F446183

General Info

Members Datasets Scaffolds Average Seq Length
448 195 896 275

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100525880|Ga0207675_1005258802
Length 311
Sequence MIRRTLLLALVALILTACGTASSPTPQAPVAHTIAVVLSSITSLFAHGTASKAEPAKTKFSKKSQKSADDRAFDVTSVAFPPGQLFGTSPKPGEQYPWKKSIVTTVFWIGEKPSENNPVPNRTSSWDKQWTKNYGGVDDPNPANRGNYIPAKFTPRQNPFYCALPYNDKAREGHRPEAPRVVPWFKDAYQGPAVSTCKDRWVAIRKGNRTVYAQWEDAGPFRTDHWQYVFGNDRPKPNLNKGAGLDVSPAVRDYLGMNDTDVTDWRFVEFGEVPRGPWSTHGENNTFVINDRTKGVELAEELKPGGGRIVR

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
97 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
150 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.69
Rhizosphere 95.09
Stem 0
Stem Tuber 0
Unclassified 31.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100525880 3300026118 Unclassified 1180
2 SwRhRL2b_contig_1225094 2162886007 Unclassified 1234
3 SwRhRL2b_contig_382074 2162886007 Unclassified 1257
4 JGI24035J26624_1002925 3300002126 Bacteria 1596
5 JGI24035J26624_1004517 3300002126 Bacteria 1321
6 JGI25405J52794_10000304 3300003911 Bacteria 6767
7 Ga0065716_1005531 3300005277 Bacteria 872
8 Ga0065714_10154762 3300005288 Bacteria 1085
9 Ga0065704_10007999 3300005289 Unclassified 3720
10 Ga0065704_10020358 3300005289 Bacteria 2224
11 Ga0065704_10030948 3300005289 Bacteria 2161
12 Ga0065704_10099616 3300005289 Unclassified 2304
13 Ga0065704_10137577 3300005289 Bacteria 1553
14 Ga0065712_10009174 3300005290 Bacteria 4187
15 Ga0065712_10010149 3300005290 Bacteria 1990
16 Ga0065712_10071718 3300005290 Bacteria 5078
17 Ga0065715_10000659 3300005293 Bacteria 9350
18 Ga0065715_10000998 3300005293 Bacteria 9474
19 Ga0065715_10003131 3300005293 Bacteria 7539
20 Ga0065715_10018022 3300005293 Bacteria 1569
21 Ga0065715_10089213 3300005293 Bacteria 12438
22 Ga0065715_10093425 3300005293 Unclassified 4682
23 Ga0065715_10095922 3300005293 Unclassified 3979
24 Ga0065715_10152593 3300005293 Unclassified 1712
25 Ga0065715_10336113 3300005293 Unclassified 975
26 Ga0065707_10295043 3300005295 Unclassified 1013
27 Ga0070658_10101736 3300005327 Bacteria 2376
28 Ga0070658_10187249 3300005327 Bacteria 1744
29 Ga0070683_100038252 3300005329 Unclassified 4396
30 Ga0070683_100080974 3300005329 Bacteria 3039
31 Ga0070683_100138511 3300005329 Unclassified 2305
32 Ga0070683_100150225 3300005329 Bacteria 2208
33 Ga0070690_100002417 3300005330 Bacteria 10035
34 Ga0070666_10018147 3300005335 Bacteria 4520
35 Ga0070666_10085808 3300005335 Bacteria 2157
36 Ga0070680_100147795 3300005336 Unclassified 1972
37 Ga0068868_100419385 3300005338 Bacteria 1159
38 Ga0070660_100034117 3300005339 Bacteria 3843
39 Ga0070660_100276714 3300005339 Bacteria 1373
40 Ga0070689_100012556 3300005340 Bacteria 6106
41 Ga0070689_100040351 3300005340 Unclassified 3579
42 Ga0070689_100100203 3300005340 Unclassified 2292
43 Ga0070687_100202368 3300005343 Bacteria 1204
44 Ga0070661_100063036 3300005344 Bacteria 2722
45 Ga0070668_100225814 3300005347 Bacteria 1546
46 Ga0070668_100423774 3300005347 Bacteria 1140
47 Ga0070669_100008063 3300005353 Bacteria 7522
48 Ga0070669_100474861 3300005353 Unclassified 1034
49 Ga0070675_100004049 3300005354 Bacteria 11127
50 Ga0070675_100068097 3300005354 Bacteria 2947
51 Ga0070675_100086704 3300005354 Bacteria 2617
52 Ga0070675_100144615 3300005354 Bacteria 2035
53 Ga0070675_100301212 3300005354 Unclassified 1412
54 Ga0070675_100375536 3300005354 Bacteria 1264
55 Ga0070671_100018220 3300005355 Bacteria 5700
56 Ga0070671_100389487 3300005355 Unclassified 1191
57 Ga0070673_100268029 3300005364 Unclassified 1494
58 Ga0070673_100317119 3300005364 Unclassified 1376
59 Ga0070673_100516558 3300005364 Unclassified 1082
60 Ga0070688_100001530 3300005365 Bacteria 11553
61 Ga0070688_100004780 3300005365 Bacteria 7078
62 Ga0070688_100015530 3300005365 Unclassified 4336
63 Ga0070659_100039757 3300005366 Bacteria 3673
64 Ga0070659_100295327 3300005366 Unclassified 1350
65 Ga0070659_100299891 3300005366 Bacteria 1340
66 Ga0070667_100113324 3300005367 Unclassified 2353
67 Ga0070667_100140305 3300005367 Bacteria 2116
68 Ga0070667_100157289 3300005367 Bacteria 2000
69 Ga0070667_100320395 3300005367 Bacteria 1399
70 Ga0070709_10035269 3300005434 Bacteria 3040
71 Ga0070714_100269488 3300005435 Unclassified 1579
72 Ga0070714_100567332 3300005435 Bacteria 1088
73 Ga0070713_100015908 3300005436 Bacteria 5641
74 Ga0070713_100063457 3300005436 Bacteria 3097
75 Ga0070713_100188508 3300005436 Bacteria 1857
76 Ga0070713_100254240 3300005436 Unclassified 1604
77 Ga0070710_10070540 3300005437 Unclassified 2013
78 Ga0070710_10093865 3300005437 Bacteria 1774
79 Ga0070710_10123951 3300005437 Bacteria 1567
80 Ga0070710_10142312 3300005437 Unclassified 1472
81 Ga0070701_10292013 3300005438 Unclassified 999
82 Ga0070711_100031116 3300005439 Bacteria 3540
83 Ga0070711_100131447 3300005439 Unclassified 1865
84 Ga0070711_100214522 3300005439 Bacteria 1493
85 Ga0070705_100044471 3300005440 Unclassified 2551
86 Ga0070705_100049131 3300005440 Unclassified 2448
87 Ga0070705_100060555 3300005440 Unclassified 2246
88 Ga0070700_100036978 3300005441 Unclassified 2966
89 Ga0070708_100047465 3300005445 Bacteria 3793
90 Ga0070708_100081364 3300005445 Unclassified 2932
91 Ga0070708_100327221 3300005445 Bacteria 1444
92 Ga0070663_100153082 3300005455 Unclassified 1770
93 Ga0070678_100023292 3300005456 Unclassified 4124
94 Ga0070662_100044444 3300005457 Bacteria 3182
95 Ga0070662_100049574 3300005457 Bacteria 3028
96 Ga0070662_100071073 3300005457 Bacteria 2566
97 Ga0070662_100155660 3300005457 Unclassified 1784
98 Ga0070662_100316396 3300005457 Unclassified 1272
99 Ga0070681_10045991 3300005458 Bacteria 4365
100 Ga0068867_100127299 3300005459 Bacteria 1975
101 Ga0070685_10005224 3300005466 Bacteria 6584
102 Ga0070706_100008760 3300005467 Bacteria 9426
103 Ga0070706_100221294 3300005467 Unclassified 1767
104 Ga0070706_100230255 3300005467 Bacteria 1730
105 Ga0070706_100408913 3300005467 Unclassified 1263
106 Ga0070707_100009067 3300005468 Bacteria 9223
107 Ga0070707_100013016 3300005468 Bacteria 7774
108 Ga0070707_100016860 3300005468 Bacteria 6860
109 Ga0070707_100129772 3300005468 Unclassified 2451
110 Ga0070707_100170373 3300005468 Unclassified 2122
111 Ga0070707_100279416 3300005468 Bacteria 1623
112 Ga0070707_100335980 3300005468 Bacteria 1468
113 Ga0070698_100005105 3300005471 Bacteria 14372
114 Ga0070699_100118135 3300005518 Unclassified 2331
115 Ga0070699_100302180 3300005518 Bacteria 1436
116 Ga0070699_100308604 3300005518 Bacteria 1420
117 Ga0070679_100059543 3300005530 Unclassified 3806
118 Ga0070684_100001588 3300005535 Bacteria 16399
119 Ga0070684_100002566 3300005535 Bacteria 13413
120 Ga0070684_100098645 3300005535 Bacteria 2606
121 Ga0070684_100166098 3300005535 Bacteria 2003
122 Ga0070697_100005830 3300005536 Bacteria 9503
123 Ga0070697_100007107 3300005536 Bacteria 8707
124 Ga0070697_100021195 3300005536 Bacteria 5148
125 Ga0070697_100233684 3300005536 Bacteria 1568
126 Ga0070697_100292671 3300005536 Unclassified 1399
127 Ga0070697_100338274 3300005536 Bacteria 1298
128 Ga0070672_100265214 3300005543 Unclassified 1449
129 Ga0070672_100461598 3300005543 Bacteria 1095
130 Ga0070686_100012927 3300005544 Bacteria 4767
131 Ga0070686_100098005 3300005544 Bacteria 1975
132 Ga0070696_100135664 3300005546 Bacteria 1794
133 Ga0070665_100079661 3300005548 Bacteria 3281
134 Ga0070665_100095689 3300005548 Bacteria 2975
135 Ga0070665_100383772 3300005548 Unclassified 1412
136 Ga0070704_100001924 3300005549 Bacteria 11471
137 Ga0070704_100016059 3300005549 Bacteria 4721
138 Ga0070664_100056975 3300005564 Bacteria 3321
139 Ga0070664_100133621 3300005564 Bacteria 2180
140 Ga0070664_100198559 3300005564 Bacteria 1789
141 Ga0068856_100294462 3300005614 Bacteria 1640
142 Ga0068856_100303462 3300005614 Bacteria 1614
143 Ga0068856_100479145 3300005614 Unclassified 1265
144 Ga0068852_100310469 3300005616 Bacteria 1529
145 Ga0068864_100060651 3300005618 Bacteria 3275
146 Ga0068861_100091307 3300005719 Unclassified 2404
147 Ga0068863_100015588 3300005841 Bacteria 7303
148 Ga0068863_100064747 3300005841 Bacteria 3458
149 Ga0068863_100272064 3300005841 Bacteria 1640
150 Ga0068858_100012289 3300005842 Bacteria 8076
151 Ga0068858_100071716 3300005842 Bacteria 3213
152 Ga0068860_100007452 3300005843 Bacteria 10941
153 Ga0068860_100064129 3300005843 Bacteria 3490
154 Ga0068862_100159912 3300005844 Bacteria 2010
155 Ga0068862_100281664 3300005844 Bacteria 1524
156 Ga0081455_10000484 3300005937 Bacteria 51669
157 Ga0081455_10004158 3300005937 Bacteria 16335
158 Ga0081455_10017062 3300005937 Bacteria 6978
159 Ga0081455_10027468 3300005937 Bacteria 5216
160 Ga0081455_10030147 3300005937 Bacteria 4933
161 Ga0081455_10110116 3300005937 Bacteria 2190
162 Ga0081455_10141234 3300005937 Unclassified 1870
163 Ga0081455_10177894 3300005937 Unclassified 1614
164 Ga0081455_10433521 3300005937 Unclassified 903
165 Ga0081540_1000036 3300005983 Bacteria 140805
166 Ga0081540_1062382 3300005983 Bacteria 1771
167 Ga0081540_1098948 3300005983 Bacteria 1261
168 Ga0081539_10009073 3300005985 Bacteria 8431
169 Ga0070717_10001230 3300006028 Bacteria 17421
170 Ga0070717_10031881 3300006028 Bacteria 4243
171 Ga0070717_10067596 3300006028 Bacteria 2973
172 Ga0070717_10191564 3300006028 Bacteria 1787
173 Ga0070717_10273537 3300006028 Unclassified 1496
174 Ga0070717_10341751 3300006028 Bacteria 1337
175 Ga0070715_10101652 3300006163 Unclassified 1342
176 Ga0070715_10157595 3300006163 Bacteria 1119
177 Ga0070716_100081734 3300006173 Unclassified 1930
178 Ga0070716_100126093 3300006173 Bacteria 1610
179 Ga0070716_100297726 3300006173 Bacteria 1121
180 Ga0070712_100042373 3300006175 Bacteria 3130
181 Ga0070712_100050458 3300006175 Bacteria 2895
182 Ga0070712_100087919 3300006175 Bacteria 2269
183 Ga0070712_100178396 3300006175 Bacteria 1653
184 Ga0070712_100289109 3300006175 Unclassified 1323
185 Ga0070712_100528656 3300006175 Unclassified 992
186 Ga0097621_100098726 3300006237 Bacteria 2453
187 Ga0097621_100280167 3300006237 Bacteria 1467
188 Ga0068871_100459056 3300006358 Bacteria 1143
189 Ga0075433_10250364 3300006852 Bacteria 1572
190 Ga0075433_10316124 3300006852 Bacteria 1382
191 Ga0075434_100334975 3300006871 Bacteria 1534
192 Ga0099795_10010916 3300007788 Bacteria 2693
193 Ga0099795_10020143 3300007788 Bacteria 2169
194 Ga0111539_10364154 3300009094 Bacteria 1683
195 Ga0105245_10144137 3300009098 Bacteria 2246
196 Ga0105245_10157201 3300009098 Bacteria 2154
197 Ga0105245_10308035 3300009098 Unclassified 1556
198 Ga0114129_10000880 3300009147 Bacteria 39098
199 Ga0114129_10096605 3300009147 Bacteria 4090
200 Ga0114129_10114188 3300009147 Bacteria 3724
201 Ga0114129_10668435 3300009147 Bacteria 1339
202 Ga0105243_10147655 3300009148 Bacteria 2013
203 Ga0105243_10379089 3300009148 Bacteria 1308
204 Ga0105242_10486878 3300009176 Unclassified 1170
205 Ga0105237_10075805 3300009545 Bacteria 3354
206 Ga0105237_10201477 3300009545 Unclassified 1990
207 Ga0105249_10017390 3300009553 Bacteria 6383
208 Ga0105249_10057706 3300009553 Bacteria 3557
209 Ga0105249_10136729 3300009553 Bacteria 2346
210 Ga0105249_10210242 3300009553 Bacteria 1909
211 Ga0105249_10212180 3300009553 Bacteria 1900
212 Ga0105249_10404695 3300009553 Unclassified 1396
213 Ga0099796_10056995 3300010159 Unclassified 1373
214 Ga0099796_10087139 3300010159 Unclassified 1155
215 Ga0105239_10114886 3300010375 Bacteria 2986
216 Ga0105239_10123034 3300010375 Bacteria 2883
217 Ga0105239_10147809 3300010375 Bacteria 2622
218 Ga0105239_10431704 3300010375 Bacteria 1493
219 Ga0157369_10145899 3300013105 Bacteria 2502
220 Ga0157374_10007191 3300013296 Bacteria 9484
221 Ga0157374_10057826 3300013296 Bacteria 3623
222 Ga0157374_10149031 3300013296 Unclassified 2274
223 Ga0157374_10202595 3300013296 Bacteria 1943
224 Ga0157374_10220334 3300013296 Bacteria 1861
225 Ga0157374_10233289 3300013296 Unclassified 1808
226 Ga0157374_10256558 3300013296 Bacteria 1721
227 Ga0157378_10027331 3300013297 Bacteria 5035
228 Ga0157378_10054795 3300013297 Bacteria 3551
229 Ga0157378_10078608 3300013297 Bacteria 2976
230 Ga0157378_10223809 3300013297 Bacteria 1790
231 Ga0157378_10331112 3300013297 Unclassified 1482
232 Ga0157378_10523110 3300013297 Unclassified 1188
233 Ga0163162_10037952 3300013306 Bacteria 4808
234 Ga0163162_10095960 3300013306 Bacteria 3053
235 Ga0163162_10213835 3300013306 Bacteria 2058
236 Ga0163162_10261887 3300013306 Bacteria 1861
237 Ga0163162_10896359 3300013306 Unclassified 1000
238 Ga0157372_10030236 3300013307 Bacteria 5923
239 Ga0157372_10046237 3300013307 Unclassified 4832
240 Ga0157375_10105135 3300013308 Bacteria 2913
241 Ga0157375_10275801 3300013308 Bacteria 1844
242 Ga0157375_10284209 3300013308 Bacteria 1818
243 Ga0163163_10058176 3300014325 Bacteria 3822
244 Ga0163163_10157455 3300014325 Bacteria 2316
245 Ga0163163_10349352 3300014325 Bacteria 1535
246 Ga0157377_10034919 3300014745 Bacteria 2754
247 Ga0157377_10080036 3300014745 Unclassified 1907
248 Ga0157379_10010316 3300014968 Bacteria 8136
249 Ga0157379_10265198 3300014968 Unclassified 1561
250 Ga0157376_10013731 3300014969 Bacteria 6055
251 Ga0157376_10308115 3300014969 Bacteria 1501
252 Ga0182005_1056717 3300015265 Bacteria 1068
253 Ga0207666_1000113 3300025271 Bacteria 12502
254 Ga0207673_1000171 3300025290 Bacteria 6405
255 Ga0207673_1001193 3300025290 Bacteria 2805
256 Ga0207697_10001071 3300025315 Bacteria 15099
257 Ga0207697_10001969 3300025315 Bacteria 10897
258 Ga0207697_10004768 3300025315 Bacteria 6417
259 Ga0207697_10010234 3300025315 Unclassified 4017
260 Ga0207697_10011900 3300025315 Bacteria 3666
261 Ga0207697_10018347 3300025315 Unclassified 2869
262 Ga0207697_10022062 3300025315 Bacteria 2609
263 Ga0207697_10031285 3300025315 Bacteria 2177
264 Ga0207697_10049084 3300025315 Bacteria 1742
265 Ga0207692_10088988 3300025898 Bacteria 1670
266 Ga0207692_10103828 3300025898 Unclassified 1565
267 Ga0207647_10001582 3300025904 Bacteria 17474
268 Ga0207647_10034676 3300025904 Bacteria 3219
269 Ga0207699_10155912 3300025906 Bacteria 1515
270 Ga0207645_10055612 3300025907 Bacteria 2526
271 Ga0207684_10008007 3300025910 Bacteria 9438
272 Ga0207684_10015850 3300025910 Bacteria 6479
273 Ga0207684_10076641 3300025910 Unclassified 2842
274 Ga0207684_10104089 3300025910 Bacteria 2427
275 Ga0207684_10282593 3300025910 Bacteria 1431
276 Ga0207684_10351559 3300025910 Unclassified 1269
277 Ga0207671_10040253 3300025914 Bacteria 3460
278 Ga0207671_10064723 3300025914 Bacteria 2718
279 Ga0207693_10016786 3300025915 Bacteria 5845
280 Ga0207693_10022683 3300025915 Bacteria 4987
281 Ga0207693_10033546 3300025915 Bacteria 4051
282 Ga0207693_10116174 3300025915 Unclassified 2101
283 Ga0207693_10154391 3300025915 Unclassified 1806
284 Ga0207693_10164426 3300025915 Unclassified 1747
285 Ga0207693_10232652 3300025915 Bacteria 1447
286 Ga0207663_10063177 3300025916 Bacteria 2357
287 Ga0207663_10082170 3300025916 Bacteria 2112
288 Ga0207660_10120769 3300025917 Unclassified 1984
289 Ga0207662_10006736 3300025918 Bacteria 6214
290 Ga0207662_10008681 3300025918 Bacteria 5573
291 Ga0207662_10415789 3300025918 Unclassified 914
292 Ga0207657_10054613 3300025919 Bacteria 3453
293 Ga0207646_10005308 3300025922 Bacteria 13584
294 Ga0207646_10013426 3300025922 Bacteria 7835
295 Ga0207646_10035816 3300025922 Bacteria 4481
296 Ga0207646_10061178 3300025922 Unclassified 3362
297 Ga0207646_10268293 3300025922 Bacteria 1543
298 Ga0207646_10294418 3300025922 Unclassified 1466
299 Ga0207659_10002427 3300025926 Bacteria 11111
300 Ga0207659_10064250 3300025926 Bacteria 2655
301 Ga0207659_10100915 3300025926 Bacteria 2175
302 Ga0207687_10080211 3300025927 Unclassified 2355
303 Ga0207664_10358681 3300025929 Unclassified 1291
304 Ga0207664_10692623 3300025929 Unclassified 916
305 Ga0207690_10002685 3300025932 Bacteria 10720
306 Ga0207690_10040510 3300025932 Bacteria 3046
307 Ga0207690_10393767 3300025932 Bacteria 1103
308 Ga0207706_10002753 3300025933 Bacteria 17100
309 Ga0207706_10036823 3300025933 Bacteria 4346
310 Ga0207706_10058813 3300025933 Bacteria 3385
311 Ga0207706_10093740 3300025933 Bacteria 2641
312 Ga0207706_10111774 3300025933 Bacteria 2403
313 Ga0207706_10160016 3300025933 Bacteria 1979
314 Ga0207706_10210528 3300025933 Bacteria 1704
315 Ga0207706_10424865 3300025933 Bacteria 1151
316 Ga0207709_10328036 3300025935 Unclassified 1148
317 Ga0207670_10022863 3300025936 Bacteria 3882
318 Ga0207670_10040610 3300025936 Bacteria 3054
319 Ga0207670_10079066 3300025936 Bacteria 2295
320 Ga0207670_10377088 3300025936 Bacteria 1129
321 Ga0207665_10033890 3300025939 Bacteria 3387
322 Ga0207665_10094160 3300025939 Bacteria 2080
323 Ga0207665_10263911 3300025939 Bacteria 1277
324 Ga0207665_10378589 3300025939 Bacteria 1074
325 Ga0207689_10085313 3300025942 Unclassified 2596
326 Ga0207661_10265077 3300025944 Unclassified 1531
327 Ga0207679_10018607 3300025945 Bacteria 4657
328 Ga0207679_10091811 3300025945 Bacteria 2351
329 Ga0207651_10326487 3300025960 Bacteria 1284
330 Ga0207712_10024547 3300025961 Unclassified 3995
331 Ga0207712_10031113 3300025961 Bacteria 3592
332 Ga0207658_10006783 3300025986 Bacteria 7798
333 Ga0207658_10124728 3300025986 Unclassified 2059
334 Ga0207658_10196052 3300025986 Bacteria 1682
335 Ga0207658_10241409 3300025986 Bacteria 1531
336 Ga0207658_10279303 3300025986 Bacteria 1431
337 Ga0207677_10003113 3300026023 Bacteria 8758
338 Ga0207703_10003254 3300026035 Bacteria 13656
339 Ga0207703_10038493 3300026035 Unclassified 3817
340 Ga0207703_10487679 3300026035 Bacteria 1155
341 Ga0207678_10035502 3300026067 Bacteria 4340
342 Ga0207678_10752934 3300026067 Unclassified 859
343 Ga0207708_10046570 3300026075 Unclassified 3302
344 Ga0207702_10371967 3300026078 Unclassified 1372
345 Ga0207641_10051577 3300026088 Unclassified 3484
346 Ga0207641_10052672 3300026088 Bacteria 3448
347 Ga0207641_10387430 3300026088 Bacteria 1340
348 Ga0207641_10679843 3300026088 Bacteria 1012
349 Ga0207675_100051518 3300026118 Unclassified 3840
350 Ga0207675_100141994 3300026118 Unclassified 2281
351 Ga0207683_10137968 3300026121 Bacteria 2196
352 Ga0209179_1036956 3300027512 Unclassified 1018
353 Ga0209998_10005303 3300027717 Bacteria 2705
354 Ga0209998_10056957 3300027717 Unclassified 914
355 Ga0209974_10005027 3300027876 Unclassified 4677
356 Ga0209974_10034228 3300027876 Unclassified 1687
357 Ga0268266_10142662 3300028379 Bacteria 2151
358 Ga0268266_10165823 3300028379 Bacteria 2001
359 Ga0268266_10208449 3300028379 Unclassified 1792
360 Ga0268265_10329186 3300028380 Unclassified 1387
361 Ga0268264_10007617 3300028381 Bacteria 9026
362 Ga0268264_10223946 3300028381 Unclassified 1733
363 Ga0373943_0230676 3300035170 Unclassified 1034
364 Ga0373955_0102804 3300035172 Unclassified 1643
365 Ga0373955_0164183 3300035172 Bacteria 1312
366 Ga0373935_0002220 3300035692 Bacteria 11039
367 Ga0373935_0005576 3300035692 Bacteria 7418
368 Ga0373935_0318433 3300035692 Bacteria 1103
369 Ga0373935_0483167 3300035692 Unclassified 898
370 Ga0373927_0109967 3300035695 Bacteria 1795
371 Ga0373947_0048126 3300035725 Bacteria 2558
372 Ga0373947_0325868 3300035725 Unclassified 1028
373 Ga0373947_0332819 3300035725 Unclassified 1017
374 Ga0373937_0172274 3300036401 Bacteria 2031
375 Ga0373937_0419966 3300036401 Unclassified 1269
376 Ga0373925_0518099 3300037068 Bacteria 980
377 Ga0395900_0004228 3300037418 Bacteria 15243
378 Ga0395898_0004958 3300037466 Bacteria 14449
379 Ga0395898_0131844 3300037466 Bacteria 2393
380 Ga0395901_0001492 3300038443 Bacteria 24334
381 Ga0395901_0032987 3300038443 Bacteria 5343
382 Ga0439458_0025461 3300042157 Bacteria 1388
383 Ga0439444_0040450 3300042437 Unclassified 913
384 Ga0495592_0010180 3300046454 Bacteria 7090
385 Ga0495629_0137169 3300046459 Unclassified 1703
386 Ga0495641_0056035 3300046461 Unclassified 1788
387 Ga0495651_0227795 3300046462 Unclassified 1286
388 Ga0495582_0206904 3300046473 Unclassified 1121
389 Ga0495664_0237000 3300046477 Unclassified 1104
390 Ga0495628_0003297 3300046516 Bacteria 14442
391 Ga0495652_0053876 3300046529 Unclassified 3427
392 Ga0495652_0058885 3300046529 Bacteria 3252
393 Ga0495640_0128967 3300046533 Bacteria 1638
394 Ga0495640_0265934 3300046533 Unclassified 1070
395 Ga0495587_0099858 3300046536 Bacteria 1673
396 Ga0495587_0125593 3300046536 Unclassified 1468
397 Ga0495645_0019899 3300046543 Bacteria 4838
398 Ga0495645_0368110 3300046543 Unclassified 922
399 Ga0495667_0129252 3300046559 Unclassified 1630
400 Ga0495634_0049063 3300046642 Unclassified 2840
401 Ga0495635_0154510 3300046663 Unclassified 1562
402 Ga0495657_0267977 3300046675 Unclassified 1025
403 Ga0495599_0001576 3300046678 Bacteria 13141
404 Ga0495623_0036593 3300046679 Bacteria 3142
405 Ga0495658_0047870 3300046683 Bacteria 2409
406 Ga0495613_0134820 3300046689 Unclassified 1767
407 Ga0495624_0123433 3300046690 Unclassified 1590
408 Ga0495604_0022558 3300047317 Bacteria 5026
409 Ga0495674_0086576 3300047319 Unclassified 2682
410 Ga0495676_0149630 3300047321 Unclassified 1663
411 Ga0495680_0103905 3300047322 Bacteria 2114
412 Ga0495680_0296662 3300047322 Unclassified 1136
413 Ga0495675_0046685 3300047444 Bacteria 2757
414 Ga0495675_0113797 3300047444 Unclassified 1688
415 Ga0495602_0032280 3300048088 Bacteria 4932
416 Ga0496102_0082620 3300048905 Bacteria 2963
417 Ga0496103_0129389 3300048906 Unclassified 1612
418 Ga0496103_0131718 3300048906 Bacteria 1597
419 Ga0496105_0032053 3300048908 Bacteria 4311
420 Ga0496107_0273950 3300048910 Unclassified 1256
421 Ga0496108_0014598 3300048911 Bacteria 6412
422 Ga0496108_0368389 3300048911 Bacteria 1254
423 Ga0496109_0048760 3300048912 Bacteria 3853
424 Ga0496109_0502781 3300048912 Bacteria 1144
425 Ga0496110_0029010 3300048913 Unclassified 4757
426 Ga0496110_0579736 3300048913 Bacteria 1018
427 Ga0496111_0062871 3300048914 Bacteria 2692
428 Ga0496111_0225142 3300048914 Bacteria 1393
429 Ga0496112_0073397 3300048915 Bacteria 3382
430 Ga0496112_0083352 3300048915 Unclassified 3162
431 Ga0496113_0212486 3300048916 Unclassified 1540
432 Ga0496113_0248777 3300048916 Bacteria 1419
433 Ga0496114_0019937 3300048917 Bacteria 5440
434 Ga0496115_0037883 3300048918 Unclassified 3823
435 Ga0496115_0038804 3300048918 Bacteria 3781
436 Ga0496115_0066963 3300048918 Bacteria 2903
437 nmdc:mga05p37_108164_c1 3300050507 Bacteria 3420
438 nmdc:mga05p37_114461_c1 3300050507 Unclassified 3315
439 nmdc:mga05p37_117826_c1 3300050507 Bacteria 3263
440 nmdc:mga08y16_226110_c1 3300050511 Bacteria 1936
441 nmdc:mga0n895_149473_c1 3300050512 Bacteria 2365
442 nmdc:mga0n895_173685_c1 3300050512 Bacteria 2186
443 nmdc:mga0n895_611624_c1 3300050512 Unclassified 1091
444 nmdc:mga08x19_73702_c1 3300050514 Bacteria 2229
445 nmdc:mga0a205_325442_c1 3300050515 Unclassified 1407
446 Ga0495601_0008487 3300053077 Bacteria 6067
447 Ga0495601_0118422 3300053077 Unclassified 1719
448 2787506407 2786546548 Bacteria 4745694
449 Ga0207675_100525880
450 SwRhRL2b_contig_1225094
451 SwRhRL2b_contig_382074
452 JGI24035J26624_1002925
453 JGI24035J26624_1004517
454 JGI25405J52794_10000304
455 Ga0065716_1005531
456 Ga0065714_10154762
457 Ga0065704_10007999
458 Ga0065704_10020358
459 Ga0065704_10030948
460 Ga0065704_10099616
461 Ga0065704_10137577
462 Ga0065712_10009174
463 Ga0065712_10010149
464 Ga0065712_10071718
465 Ga0065715_10000659
466 Ga0065715_10000998
467 Ga0065715_10003131
468 Ga0065715_10018022
469 Ga0065715_10089213
470 Ga0065715_10093425
471 Ga0065715_10095922
472 Ga0065715_10152593
473 Ga0065715_10336113
474 Ga0065707_10295043
475 Ga0070658_10101736
476 Ga0070658_10187249
477 Ga0070683_100038252
478 Ga0070683_100080974
479 Ga0070683_100138511
480 Ga0070683_100150225
481 Ga0070690_100002417
482 Ga0070666_10018147
483 Ga0070666_10085808
484 Ga0070680_100147795
485 Ga0068868_100419385
486 Ga0070660_100034117
487 Ga0070660_100276714
488 Ga0070689_100012556
489 Ga0070689_100040351
490 Ga0070689_100100203
491 Ga0070687_100202368
492 Ga0070661_100063036
493 Ga0070668_100225814
494 Ga0070668_100423774
495 Ga0070669_100008063
496 Ga0070669_100474861
497 Ga0070675_100004049
498 Ga0070675_100068097
499 Ga0070675_100086704
500 Ga0070675_100144615
501 Ga0070675_100301212
502 Ga0070675_100375536
503 Ga0070671_100018220
504 Ga0070671_100389487
505 Ga0070673_100268029
506 Ga0070673_100317119
507 Ga0070673_100516558
508 Ga0070688_100001530
509 Ga0070688_100004780
510 Ga0070688_100015530
511 Ga0070659_100039757
512 Ga0070659_100295327
513 Ga0070659_100299891
514 Ga0070667_100113324
515 Ga0070667_100140305
516 Ga0070667_100157289
517 Ga0070667_100320395
518 Ga0070709_10035269
519 Ga0070714_100269488
520 Ga0070714_100567332
521 Ga0070713_100015908
522 Ga0070713_100063457
523 Ga0070713_100188508
524 Ga0070713_100254240
525 Ga0070710_10070540
526 Ga0070710_10093865
527 Ga0070710_10123951
528 Ga0070710_10142312
529 Ga0070701_10292013
530 Ga0070711_100031116
531 Ga0070711_100131447
532 Ga0070711_100214522
533 Ga0070705_100044471
534 Ga0070705_100049131
535 Ga0070705_100060555
536 Ga0070700_100036978
537 Ga0070708_100047465
538 Ga0070708_100081364
539 Ga0070708_100327221
540 Ga0070663_100153082
541 Ga0070678_100023292
542 Ga0070662_100044444
543 Ga0070662_100049574
544 Ga0070662_100071073
545 Ga0070662_100155660
546 Ga0070662_100316396
547 Ga0070681_10045991
548 Ga0068867_100127299
549 Ga0070685_10005224
550 Ga0070706_100008760
551 Ga0070706_100221294
552 Ga0070706_100230255
553 Ga0070706_100408913
554 Ga0070707_100009067
555 Ga0070707_100013016
556 Ga0070707_100016860
557 Ga0070707_100129772
558 Ga0070707_100170373
559 Ga0070707_100279416
560 Ga0070707_100335980
561 Ga0070698_100005105
562 Ga0070699_100118135
563 Ga0070699_100302180
564 Ga0070699_100308604
565 Ga0070679_100059543
566 Ga0070684_100001588
567 Ga0070684_100002566
568 Ga0070684_100098645
569 Ga0070684_100166098
570 Ga0070697_100005830
571 Ga0070697_100007107
572 Ga0070697_100021195
573 Ga0070697_100233684
574 Ga0070697_100292671
575 Ga0070697_100338274
576 Ga0070672_100265214
577 Ga0070672_100461598
578 Ga0070686_100012927
579 Ga0070686_100098005
580 Ga0070696_100135664
581 Ga0070665_100079661
582 Ga0070665_100095689
583 Ga0070665_100383772
584 Ga0070704_100001924
585 Ga0070704_100016059
586 Ga0070664_100056975
587 Ga0070664_100133621
588 Ga0070664_100198559
589 Ga0068856_100294462
590 Ga0068856_100303462
591 Ga0068856_100479145
592 Ga0068852_100310469
593 Ga0068864_100060651
594 Ga0068861_100091307
595 Ga0068863_100015588
596 Ga0068863_100064747
597 Ga0068863_100272064
598 Ga0068858_100012289
599 Ga0068858_100071716
600 Ga0068860_100007452
601 Ga0068860_100064129
602 Ga0068862_100159912
603 Ga0068862_100281664
604 Ga0081455_10000484
605 Ga0081455_10004158
606 Ga0081455_10017062
607 Ga0081455_10027468
608 Ga0081455_10030147
609 Ga0081455_10110116
610 Ga0081455_10141234
611 Ga0081455_10177894
612 Ga0081455_10433521
613 Ga0081540_1000036
614 Ga0081540_1062382
615 Ga0081540_1098948
616 Ga0081539_10009073
617 Ga0070717_10001230
618 Ga0070717_10031881
619 Ga0070717_10067596
620 Ga0070717_10191564
621 Ga0070717_10273537
622 Ga0070717_10341751
623 Ga0070715_10101652
624 Ga0070715_10157595
625 Ga0070716_100081734
626 Ga0070716_100126093
627 Ga0070716_100297726
628 Ga0070712_100042373
629 Ga0070712_100050458
630 Ga0070712_100087919
631 Ga0070712_100178396
632 Ga0070712_100289109
633 Ga0070712_100528656
634 Ga0097621_100098726
635 Ga0097621_100280167
636 Ga0068871_100459056
637 Ga0075433_10250364
638 Ga0075433_10316124
639 Ga0075434_100334975
640 Ga0099795_10010916
641 Ga0099795_10020143
642 Ga0111539_10364154
643 Ga0105245_10144137
644 Ga0105245_10157201
645 Ga0105245_10308035
646 Ga0114129_10000880
647 Ga0114129_10096605
648 Ga0114129_10114188
649 Ga0114129_10668435
650 Ga0105243_10147655
651 Ga0105243_10379089
652 Ga0105242_10486878
653 Ga0105237_10075805
654 Ga0105237_10201477
655 Ga0105249_10017390
656 Ga0105249_10057706
657 Ga0105249_10136729
658 Ga0105249_10210242
659 Ga0105249_10212180
660 Ga0105249_10404695
661 Ga0099796_10056995
662 Ga0099796_10087139
663 Ga0105239_10114886
664 Ga0105239_10123034
665 Ga0105239_10147809
666 Ga0105239_10431704
667 Ga0157369_10145899
668 Ga0157374_10007191
669 Ga0157374_10057826
670 Ga0157374_10149031
671 Ga0157374_10202595
672 Ga0157374_10220334
673 Ga0157374_10233289
674 Ga0157374_10256558
675 Ga0157378_10027331
676 Ga0157378_10054795
677 Ga0157378_10078608
678 Ga0157378_10223809
679 Ga0157378_10331112
680 Ga0157378_10523110
681 Ga0163162_10037952
682 Ga0163162_10095960
683 Ga0163162_10213835
684 Ga0163162_10261887
685 Ga0163162_10896359
686 Ga0157372_10030236
687 Ga0157372_10046237
688 Ga0157375_10105135
689 Ga0157375_10275801
690 Ga0157375_10284209
691 Ga0163163_10058176
692 Ga0163163_10157455
693 Ga0163163_10349352
694 Ga0157377_10034919
695 Ga0157377_10080036
696 Ga0157379_10010316
697 Ga0157379_10265198
698 Ga0157376_10013731
699 Ga0157376_10308115
700 Ga0182005_1056717
701 Ga0207666_1000113
702 Ga0207673_1000171
703 Ga0207673_1001193
704 Ga0207697_10001071
705 Ga0207697_10001969
706 Ga0207697_10004768
707 Ga0207697_10010234
708 Ga0207697_10011900
709 Ga0207697_10018347
710 Ga0207697_10022062
711 Ga0207697_10031285
712 Ga0207697_10049084
713 Ga0207692_10088988
714 Ga0207692_10103828
715 Ga0207647_10001582
716 Ga0207647_10034676
717 Ga0207699_10155912
718 Ga0207645_10055612
719 Ga0207684_10008007
720 Ga0207684_10015850
721 Ga0207684_10076641
722 Ga0207684_10104089
723 Ga0207684_10282593
724 Ga0207684_10351559
725 Ga0207671_10040253
726 Ga0207671_10064723
727 Ga0207693_10016786
728 Ga0207693_10022683
729 Ga0207693_10033546
730 Ga0207693_10116174
731 Ga0207693_10154391
732 Ga0207693_10164426
733 Ga0207693_10232652
734 Ga0207663_10063177
735 Ga0207663_10082170
736 Ga0207660_10120769
737 Ga0207662_10006736
738 Ga0207662_10008681
739 Ga0207662_10415789
740 Ga0207657_10054613
741 Ga0207646_10005308
742 Ga0207646_10013426
743 Ga0207646_10035816
744 Ga0207646_10061178
745 Ga0207646_10268293
746 Ga0207646_10294418
747 Ga0207659_10002427
748 Ga0207659_10064250
749 Ga0207659_10100915
750 Ga0207687_10080211
751 Ga0207664_10358681
752 Ga0207664_10692623
753 Ga0207690_10002685
754 Ga0207690_10040510
755 Ga0207690_10393767
756 Ga0207706_10002753
757 Ga0207706_10036823
758 Ga0207706_10058813
759 Ga0207706_10093740
760 Ga0207706_10111774
761 Ga0207706_10160016
762 Ga0207706_10210528
763 Ga0207706_10424865
764 Ga0207709_10328036
765 Ga0207670_10022863
766 Ga0207670_10040610
767 Ga0207670_10079066
768 Ga0207670_10377088
769 Ga0207665_10033890
770 Ga0207665_10094160
771 Ga0207665_10263911
772 Ga0207665_10378589
773 Ga0207689_10085313
774 Ga0207661_10265077
775 Ga0207679_10018607
776 Ga0207679_10091811
777 Ga0207651_10326487
778 Ga0207712_10024547
779 Ga0207712_10031113
780 Ga0207658_10006783
781 Ga0207658_10124728
782 Ga0207658_10196052
783 Ga0207658_10241409
784 Ga0207658_10279303
785 Ga0207677_10003113
786 Ga0207703_10003254
787 Ga0207703_10038493
788 Ga0207703_10487679
789 Ga0207678_10035502
790 Ga0207678_10752934
791 Ga0207708_10046570
792 Ga0207702_10371967
793 Ga0207641_10051577
794 Ga0207641_10052672
795 Ga0207641_10387430
796 Ga0207641_10679843
797 Ga0207675_100051518
798 Ga0207675_100141994
799 Ga0207683_10137968
800 Ga0209179_1036956
801 Ga0209998_10005303
802 Ga0209998_10056957
803 Ga0209974_10005027
804 Ga0209974_10034228
805 Ga0268266_10142662
806 Ga0268266_10165823
807 Ga0268266_10208449
808 Ga0268265_10329186
809 Ga0268264_10007617
810 Ga0268264_10223946
811 Ga0373943_0230676
812 Ga0373955_0102804
813 Ga0373955_0164183
814 Ga0373935_0002220
815 Ga0373935_0005576
816 Ga0373935_0318433
817 Ga0373935_0483167
818 Ga0373927_0109967
819 Ga0373947_0048126
820 Ga0373947_0325868
821 Ga0373947_0332819
822 Ga0373937_0172274
823 Ga0373937_0419966
824 Ga0373925_0518099
825 Ga0395900_0004228
826 Ga0395898_0004958
827 Ga0395898_0131844
828 Ga0395901_0001492
829 Ga0395901_0032987
830 Ga0439458_0025461
831 Ga0439444_0040450
832 Ga0495592_0010180
833 Ga0495629_0137169
834 Ga0495641_0056035
835 Ga0495651_0227795
836 Ga0495582_0206904
837 Ga0495664_0237000
838 Ga0495628_0003297
839 Ga0495652_0053876
840 Ga0495652_0058885
841 Ga0495640_0128967
842 Ga0495640_0265934
843 Ga0495587_0099858
844 Ga0495587_0125593
845 Ga0495645_0019899
846 Ga0495645_0368110
847 Ga0495667_0129252
848 Ga0495634_0049063
849 Ga0495635_0154510
850 Ga0495657_0267977
851 Ga0495599_0001576
852 Ga0495623_0036593
853 Ga0495658_0047870
854 Ga0495613_0134820
855 Ga0495624_0123433
856 Ga0495604_0022558
857 Ga0495674_0086576
858 Ga0495676_0149630
859 Ga0495680_0103905
860 Ga0495680_0296662
861 Ga0495675_0046685
862 Ga0495675_0113797
863 Ga0495602_0032280
864 Ga0496102_0082620
865 Ga0496103_0129389
866 Ga0496103_0131718
867 Ga0496105_0032053
868 Ga0496107_0273950
869 Ga0496108_0014598
870 Ga0496108_0368389
871 Ga0496109_0048760
872 Ga0496109_0502781
873 Ga0496110_0029010
874 Ga0496110_0579736
875 Ga0496111_0062871
876 Ga0496111_0225142
877 Ga0496112_0073397
878 Ga0496112_0083352
879 Ga0496113_0212486
880 Ga0496113_0248777
881 Ga0496114_0019937
882 Ga0496115_0037883
883 Ga0496115_0038804
884 Ga0496115_0066963
885 nmdc:mga05p37_108164_c1
886 nmdc:mga05p37_114461_c1
887 nmdc:mga05p37_117826_c1
888 nmdc:mga08y16_226110_c1
889 nmdc:mga0n895_149473_c1
890 nmdc:mga0n895_173685_c1
891 nmdc:mga0n895_611624_c1
892 nmdc:mga08x19_73702_c1
893 nmdc:mga0a205_325442_c1
894 Ga0495601_0008487
895 Ga0495601_0118422
896 2787506407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7di0-assembly3.cif.gz_C crystal structure of the rationally designed apdpbb_sym_79 protein 0.7772 175 245
5c18-assembly1.cif.gz_F p97-delta709-728 in complex with atp-gamma-s 0.7674 174 246
7du6-assembly1.cif.gz_A crystal structure of the rationally designed mkdpbb_sym2 protein 0.7592 170 244
7dww-assembly2.cif.gz_A crystal structure of the computationally designed msdpbb_sym2 protein 0.7551 174 244
8fct-assembly1.cif.gz_F cryo-em structure of p97:ubxd1 lariat mutant 0.7549 174 244
ID Description Score Start End Superfamily
af_Q4DWB5_6_96_2.40.40.20 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.7704 174 244 2.40.40.20
af_P46468_319_424_2.40.40.20 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.746 174 241 2.40.40.20
af_A4ICA6_1_101_2.40.40.50 Mainly Beta;Beta Barrel;Barwin-like endoglucanases;Ubiquitin fusion degradation protein UFD1, N-terminal domain 0.7421 175 246 2.40.40.50
1qcsA01 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.7324 174 244 2.40.40.20
1cr5A01 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.7014 136 244 2.40.40.20
ID Description Score Start End GO Terms
AF-A0A3C0R1Z8-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.7028 132 280
AF-A0A7W1SA72-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.6915 168 277
AF-A0A2V6MN20-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.6898 129 275
AF-A0A7V9ESV2-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.6846 152 283
AF-A0A533YK48-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.6755 158 282

Map