005614 Unclassified 534
103 Ga0068852_100001300 3300005616 Bacteria 16700
104 Ga0068852_100035064 3300005616 Bacteria 4180
105 Ga0068852_101375104 3300005616 Unclassified 728
106 Ga0068859_101356675 3300005617 Bacteria 784
107 Ga0068864_100312545 3300005618 Bacteria 1473
108 Ga0068866_10038032 3300005718 Bacteria 2367
109 Ga0068851_10033213 3300005834 Bacteria 2571
110 Ga0068870_10306423 3300005840 Bacteria 1004
111 Ga0068863_100000871 3300005841 Bacteria 30229
112 Ga0068863_100093925 3300005841 Bacteria 2846
113 Ga0068858_100005148 3300005842 Bacteria 12812
114 Ga0068858_100140360 3300005842 Bacteria 2268
115 Ga0068860_100001576 3300005843 Bacteria 24578
116 Ga0068862_100098724 3300005844 Bacteria 2551
117 Ga0068862_100118211 3300005844 Bacteria 2334
118 Ga0068862_100180814 3300005844 Bacteria 1892
119 Ga0068862_102210949 3300005844 Unclassified 561
120 Ga0081540_1092062 3300005983 Bacteria 1331
121 Ga0081539_10018027 3300005985 Bacteria 4921
122 Ga0097621_100101338 3300006237 Bacteria 2423
123 Ga0068871_101269267 3300006358 Bacteria 692
124 Ga0068865_100004405 3300006881 Bacteria 8486
125 Ga0068865_100997536 3300006881 Bacteria 733
126 Ga0097620_101357151 3300006931 Bacteria 784
127 Ga0105240_10853627 3300009093 Bacteria 982
128 Ga0111539_10037796 3300009094 Bacteria 5826
129 Ga0105245_10000657 3300009098 Bacteria 31348
130 Ga0105243_10099657 3300009148 Bacteria 2409
131 Ga0105241_10003321 3300009174 Bacteria 11971
132 Ga0105242_10642904 3300009176 Bacteria 1030
133 Ga0105248_10000394 3300009177 Bacteria 50466
134 Ga0105237_11638478 3300009545 Bacteria 650
135 Ga0105238_10104645 3300009551 Bacteria 2811
136 Ga0105238_10458788 3300009551 Bacteria 1272
137 Ga0105238_10523230 3300009551 Bacteria 1189
138 Ga0105249_10153888 3300009553 Bacteria 2216
139 Ga0105239_10007868 3300010375 Bacteria 12184
140 Ga0105246_10012486 3300011119 Bacteria 5304
141 Ga0157373_10001442 3300013100 Bacteria 18155
142 Ga0157373_10008637 3300013100 Bacteria 7557
143 Ga0157373_10361030 3300013100 Bacteria 1037
144 Ga0157371_10002891 3300013102 Bacteria 16063
145 Ga0157371_10063718 3300013102 Bacteria 2613
146 Ga0157371_10207890 3300013102 Bacteria 1404
147 Ga0157371_11234798 3300013102 Bacteria 577
148 Ga0157370_10093432 3300013104 Bacteria 2823
149 Ga0157370_10779432 3300013104 Unclassified 870
150 Ga0157369_10344785 3300013105 Bacteria 1547
151 Ga0157369_10710194 3300013105 Bacteria 1035
152 Ga0157374_10221666 3300013296 Bacteria 1856
153 Ga0157374_10370364 3300013296 Bacteria 1426
154 Ga0157378_10001591 3300013297 Bacteria 20531
155 Ga0157378_10777212 3300013297 Bacteria 982
156 Ga0157372_10029632 3300013307 Bacteria 5979
157 Ga0157372_10136310 3300013307 Bacteria 2827
158 Ga0157372_11339755 3300013307 Bacteria 826
159 Ga0157372_11988975 3300013307 Bacteria 668
160 Ga0157380_11193395 3300014326 Bacteria 804
161 Ga0157377_10209490 3300014745 Bacteria 1242
162 Ga0206354_10669789 3300020081 Bacteria 1616
163 Ga0206353_11262890 3300020082 Bacteria 1320
164 Ga0207673_1003470 3300025290 Bacteria 1846
165 Ga0207697_10000056 3300025315 Bacteria 45867
166 Ga0207656_10003427 3300025321 Bacteria 5449
167 Ga0207656_10047253 3300025321 Bacteria 1849
168 Ga0207642_10148523 3300025899 Bacteria 1244
169 Ga0207688_10001342 3300025901 Bacteria 12786
170 Ga0207680_10069257 3300025903 Bacteria 2179
171 Ga0207647_10000579 3300025904 Bacteria 28504
172 Ga0207647_10198482 3300025904 Bacteria 1161
173 Ga0207645_10023137 3300025907 Bacteria 4039
174 Ga0207645_10354410 3300025907 Bacteria 982
175 Ga0207645_10476713 3300025907 Bacteria 843
176 Ga0207643_10322366 3300025908 Bacteria 965
177 Ga0207705_10022465 3300025909 Bacteria 4497
178 Ga0207705_10023115 3300025909 Bacteria 4434
179 Ga0207705_10033411 3300025909 Bacteria 3674
180 Ga0207705_10099093 3300025909 Bacteria 2142
181 Ga0207705_10130039 3300025909 Bacteria 1873
182 Ga0207705_10181457 3300025909 Bacteria 1589
183 Ga0207705_10195151 3300025909 Bacteria 1532
184 Ga0207705_10201172 3300025909 Bacteria 1509
185 Ga0207705_10366026 3300025909 Bacteria 1112
186 Ga0207705_10410126 3300025909 Bacteria 1048
187 Ga0207705_10739540 3300025909 Bacteria 764
188 Ga0207707_10025684 3300025912 Bacteria 5152
189 Ga0207707_10296545 3300025912 Bacteria 1399
190 Ga0207707_10380471 3300025912 Bacteria 1213
191 Ga0207707_10389858 3300025912 Bacteria 1197
192 Ga0207707_10502854 3300025912 Bacteria 1033
193 Ga0207707_10728695 3300025912 Bacteria 831
194 Ga0207695_10047392 3300025913 Bacteria 4549
195 Ga0207695_11252538 3300025913 Bacteria 622
196 Ga0207660_10000012 3300025917 Bacteria 84167
197 Ga0207660_10000776 3300025917 Bacteria 21236
198 Ga0207660_10111957 3300025917 Bacteria 2055
199 Ga0207660_10127207 3300025917 Bacteria 1936
200 Ga0207660_10194821 3300025917 Bacteria 1580
201 Ga0207660_10358639 3300025917 Bacteria 1169
202 Ga0207660_10372596 3300025917 Bacteria 1147
203 Ga0207660_11069669 3300025917 Bacteria 658
204 Ga0207657_10003078 3300025919 Bacteria 17842
205 Ga0207657_10004573 3300025919 Bacteria 14626
206 Ga0207657_10043664 3300025919 Bacteria 3946
207 Ga0207657_10292245 3300025919 Bacteria 1292
208 Ga0207657_10350080 3300025919 Bacteria 1165
209 Ga0207657_10988593 3300025919 Bacteria 646
210 Ga0207649_10037572 3300025920 Bacteria 2926
211 Ga0207649_10051989 3300025920 Bacteria 2540
212 Ga0207649_10078010 3300025920 Bacteria 2136
213 Ga0207649_10133427 3300025920 Bacteria 1690
214 Ga0207652_10204389 3300025921 Bacteria 1778
215 Ga0207652_10208833 3300025921 Bacteria 1758
216 Ga0207652_10348193 3300025921 Bacteria 1337
217 Ga0207652_10367884 3300025921 Bacteria 1298
218 Ga0207652_10415965 3300025921 Bacteria 1213
219 Ga0207652_10458302 3300025921 Bacteria 1149
220 Ga0207652_10901274 3300025921 Bacteria 781
221 Ga0207652_11223231 3300025921 Bacteria 653
222 Ga0207681_10032774 3300025923 Bacteria 3403
223 Ga0207681_10361485 3300025923 Bacteria 1164
224 Ga0207681_10559500 3300025923 Bacteria 942
225 Ga0207681_11303674 3300025923 Bacteria 610
226 Ga0207694_10185202 3300025924 Bacteria 1690
227 Ga0207694_10427460 3300025924 Bacteria 1104
228 Ga0207650_10113351 3300025925 Bacteria 2102
229 Ga0207659_10291682 3300025926 Bacteria 1337
230 Ga0207659_10590424 3300025926 Bacteria 946
231 Ga0207687_10019996 3300025927 Bacteria 4440
232 Ga0207664_10931778 3300025929 Bacteria 779
233 Ga0207664_11823585 3300025929 Unclassified 531
234 Ga0207644_10018882 3300025931 Bacteria 4672
235 Ga0207690_10006438 3300025932 Bacteria 6960
236 Ga0207690_10047599 3300025932 Bacteria 2847
237 Ga0207690_10052300 3300025932 Bacteria 2735
238 Ga0207690_10087209 3300025932 Bacteria 2196
239 Ga0207690_10139019 3300025932 Bacteria 1787
240 Ga0207690_10262060 3300025932 Bacteria 1340
241 Ga0207690_10539540 3300025932 Bacteria 947
242 Ga0207706_10000619 3300025933 Bacteria 37719
243 Ga0207706_10079700 3300025933 Bacteria 2879
244 Ga0207706_10179209 3300025933 Bacteria 1861
245 Ga0207709_10048746 3300025935 Bacteria 2582
246 Ga0207670_10043783 3300025936 Bacteria 2959
247 Ga0207669_10626904 3300025937 Bacteria 877
248 Ga0207704_10260066 3300025938 Bacteria 1308
249 Ga0207711_10007131 3300025941 Bacteria 9365
250 Ga0207689_10000104 3300025942 Bacteria 69092
251 Ga0207689_10029213 3300025942 Bacteria 4606
252 Ga0207661_10319012 3300025944 Bacteria 1396
253 Ga0207661_10602103 3300025944 Unclassified 1009
254 Ga0207679_10099947 3300025945 Bacteria 2266
255 Ga0207679_10126810 3300025945 Bacteria 2041
256 Ga0207679_10214591 3300025945 Bacteria 1616
257 Ga0207679_10323398 3300025945 Bacteria 1336
258 Ga0207679_10464335 3300025945 Bacteria 1124
259 Ga0207679_11225430 3300025945 Bacteria 689
260 Ga0207679_11380329 3300025945 Bacteria 646
261 Ga0207679_11804938 3300025945 Unclassified 559
262 Ga0207667_10104067 3300025949 Bacteria 2928
263 Ga0207667_10223708 3300025949 Bacteria 1928
264 Ga0207667_10398056 3300025949 Bacteria 1402
265 Ga0207667_10884809 3300025949 Bacteria 886
266 Ga0207667_11053585 3300025949 Bacteria 798
267 Ga0207651_10000128 3300025960 Bacteria 32485
268 Ga0207712_10045825 3300025961 Bacteria 3029
269 Ga0207668_10015311 3300025972 Bacteria 4762
270 Ga0207668_10051128 3300025972 Bacteria 2853
271 Ga0207668_10946260 3300025972 Bacteria 768
272 Ga0207640_10053632 3300025981 Bacteria 2633
273 Ga0207640_10110649 3300025981 Bacteria 1946
274 Ga0207640_10122524 3300025981 Bacteria 1866
275 Ga0207640_10262184 3300025981 Bacteria 1347
276 Ga0207658_10003642 3300025986 Bacteria 10876
277 Ga0207677_10040003 3300026023 Bacteria 3087
278 Ga0207703_10005880 3300026035 Bacteria 9830
279 Ga0207703_10223163 3300026035 Bacteria 1686
280 Ga0207639_10038930 3300026041 Bacteria 3540
281 Ga0207639_10053352 3300026041 Bacteria 3084
282 Ga0207639_10090298 3300026041 Bacteria 2450
283 Ga0207639_10338718 3300026041 Bacteria 1340
284 Ga0207639_10926685 3300026041 Bacteria 815
285 Ga0207678_10041871 3300026067 Bacteria 3970
286 Ga0207678_10044994 3300026067 Bacteria 3817
287 Ga0207678_10059188 3300026067 Bacteria 3296
288 Ga0207678_10151194 3300026067 Bacteria 1982
289 Ga0207678_10474424 3300026067 Bacteria 1089
290 Ga0207678_10538134 3300026067 Bacteria 1021
291 Ga0207678_10605688 3300026067 Bacteria 960
292 Ga0207678_11028431 3300026067 Bacteria 729
293 Ga0207702_10006964 3300026078 Bacteria 9681
294 Ga0207702_10254748 3300026078 Bacteria 1650
295 Ga0207702_10381194 3300026078 Bacteria 1356
296 Ga0207702_10410177 3300026078 Bacteria 1308
297 Ga0207702_10828614 3300026078 Unclassified 915
298 Ga0207702_11485912 3300026078 Unclassified 671
299 Ga0207702_11708491 3300026078 Bacteria 622
300 Ga0207641_10013246 3300026088 Bacteria 6762
301 Ga0207641_10077310 3300026088 Bacteria 2880
302 Ga0207648_10000141 3300026089 Bacteria 71670
303 Ga0207648_10002387 3300026089 Bacteria 20217
304 Ga0207676_10007872 3300026095 Bacteria 7578
305 Ga0207674_10000714 3300026116 Bacteria 43427
306 Ga0207674_10017372 3300026116 Bacteria 7850
307 Ga0207674_10027615 3300026116 Bacteria 6001
308 Ga0207675_100025500 3300026118 Bacteria 5503
309 Ga0207683_10091574 3300026121 Bacteria 2709
310 Ga0207698_10004042 3300026142 Bacteria 8905
311 Ga0207698_10004175 3300026142 Bacteria 8787
312 Ga0207698_10011048 3300026142 Bacteria 5838
313 Ga0207698_10029430 3300026142 Bacteria 3934
314 Ga0207698_10036792 3300026142 Bacteria 3598
315 Ga0207698_10203682 3300026142 Bacteria 1774
316 Ga0207698_10267432 3300026142 Bacteria 1574
317 Ga0207698_10506534 3300026142 Bacteria 1176
318 Ga0207698_10725913 3300026142 Bacteria 990
319 Ga0268266_10520610 3300028379 Bacteria 1137
320 Ga0268266_11083724 3300028379 Bacteria 775
321 Ga0268265_10062797 3300028380 Bacteria 2855
322 Ga0268265_10141709 3300028380 Bacteria 2013
323 Ga0268265_10243180 3300028380 Bacteria 1589
324 Ga0268264_10006232 3300028381 Bacteria 10065
325 Ga0316182_1248735 3300030745 Bacteria 787
326 Ga0307408_100308992 3300031548 Bacteria 1327
327 Ga0307405_10147385 3300031731 Bacteria 1650
328 Ga0307413_10722619 3300031824 Bacteria 830
329 Ga0307413_10951285 3300031824 Bacteria 733
330 Ga0307410_10021186 3300031852 Bacteria 3994
331 Ga0307410_10112540 3300031852 Bacteria 1971
332 Ga0307410_10159623 3300031852 Bacteria 1688
333 Ga0307410_10513204 3300031852 Bacteria 988
334 Ga0307410_10607895 3300031852 Bacteria 912
335 Ga0307410_11811101 3300031852 Bacteria 542
336 Ga0307406_10084791 3300031901 Bacteria 2116
337 Ga0307406_10338984 3300031901 Unclassified 1170
338 Ga0307407_10197893 3300031903 Bacteria 1344
339 Ga0307412_10061858 3300031911 Bacteria 2518
340 Ga0307412_10239020 3300031911 Bacteria 1404
341 Ga0307412_11088993 3300031911 Bacteria 710
342 Ga0307412_11575691 3300031911 Bacteria 599
343 Ga0307409_100150012 3300031995 Bacteria 2022
344 Ga0307409_100263942 3300031995 Bacteria 1582
345 Ga0307409_100438952 3300031995 Bacteria 1257
346 Ga0307409_100747125 3300031995 Bacteria 982
347 Ga0307416_100174527 3300032002 Bacteria 2006
348 Ga0307416_100473958 3300032002 Bacteria 1310
349 Ga0307416_100608593 3300032002 Bacteria 1173
350 Ga0307416_101842815 3300032002 Bacteria 709
351 Ga0307414_10143869 3300032004 Bacteria 1871
352 Ga0307414_10145157 3300032004 Bacteria 1863
353 Ga0307414_10885976 3300032004 Bacteria 817
354 Ga0307414_12222719 3300032004 Bacteria 512
355 Ga0307411_10117105 3300032005 Bacteria 1919
356 Ga0307411_10348504 3300032005 Bacteria 1206
357 Ga0307411_10351797 3300032005 Bacteria 1201
358 Ga0307411_10444710 3300032005 Unclassified 1083
359 Ga0307411_10581782 3300032005 Bacteria 960
360 Ga0307411_11495000 3300032005 Bacteria 620
361 Ga0307411_12307832 3300032005 Bacteria 505
362 Ga0307415_100051544 3300032126 Bacteria 2793
363 Ga0307415_100156404 3300032126 Bacteria 1761
364 Ga0307415_100220145 3300032126 Bacteria 1521
365 Ga0307415_100262558 3300032126 Bacteria 1410
366 Ga0307415_100473313 3300032126 Bacteria 1089
367 Ga0307415_101344819 3300032126 Bacteria 678
368 Ga0307415_101448224 3300032126 Bacteria 655
369 Ga0373929_0023769 3300035085 Bacteria 1261
370 Ga0395899_0108521 3300037312 Bacteria 1997
371 Ga0395899_0180240 3300037312 Bacteria 1483
372 Ga0395899_0297190 3300037312 Bacteria 1094
373 Ga0395899_0352570 3300037312 Bacteria 984
374 Ga0395900_0009277 3300037418 Bacteria 10089
375 Ga0395900_0106238 3300037418 Bacteria 2884
376 Ga0395900_0139595 3300037418 Bacteria 2482
377 Ga0395900_0141871 3300037418 Bacteria 2459
378 Ga0395900_0211235 3300037418 Bacteria 1959
379 Ga0395900_0337204 3300037418 Bacteria 1484
380 Ga0395900_0370238 3300037418 Bacteria 1403
381 Ga0395900_0465333 3300037418 Bacteria 1218
382 Ga0395900_1257760 3300037418 Unclassified 655
383 Ga0395900_1558759 3300037418 Unclassified 572
384 Ga0395898_0062819 3300037466 Bacteria 3605
385 Ga0395898_0380806 3300037466 Bacteria 1345
386 Ga0395898_0630245 3300037466 Unclassified 1015
387 Ga0395905_0116413 3300037471 Bacteria 2512
388 Ga0395905_0138359 3300037471 Bacteria 2291
389 Ga0395905_0735065 3300037471 Bacteria 889
390 Ga0395905_1093498 3300037471 Unclassified 700
391 Ga0395905_1845652 3300037471 Unclassified 510
392 Ga0395901_0000268 3300038443 Bacteria 64837
393 Ga0395901_0092527 3300038443 Bacteria 3165
394 Ga0395901_0135757 3300038443 Bacteria 2586
395 Ga0395901_0143633 3300038443 Bacteria 2508
396 Ga0395901_0307734 3300038443 Bacteria 1642
397 Ga0395901_0324697 3300038443 Bacteria 1592
398 Ga0395901_0353672 3300038443 Bacteria 1516
399 Ga0395901_0563334 3300038443 Bacteria 1153
400 Ga0395901_0651433 3300038443 Bacteria 1056
401 Ga0395901_1961903 3300038443 Bacteria 532
402 Ga0439438_064041 3300041405 Bacteria 917
403 Ga0439442_152366 3300042002 Bacteria 515
404 Ga0450914_000140 3300042118 Bacteria 2474
405 Ga0450917_002638 3300042120 Bacteria 1286
406 Ga0450905_000757 3300042142 Bacteria 3971
407 Ga0450889_003954 3300042144 Bacteria 1463
408 Ga0466969_0086653 3300044656 Bacteria 1488
409 Ga0466969_0093483 3300044656 Bacteria 1422
410 Ga0466966_0017969 3300044684 Bacteria 4669
411 Ga0466966_0020580 3300044684 Bacteria 4336
412 Ga0466961_0007049 3300044693 Bacteria 7151
413 Ga0466961_0013095 3300044693 Bacteria 5307
414 Ga0466961_0028834 3300044693 Bacteria 3570
415 Ga0466961_0945069 3300044693 Bacteria 513
416 Ga0466963_0078691 3300044694 Bacteria 2229
417 Ga0466964_0076159 3300044706 Bacteria 1430
418 Ga0466964_0166360 3300044706 Bacteria 1035
419 Ga0466971_0003209 3300044719 Bacteria 6972
420 Ga0466971_0233793 3300044719 Bacteria 873
421 Ga0466970_0006122 3300044765 Bacteria 5993
422 Ga0466957_0002791 3300044842 Bacteria 9444
423 Ga0466959_0064620 3300045049 Bacteria 2657
424 Ga0466959_0110645 3300045049 Bacteria 1960
425 Ga0466958_0010434 3300045836 Bacteria 5203
426 Ga0466958_0061835 3300045836 Bacteria 2282
427 Ga0466958_0206099 3300045836 Bacteria 1252
428 Ga0466958_0293218 3300045836 Bacteria 1044
429 Ga0466967_0031471 3300045976 Bacteria 4466
430 Ga0466967_0044592 3300045976 Bacteria 3847
431 Ga0466967_0142523 3300045976 Bacteria 2233
432 Ga0466967_0611607 3300045976 Bacteria 1076
433 Ga0466967_1282336 3300045976 Unclassified 730
434 Ga0466967_1710675 3300045976 Bacteria 626
435 Ga0495663_0101628 3300046525 Bacteria 947
436 Ga0495677_0097862 3300047445 Bacteria 1109
437 Ga0495685_075812 3300047447 Bacteria 1123
438 Ga0496101_0376772 3300048904 Bacteria 1116
439 Ga0496104_0421496 3300048907 Bacteria 1247
440 Ga0496111_0081894 3300048914 Bacteria 2356
441 Ga0496112_0072264 3300048915 Bacteria 3410
442 Ga0496113_0098152 3300048916 Bacteria 2267
443 Ga0501067_0058130 3300049583 Bacteria 2142
444 Ga0501068_0080305 3300049584 Bacteria 2001
445 Ga0501068_0320811 3300049584 Bacteria 993
446 nmdc:mga08y16_249453_c1 3300050511 Bacteria 1834
447 Ga0466962_0009213 3300061719 Bacteria 4730
448 Ga0466962_0073034 3300061719 Bacteria 1639

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005983 Ga0081540_1092062 Ga0081540_10920622 125
2 3300005366 Ga0070659_100413636 Ga0070659_1004136361 127
3 3300005435 Ga0070714_101707397 Ga0070714_1017073972 127
4 3300005458 Ga0070681_10691003 Ga0070681_106910032 127
5 3300005614 Ga0068856_102408809 Ga0068856_1024088091 127
6 3300009545 Ga0105237_11638478 Ga0105237_116384781 127
7 3300009551 Ga0105238_10458788 Ga0105238_104587882 127
8 3300013100 Ga0157373_10361030 Ga0157373_103610302 127
9 3300013102 Ga0157371_10207890 Ga0157371_102078902 127
10 3300013105 Ga0157369_10710194 Ga0157369_107101942 127
11 3300013307 Ga0157372_10136310 Ga0157372_101363102 127
12 3300013307 Ga0157372_11339755 Ga0157372_113397552 127
13 3300013307 Ga0157372_11988975 Ga0157372_119889752 127
14 3300020081 Ga0206354_10669789 Ga0206354_106697892 127
15 3300020082 Ga0206353_11262890 Ga0206353_112628902 127
16 3300025909 Ga0207705_10022465 Ga0207705_100224652 127
17 3300025909 Ga0207705_10023115 Ga0207705_100231153 127
18 3300025909 Ga0207705_10201172 Ga0207705_102011723 127
19 3300025912 Ga0207707_10296545 Ga0207707_102965452 127
20 3300025912 Ga0207707_10380471 Ga0207707_103804712 127
21 3300025912 Ga0207707_10502854 Ga0207707_105028541 127
22 3300025913 Ga0207695_10047392 Ga0207695_100473923 127
23 3300025917 Ga0207660_10000012 Ga0207660_1000001270 127
24 3300025917 Ga0207660_10000776 Ga0207660_1000077611 127
25 3300025917 Ga0207660_10111957 Ga0207660_101119572 127
26 3300025917 Ga0207660_10127207 Ga0207660_101272073 127
27 3300025917 Ga0207660_10358639 Ga0207660_103586392 127
28 3300025919 Ga0207657_10003078 Ga0207657_1000307813 127
29 3300025920 Ga0207649_10037572 Ga0207649_100375723 127
30 3300025920 Ga0207649_10133427 Ga0207649_101334272 127
31 3300025921 Ga0207652_10204389 Ga0207652_102043892 127
32 3300025921 Ga0207652_10348193 Ga0207652_103481932 127
33 3300025921 Ga0207652_10458302 Ga0207652_104583022 127
34 3300025921 Ga0207652_11223231 Ga0207652_112232312 127
35 3300025923 Ga0207681_10559500 Ga0207681_105595002 127
36 3300025924 Ga0207694_10185202 Ga0207694_101852023 127
37 3300025929 Ga0207664_10931778 Ga0207664_109317781 127
38 3300025929 Ga0207664_11823585 Ga0207664_118235851 127
39 3300025932 Ga0207690_10052300 Ga0207690_100523003 127
40 3300025932 Ga0207690_10087209 Ga0207690_100872092 127
41 3300025932 Ga0207690_10139019 Ga0207690_101390192 127
42 3300025932 Ga0207690_10262060 Ga0207690_102620602 127
43 3300025944 Ga0207661_10319012 Ga0207661_103190122 127
44 3300025945 Ga0207679_10323398 Ga0207679_103233982 127
45 3300025945 Ga0207679_11380329 Ga0207679_113803291 127
46 3300025949 Ga0207667_10104067 Ga0207667_101040672 127
47 3300025949 Ga0207667_10223708 Ga0207667_102237082 127
48 3300025949 Ga0207667_10398056 Ga0207667_103980562 127
49 3300026041 Ga0207639_10090298 Ga0207639_100902983 127
50 3300026041 Ga0207639_10338718 Ga0207639_103387182 127
51 3300026067 Ga0207678_10538134 Ga0207678_105381342 127
52 3300026067 Ga0207678_10605688 Ga0207678_106056882 127
53 3300026078 Ga0207702_10410177 Ga0207702_104101772 127
54 3300026078 Ga0207702_10828614 Ga0207702_108286141 127
55 3300026078 Ga0207702_11485912 Ga0207702_114859121 127
56 3300026078 Ga0207702_11708491 Ga0207702_117084912 127
57 3300026116 Ga0207674_10017372 Ga0207674_100173725 127
58 3300026142 Ga0207698_10004042 Ga0207698_100040428 127
59 3300026142 Ga0207698_10011048 Ga0207698_100110487 127
60 3300026142 Ga0207698_10029430 Ga0207698_100294304 127
61 3300026142 Ga0207698_10506534 Ga0207698_105065342 127
62 3300026142 Ga0207698_10725913 Ga0207698_107259132 127
63 3300037312 Ga0395899_0108521 Ga0395899_0108521_1110_1493 127
64 3300037312 Ga0395899_0180240 Ga0395899_0180240_706_1089 127
65 3300037312 Ga0395899_0297190 Ga0395899_0297190_498_881 127
66 3300037418 Ga0395900_0009277 Ga0395900_0009277_799_1182 127
67 3300037418 Ga0395900_0139595 Ga0395900_0139595_76_459 127
68 3300037418 Ga0395900_0337204 Ga0395900_0337204_591_974 127
69 3300037418 Ga0395900_0465333 Ga0395900_0465333_569_952 127
70 3300037418 Ga0395900_1558759 Ga0395900_1558759_118_501 127
71 3300037466 Ga0395898_0062819 Ga0395898_0062819_1129_1512 127
72 3300037466 Ga0395898_0380806 Ga0395898_0380806_844_1227 127
73 3300037471 Ga0395905_0116413 Ga0395905_0116413_1527_1910 127
74 3300038443 Ga0395901_0000268 Ga0395901_0000268_6666_7049 127
75 3300038443 Ga0395901_0135757 Ga0395901_0135757_919_1302 127
76 3300038443 Ga0395901_0143633 Ga0395901_0143633_96_479 127
77 3300044656 Ga0466969_0086653 Ga0466969_0086653_510_893 127
78 3300044684 Ga0466966_0017969 Ga0466966_0017969_14_397 127
79 3300044693 Ga0466961_0013095 Ga0466961_0013095_1387_1770 127
80 3300044694 Ga0466963_0078691 Ga0466963_0078691_549_932 127
81 3300044706 Ga0466964_0076159 Ga0466964_0076159_111_494 127
82 3300044719 Ga0466971_0233793 Ga0466971_0233793_383_766 127
83 3300045049 Ga0466959_0064620 Ga0466959_0064620_1681_2064 127
84 3300045836 Ga0466958_0061835 Ga0466958_0061835_447_830 127
85 3300045836 Ga0466958_0206099 Ga0466958_0206099_339_722 127
86 3300045976 Ga0466967_0031471 Ga0466967_0031471_3451_3834 127
87 3300045976 Ga0466967_0142523 Ga0466967_0142523_117_500 127
88 3300045976 Ga0466967_1282336 Ga0466967_1282336_166_549 127
89 3300001990 JGI24737J22298_10037358 JGI24737J22298_100373582 129
90 3300001990 JGI24737J22298_10135624 JGI24737J22298_101356241 129
91 3300002067 JGI24735J21928_10020087 JGI24735J21928_100200872 129
92 3300002073 JGI24745J21846_1009809 JGI24745J21846_10098092 129
93 3300002075 JGI24738J21930_10002454 JGI24738J21930_100024544 129
94 3300002244 JGI24742J22300_10033285 JGI24742J22300_100332852 129
95 3300005293 Ga0065715_10141584 Ga0065715_101415842 129
96 3300005327 Ga0070658_10118266 Ga0070658_101182662 129
97 3300005327 Ga0070658_10155007 Ga0070658_101550073 129
98 3300005327 Ga0070658_10620473 Ga0070658_106204732 129
99 3300005327 Ga0070658_10990642 Ga0070658_109906422 129
100 3300005328 Ga0070676_10387163 Ga0070676_103871632 129
101 3300005329 Ga0070683_100726623 Ga0070683_1007266232 129
102 3300005331 Ga0070670_100158556 Ga0070670_1001585562 129
103 3300005335 Ga0070666_10061455 Ga0070666_100614553 129
104 3300005336 Ga0070680_100077190 Ga0070680_1000771902 129
105 3300005336 Ga0070680_100509195 Ga0070680_1005091951 129
106 3300005336 Ga0070680_101570932 Ga0070680_1015709321 129
107 3300005337 Ga0070682_100276993 Ga0070682_1002769932 129
108 3300005338 Ga0068868_100248023 Ga0068868_1002480231 129
109 3300005339 Ga0070660_100016705 Ga0070660_1000167057 129
110 3300005339 Ga0070660_100074934 Ga0070660_1000749343 129
111 3300005339 Ga0070660_100158184 Ga0070660_1001581843 129
112 3300005340 Ga0070689_100151099 Ga0070689_1001510991 129
113 3300005344 Ga0070661_100058234 Ga0070661_1000582341 129
114 3300005344 Ga0070661_100070457 Ga0070661_1000704573 129
115 3300005344 Ga0070661_100239573 Ga0070661_1002395732 129
116 3300005344 Ga0070661_100388714 Ga0070661_1003887142 129
117 3300005345 Ga0070692_10040958 Ga0070692_100409583 129
118 3300005345 Ga0070692_10101671 Ga0070692_101016712 129
119 3300005347 Ga0070668_100671462 Ga0070668_1006714622 129
120 3300005347 Ga0070668_101311447 Ga0070668_1013114471 129
121 3300005353 Ga0070669_100455739 Ga0070669_1004557392 129
122 3300005353 Ga0070669_100844261 Ga0070669_1008442612 129
123 3300005354 Ga0070675_100352047 Ga0070675_1003520472 129
124 3300005365 Ga0070688_100099470 Ga0070688_1000994703 129
125 3300005366 Ga0070659_100014584 Ga0070659_1000145843 129
126 3300005366 Ga0070659_100193606 Ga0070659_1001936063 129
127 3300005366 Ga0070659_100310546 Ga0070659_1003105462 129
128 3300005366 Ga0070659_100337229 Ga0070659_1003372291 129
129 3300005367 Ga0070667_100000520 Ga0070667_1000005202 129
130 3300005444 Ga0070694_100073463 Ga0070694_1000734633 129
131 3300005455 Ga0070663_100005191 Ga0070663_1000051915 129
132 3300005455 Ga0070663_100387830 Ga0070663_1003878302 129
133 3300005455 Ga0070663_100577775 Ga0070663_1005777752 129
134 3300005455 Ga0070663_101127573 Ga0070663_1011275731 129
135 3300005457 Ga0070662_100480772 Ga0070662_1004807722 129
136 3300005458 Ga0070681_10026918 Ga0070681_100269182 129
137 3300005458 Ga0070681_10559954 Ga0070681_105599542 129
138 3300005459 Ga0068867_100008272 Ga0068867_1000082728 129
139 3300005530 Ga0070679_100123045 Ga0070679_1001230452 129
140 3300005530 Ga0070679_100210640 Ga0070679_1002106402 129
141 3300005530 Ga0070679_100297764 Ga0070679_1002977642 129
142 3300005530 Ga0070679_102210011 Ga0070679_1022100111 129
143 3300005539 Ga0068853_100023524 Ga0068853_1000235247 129
144 3300005539 Ga0068853_100503272 Ga0068853_1005032722 129
145 3300005539 Ga0068853_100525640 Ga0068853_1005256402 129
146 3300005539 Ga0068853_101543639 Ga0068853_1015436391 129
147 3300005544 Ga0070686_100471322 Ga0070686_1004713222 129
148 3300005545 Ga0070695_100109308 Ga0070695_1001093082 129
149 3300005546 Ga0070696_100020710 Ga0070696_1000207104 129
150 3300005547 Ga0070693_100072798 Ga0070693_1000727983 129
151 3300005547 Ga0070693_100468869 Ga0070693_1004688692 129
152 3300005548 Ga0070665_100220961 Ga0070665_1002209613 129
153 3300005548 Ga0070665_101661569 Ga0070665_1016615691 129
154 3300005563 Ga0068855_100038760 Ga0068855_1000387604 129
155 3300005563 Ga0068855_101012969 Ga0068855_1010129692 129
156 3300005563 Ga0068855_101074151 Ga0068855_1010741512 129
157 3300005564 Ga0070664_100031466 Ga0070664_1000314662 129
158 3300005564 Ga0070664_100146483 Ga0070664_1001464833 129
159 3300005564 Ga0070664_100265441 Ga0070664_1002654412 129
160 3300005577 Ga0068857_100002348 Ga0068857_10000234811 129
161 3300005577 Ga0068857_100117415 Ga0068857_1001174152 129
162 3300005577 Ga0068857_100535444 Ga0068857_1005354442 129
163 3300005577 Ga0068857_101012962 Ga0068857_1010129622 129
164 3300005578 Ga0068854_100005296 Ga0068854_1000052962 129
165 3300005578 Ga0068854_100060737 Ga0068854_1000607372 129
166 3300005578 Ga0068854_100227938 Ga0068854_1002279382 129
167 3300005578 Ga0068854_100340546 Ga0068854_1003405462 129
168 3300005578 Ga0068854_100732739 Ga0068854_1007327392 129
169 3300005614 Ga0068856_100015956 Ga0068856_1000159567 129
170 3300005614 Ga0068856_100407793 Ga0068856_1004077932 129
171 3300005614 Ga0068856_100442393 Ga0068856_1004423932 129
172 3300005616 Ga0068852_100001300 Ga0068852_1000013007 129
173 3300005616 Ga0068852_100035064 Ga0068852_1000350644 129
174 3300005616 Ga0068852_101375104 Ga0068852_1013751042 129
175 3300005617 Ga0068859_101356675 Ga0068859_1013566751 129
176 3300005618 Ga0068864_100312545 Ga0068864_1003125452 129
177 3300005718 Ga0068866_10038032 Ga0068866_100380323 129
178 3300005834 Ga0068851_10033213 Ga0068851_100332132 129
179 3300005840 Ga0068870_10306423 Ga0068870_103064232 129
180 3300005841 Ga0068863_100000871 Ga0068863_1000008717 129
181 3300005841 Ga0068863_100093925 Ga0068863_1000939254 129
182 3300005842 Ga0068858_100005148 Ga0068858_1000051486 129
183 3300005842 Ga0068858_100140360 Ga0068858_1001403603 129
184 3300005843 Ga0068860_100001576 Ga0068860_1000015762 129
185 3300005844 Ga0068862_100098724 Ga0068862_1000987243 129
186 3300005844 Ga0068862_100118211 Ga0068862_1001182113 129
187 3300005844 Ga0068862_100180814 Ga0068862_1001808141 129
188 3300005844 Ga0068862_102210949 Ga0068862_1022109492 129
189 3300005985 Ga0081539_10018027 Ga0081539_100180273 129
190 3300006237 Ga0097621_100101338 Ga0097621_1001013382 129
191 3300006358 Ga0068871_101269267 Ga0068871_1012692671 129
192 3300006881 Ga0068865_100004405 Ga0068865_1000044058 129
193 3300006881 Ga0068865_100997536 Ga0068865_1009975362 129
194 3300006931 Ga0097620_101357151 Ga0097620_1013571511 129
195 3300009093 Ga0105240_10853627 Ga0105240_108536271 129
196 3300009094 Ga0111539_10037796 Ga0111539_100377962 129
197 3300009098 Ga0105245_10000657 Ga0105245_100006572 129
198 3300009174 Ga0105241_10003321 Ga0105241_1000332111 129
199 3300009176 Ga0105242_10642904 Ga0105242_106429042 129
200 3300009177 Ga0105248_10000394 Ga0105248_1000039436 129
201 3300009551 Ga0105238_10104645 Ga0105238_101046452 129
202 3300009551 Ga0105238_10523230 Ga0105238_105232302 129
203 3300009553 Ga0105249_10153888 Ga0105249_101538882 129
204 3300010375 Ga0105239_10007868 Ga0105239_100078688 129
205 3300011119 Ga0105246_10012486 Ga0105246_100124863 129
206 3300013100 Ga0157373_10001442 Ga0157373_100014426 129
207 3300013102 Ga0157371_10002891 Ga0157371_1000289111 129
208 3300013102 Ga0157371_10063718 Ga0157371_100637182 129
209 3300013102 Ga0157371_11234798 Ga0157371_112347981 129
210 3300013104 Ga0157370_10093432 Ga0157370_100934324 129
211 3300013104 Ga0157370_10779432 Ga0157370_107794322 129
212 3300013105 Ga0157369_10344785 Ga0157369_103447851 129
213 3300013296 Ga0157374_10221666 Ga0157374_102216663 129
214 3300013296 Ga0157374_10370364 Ga0157374_103703642 129
215 3300013297 Ga0157378_10001591 Ga0157378_1000159120 129
216 3300013297 Ga0157378_10777212 Ga0157378_107772121 129
217 3300013307 Ga0157372_10029632 Ga0157372_100296324 129
218 3300014326 Ga0157380_11193395 Ga0157380_111933952 129
219 3300014745 Ga0157377_10209490 Ga0157377_102094901 129
220 3300025290 Ga0207673_1003470 Ga0207673_10034703 129
221 3300025315 Ga0207697_10000056 Ga0207697_1000005642 129
222 3300025321 Ga0207656_10003427 Ga0207656_100034277 129
223 3300025321 Ga0207656_10047253 Ga0207656_100472532 129
224 3300025899 Ga0207642_10148523 Ga0207642_101485231 129
225 3300025901 Ga0207688_10001342 Ga0207688_1000134211 129
226 3300025903 Ga0207680_10069257 Ga0207680_100692573 129
227 3300025904 Ga0207647_10000579 Ga0207647_1000057927 129
228 3300025904 Ga0207647_10198482 Ga0207647_101984822 129
229 3300025907 Ga0207645_10023137 Ga0207645_100231374 129
230 3300025907 Ga0207645_10354410 Ga0207645_103544102 129
231 3300025907 Ga0207645_10476713 Ga0207645_104767132 129
232 3300025908 Ga0207643_10322366 Ga0207643_103223662 129
233 3300025909 Ga0207705_10033411 Ga0207705_100334113 129
234 3300025909 Ga0207705_10099093 Ga0207705_100990933 129
235 3300025909 Ga0207705_10130039 Ga0207705_101300392 129
236 3300025909 Ga0207705_10181457 Ga0207705_101814572 129
237 3300025909 Ga0207705_10195151 Ga0207705_101951512 129
238 3300025909 Ga0207705_10366026 Ga0207705_103660262 129
239 3300025909 Ga0207705_10410126 Ga0207705_104101261 129
240 3300025909 Ga0207705_10739540 Ga0207705_107395402 129
241 3300025912 Ga0207707_10025684 Ga0207707_100256842 129
242 3300025912 Ga0207707_10389858 Ga0207707_103898582 129
243 3300025912 Ga0207707_10728695 Ga0207707_107286951 129
244 3300025917 Ga0207660_10194821 Ga0207660_101948212 129
245 3300025917 Ga0207660_10372596 Ga0207660_103725962 129
246 3300025917 Ga0207660_11069669 Ga0207660_110696692 129
247 3300025919 Ga0207657_10004573 Ga0207657_1000457310 129
248 3300025919 Ga0207657_10043664 Ga0207657_100436644 129
249 3300025919 Ga0207657_10292245 Ga0207657_102922452 129
250 3300025919 Ga0207657_10350080 Ga0207657_103500801 129
251 3300025919 Ga0207657_10988593 Ga0207657_109885931 129
252 3300025920 Ga0207649_10051989 Ga0207649_100519892 129
253 3300025920 Ga0207649_10078010 Ga0207649_100780103 129
254 3300025921 Ga0207652_10208833 Ga0207652_102088332 129
255 3300025921 Ga0207652_10367884 Ga0207652_103678841 129
256 3300025921 Ga0207652_10415965 Ga0207652_104159652 129
257 3300025921 Ga0207652_10901274 Ga0207652_109012742 129
258 3300025923 Ga0207681_10032774 Ga0207681_100327743 129
259 3300025923 Ga0207681_10361485 Ga0207681_103614852 129
260 3300025923 Ga0207681_11303674 Ga0207681_113036741 129
261 3300025924 Ga0207694_10427460 Ga0207694_104274602 129
262 3300025925 Ga0207650_10113351 Ga0207650_101133513 129
263 3300025926 Ga0207659_10291682 Ga0207659_102916822 129
264 3300025926 Ga0207659_10590424 Ga0207659_105904241 129
265 3300025927 Ga0207687_10019996 Ga0207687_100199965 129
266 3300025931 Ga0207644_10018882 Ga0207644_100188827 129
267 3300025932 Ga0207690_10006438 Ga0207690_100064384 129
268 3300025932 Ga0207690_10047599 Ga0207690_100475993 129
269 3300025932 Ga0207690_10539540 Ga0207690_105395402 129
270 3300025933 Ga0207706_10000619 Ga0207706_100006192 129
271 3300025933 Ga0207706_10079700 Ga0207706_100797003 129
272 3300025933 Ga0207706_10179209 Ga0207706_101792093 129
273 3300025935 Ga0207709_10048746 Ga0207709_100487463 129
274 3300025938 Ga0207704_10260066 Ga0207704_102600662 129
275 3300025941 Ga0207711_10007131 Ga0207711_100071313 129
276 3300025942 Ga0207689_10000104 Ga0207689_1000010424 129
277 3300025942 Ga0207689_10029213 Ga0207689_100292132 129
278 3300025945 Ga0207679_10099947 Ga0207679_100999473 129
279 3300025945 Ga0207679_10126810 Ga0207679_101268103 129
280 3300025945 Ga0207679_10214591 Ga0207679_102145912 129
281 3300025945 Ga0207679_10464335 Ga0207679_104643351 129
282 3300025945 Ga0207679_11225430 Ga0207679_112254301 129
283 3300025945 Ga0207679_11804938 Ga0207679_118049381 129
284 3300025949 Ga0207667_10884809 Ga0207667_108848092 129
285 3300025949 Ga0207667_11053585 Ga0207667_110535852 129
286 3300025960 Ga0207651_10000128 Ga0207651_1000012828 129
287 3300025961 Ga0207712_10045825 Ga0207712_100458254 129
288 3300025972 Ga0207668_10015311 Ga0207668_100153115 129
289 3300025972 Ga0207668_10051128 Ga0207668_100511283 129
290 3300025972 Ga0207668_10946260 Ga0207668_109462601 129
291 3300025981 Ga0207640_10053632 Ga0207640_100536323 129
292 3300025981 Ga0207640_10110649 Ga0207640_101106492 129
293 3300025981 Ga0207640_10122524 Ga0207640_101225242 129
294 3300025981 Ga0207640_10262184 Ga0207640_102621842 129
295 3300025986 Ga0207658_10003642 Ga0207658_100036426 129
296 3300026023 Ga0207677_10040003 Ga0207677_100400033 129
297 3300026035 Ga0207703_10005880 Ga0207703_100058803 129
298 3300026035 Ga0207703_10223163 Ga0207703_102231631 129
299 3300026041 Ga0207639_10038930 Ga0207639_100389303 129
300 3300026041 Ga0207639_10053352 Ga0207639_100533524 129
301 3300026041 Ga0207639_10926685 Ga0207639_109266852 129
302 3300026067 Ga0207678_10041871 Ga0207678_100418713 129
303 3300026067 Ga0207678_10044994 Ga0207678_100449946 129
304 3300026067 Ga0207678_10059188 Ga0207678_100591882 129
305 3300026067 Ga0207678_10151194 Ga0207678_101511943 129
306 3300026067 Ga0207678_10474424 Ga0207678_104744241 129
307 3300026067 Ga0207678_11028431 Ga0207678_110284312 129
308 3300026078 Ga0207702_10006964 Ga0207702_1000696412 129
309 3300026078 Ga0207702_10254748 Ga0207702_102547482 129
310 3300026078 Ga0207702_10381194 Ga0207702_103811942 129
311 3300026088 Ga0207641_10013246 Ga0207641_100132467 129
312 3300026088 Ga0207641_10077310 Ga0207641_100773102 129
313 3300026089 Ga0207648_10000141 Ga0207648_1000014144 129
314 3300026089 Ga0207648_10002387 Ga0207648_1000238713 129
315 3300026095 Ga0207676_10007872 Ga0207676_100078728 129
316 3300026116 Ga0207674_10000714 Ga0207674_1000071429 129
317 3300026116 Ga0207674_10027615 Ga0207674_100276156 129
318 3300026118 Ga0207675_100025500 Ga0207675_1000255007 129
319 3300026121 Ga0207683_10091574 Ga0207683_100915744 129
320 3300026142 Ga0207698_10004175 Ga0207698_100041753 129
321 3300026142 Ga0207698_10036792 Ga0207698_100367921 129
322 3300026142 Ga0207698_10203682 Ga0207698_102036821 129
323 3300026142 Ga0207698_10267432 Ga0207698_102674322 129
324 3300028379 Ga0268266_10520610 Ga0268266_105206102 129
325 3300028379 Ga0268266_11083724 Ga0268266_110837242 129
326 3300028380 Ga0268265_10062797 Ga0268265_100627973 129
327 3300028380 Ga0268265_10141709 Ga0268265_101417093 129
328 3300028380 Ga0268265_10243180 Ga0268265_102431802 129
329 3300028381 Ga0268264_10006232 Ga0268264_100062323 129
330 3300030745 Ga0316182_1248735 Ga0316182_12487352 129
331 3300031548 Ga0307408_100308992 Ga0307408_1003089922 129
332 3300031731 Ga0307405_10147385 Ga0307405_101473852 129
333 3300031824 Ga0307413_10722619 Ga0307413_107226191 129
334 3300031824 Ga0307413_10951285 Ga0307413_109512852 129
335 3300031852 Ga0307410_10021186 Ga0307410_100211861 129
336 3300031852 Ga0307410_10112540 Ga0307410_101125402 129
337 3300031852 Ga0307410_10159623 Ga0307410_101596232 129
338 3300031852 Ga0307410_11811101 Ga0307410_118111011 129
339 3300031901 Ga0307406_10084791 Ga0307406_100847912 129
340 3300031901 Ga0307406_10338984 Ga0307406_103389842 129
341 3300031911 Ga0307412_10061858 Ga0307412_100618583 129
342 3300031911 Ga0307412_10239020 Ga0307412_102390202 129
343 3300031911 Ga0307412_11575691 Ga0307412_115756911 129
344 3300031995 Ga0307409_100150012 Ga0307409_1001500122 129
345 3300031995 Ga0307409_100438952 Ga0307409_1004389522 129
346 3300032002 Ga0307416_100174527 Ga0307416_1001745273 129
347 3300032002 Ga0307416_100608593 Ga0307416_1006085932 129
348 3300032002 Ga0307416_101842815 Ga0307416_1018428152 129
349 3300032004 Ga0307414_10143869 Ga0307414_101438692 129
350 3300032004 Ga0307414_10145157 Ga0307414_101451572 129
351 3300032004 Ga0307414_12222719 Ga0307414_122227191 129
352 3300032005 Ga0307411_10117105 Ga0307411_101171052 129
353 3300032005 Ga0307411_10351797 Ga0307411_103517972 129
354 3300032005 Ga0307411_10444710 Ga0307411_104447102 129
355 3300032005 Ga0307411_12307832 Ga0307411_123078322 129
356 3300032126 Ga0307415_100051544 Ga0307415_1000515444 129
357 3300032126 Ga0307415_100156404 Ga0307415_1001564042 129
358 3300032126 Ga0307415_100220145 Ga0307415_1002201451 129
359 3300032126 Ga0307415_100262558 Ga0307415_1002625582 129
360 3300032126 Ga0307415_100473313 Ga0307415_1004733131 129
361 3300032126 Ga0307415_101448224 Ga0307415_1014482242 129
362 3300035085 Ga0373929_0023769 Ga0373929_0023769_830_1219 129
363 3300037312 Ga0395899_0352570 Ga0395899_0352570_440_841 129
364 3300037418 Ga0395900_0106238 Ga0395900_0106238_471_872 129
365 3300037418 Ga0395900_0141871 Ga0395900_0141871_26_415 129
366 3300037418 Ga0395900_0211235 Ga0395900_0211235_233_622 129
367 3300037418 Ga0395900_0370238 Ga0395900_0370238_921_1310 129
368 3300037418 Ga0395900_1257760 Ga0395900_1257760_68_457 129
369 3300037466 Ga0395898_0630245 Ga0395898_0630245_345_734 129
370 3300037471 Ga0395905_0138359 Ga0395905_0138359_702_1091 129
371 3300037471 Ga0395905_0735065 Ga0395905_0735065_355_744 129
372 3300037471 Ga0395905_1093498 Ga0395905_1093498_244_633 129
373 3300037471 Ga0395905_1845652 Ga0395905_1845652_81_470 129
374 3300038443 Ga0395901_0092527 Ga0395901_0092527_2071_2469 129
375 3300038443 Ga0395901_0307734 Ga0395901_0307734_828_1217 129
376 3300038443 Ga0395901_0324697 Ga0395901_0324697_485_874 129
377 3300038443 Ga0395901_0353672 Ga0395901_0353672_730_1119 129
378 3300038443 Ga0395901_0563334 Ga0395901_0563334_501_890 129
379 3300038443 Ga0395901_0651433 Ga0395901_0651433_564_953 129
380 3300038443 Ga0395901_1961903 Ga0395901_1961903_86_487 129
381 3300041405 Ga0439438_064041 Ga0439438_064041_407_808 129
382 3300042002 Ga0439442_152366 Ga0439442_152366_23_424 129
383 3300042118 Ga0450914_000140 Ga0450914_000140_380_781 129
384 3300042120 Ga0450917_002638 Ga0450917_002638_728_1129 129
385 3300042142 Ga0450905_000757 Ga0450905_000757_465_866 129
386 3300042144 Ga0450889_003954 Ga0450889_003954_713_1114 129
387 3300044656 Ga0466969_0093483 Ga0466969_0093483_523_912 129
388 3300044684 Ga0466966_0020580 Ga0466966_0020580_2398_2787 129
389 3300044693 Ga0466961_0007049 Ga0466961_0007049_4258_4647 129
390 3300044693 Ga0466961_0945069 Ga0466961_0945069_33_422 129
391 3300044706 Ga0466964_0166360 Ga0466964_0166360_395_784 129
392 3300044719 Ga0466971_0003209 Ga0466971_0003209_4276_4665 129
393 3300044765 Ga0466970_0006122 Ga0466970_0006122_2156_2545 129
394 3300044842 Ga0466957_0002791 Ga0466957_0002791_8638_9027 129
395 3300045049 Ga0466959_0110645 Ga0466959_0110645_1154_1543 129
396 3300045836 Ga0466958_0010434 Ga0466958_0010434_3951_4340 129
397 3300045836 Ga0466958_0293218 Ga0466958_0293218_394_783 129
398 3300045976 Ga0466967_0044592 Ga0466967_0044592_1646_2035 129
399 3300045976 Ga0466967_0611607 Ga0466967_0611607_536_937 129
400 3300045976 Ga0466967_1710675 Ga0466967_1710675_176_565 129
401 3300046525 Ga0495663_0101628 Ga0495663_0101628_210_599 129
402 3300047447 Ga0495685_075812 Ga0495685_075812_93_482 129
403 3300048904 Ga0496101_0376772 Ga0496101_0376772_38_427 129
404 3300048907 Ga0496104_0421496 Ga0496104_0421496_759_1148 129
405 3300048914 Ga0496111_0081894 Ga0496111_0081894_270_659 129
406 3300048915 Ga0496112_0072264 Ga0496112_0072264_381_770 129
407 3300048916 Ga0496113_0098152 Ga0496113_0098152_1297_1686 129
408 3300049583 Ga0501067_0058130 Ga0501067_0058130_1253_1642 129
409 3300049584 Ga0501068_0320811 Ga0501068_0320811_363_752 129
410 3300050511 nmdc:mga08y16_249453_c1 nmdc:mga08y16_249453_c1_840_1241 129
411 3300061719 Ga0466962_0009213 Ga0466962_0009213_3797_4186 129
412 3300061719 Ga0466962_0073034 Ga0466962_0073034_441_830 129
413 3300031995 Ga0307409_100263942 Ga0307409_1002639423 131
414 3300032005 Ga0307411_10348504 Ga0307411_103485042 131
415 3300031852 Ga0307410_10607895 Ga0307410_106078952 132
416 3300031903 Ga0307407_10197893 Ga0307407_101978932 132
417 3300031911 Ga0307412_11088993 Ga0307412_110889932 132
418 3300032002 Ga0307416_100473958 Ga0307416_1004739582 132
419 3300032004 Ga0307414_10885976 Ga0307414_108859762 132
420 3300032005 Ga0307411_11495000 Ga0307411_114950001 132
421 3300032126 Ga0307415_101344819 Ga0307415_1013448191 132
422 3300044693 Ga0466961_0028834 Ga0466961_0028834_2011_2427 138
423 3300032005 Ga0307411_10581782 Ga0307411_105817822 140
424 3300025936 Ga0207670_10043783 Ga0207670_100437833 141
425 3300031852 Ga0307410_10513204 Ga0307410_105132042 141
426 3300031995 Ga0307409_100747125 Ga0307409_1007471252 141
427 3300047445 Ga0495677_0097862 Ga0495677_0097862_219_647 141
428 3300049584 Ga0501068_0080305 Ga0501068_0080305_330_755 141
429 3300001989 JGI24739J22299_10000747 JGI24739J22299_100007478 142
430 3300001990 JGI24737J22298_10000070 JGI24737J22298_1000007010 142
431 3300005328 Ga0070676_10012651 Ga0070676_100126512 142
432 3300005330 Ga0070690_100012991 Ga0070690_1000129912 142
433 3300005334 Ga0068869_100005977 Ga0068869_1000059772 142
434 3300005338 Ga0068868_100000652 Ga0068868_10000065210 142
435 3300005339 Ga0070660_100004598 Ga0070660_1000045984 142
436 3300005353 Ga0070669_100001264 Ga0070669_1000012643 142
437 3300005354 Ga0070675_100008244 Ga0070675_1000082443 142
438 3300005355 Ga0070671_100034068 Ga0070671_1000340682 142
439 3300005364 Ga0070673_100000119 Ga0070673_10000011911 142
440 3300005366 Ga0070659_100005323 Ga0070659_1000053233 142
441 3300005457 Ga0070662_100001228 Ga0070662_1000012282 142
442 3300005459 Ga0068867_100003540 Ga0068867_10000354010 142
443 3300005539 Ga0068853_100002954 Ga0068853_1000029544 142
444 3300009148 Ga0105243_10099657 Ga0105243_100996573 142
445 3300013100 Ga0157373_10008637 Ga0157373_100086378 142
446 3300025913 Ga0207695_11252538 Ga0207695_112525381 142
447 3300025937 Ga0207669_10626904 Ga0207669_106269043 142
448 3300025944 Ga0207661_10602103 Ga0207661_106021032 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

35

150

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l4u-assembly1.cif.gz_A-2 crystal structure of construct containing a. aeolicus ntrc1 receiver, central and dna binding domains 0.9002 16 141
5m7n-assembly1.cif.gz_B crystal structure of ntrx from brucella abortus in complex with atp processed with the crystaldirect automated mounting and cryo-cooling technology 0.8979 16 141
1mb3-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.5 in complex with mg2+ 0.8906 17 136
1mb0-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ 0.8906 17 136
1m5u-assembly1.cif.gz_A crystal structure of the response regulator divk. structure at ph 8.0 in the apo-form 0.889 17 136
ID Description Score Start End Superfamily
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9336 18 95 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.929 18 93 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9211 16 95 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9203 17 95 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9124 16 95 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A516IU41-F1-model_v4 Response regulator 0.9943 16 140 GO:0000160
AF-A0A0Q8QZA0-F1-model_v4 Response regulatory domain-containing protein 0.9822 18 139 GO:0000160
AF-A0A5C7NNY3-F1-model_v4 deleted 0.9817 17 139
AF-A0A5C7NNC9-F1-model_v4 deleted 0.9803 17 137
AF-A0A2G4YSF2-F1-model_v4 Diguanylate phosphodiesterase 0.9798 16 134 GO:0000160
GO:0071111

Feature Viewer

pLDDT pTM Quality
89.44 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map