F446169

General Info

Members Datasets Scaffolds Average Seq Length
448 374 243 173

Family's Representative Sequence

Representative Sequence 3300022739|Ga0228711_1000001|Ga0228711_1000001213
Length 176
Sequence VPVYVALLRAVNVGGTGKLAMADLMAACDELGFAAARTYMQSGNVVFRSDLPEAAVQAKLEQALAARMGKAPDVLLRSRRQLEDAAVKAGRLFDAKPNFLLITFLPEPPAADAFERLVAPDGEEVRIDGREVYIHYPNGSGRSKLKVPALRPGTARNLNTVRKLAEMAAAMEDGSA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
3 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
4 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
5 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
6 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
7 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
8 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
9 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
10 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
11 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
12 2516143018 Ensifer sp. BR816 Isolate Nodule
13 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
14 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
15 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
16 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
17 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
18 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
19 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
20 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
21 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
22 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
23 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
24 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
25 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
26 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
27 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
28 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
29 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
30 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
31 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
32 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
33 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
34 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
35 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
36 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
37 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
38 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
39 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
40 2838061910 Rhizobium phaseoli L15 Isolate Nodule
41 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
42 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
43 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
44 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
45 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
46 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
47 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
48 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
49 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
50 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
51 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
52 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
53 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
54 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
55 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
56 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
57 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
58 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
59 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
60 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
61 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
62 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
63 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
64 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
65 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
66 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
67 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
68 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
69 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
70 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
71 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
72 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
73 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
74 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
75 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
76 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
77 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
78 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
79 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
80 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
81 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
82 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
83 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
84 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
85 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
86 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
87 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
88 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
89 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
90 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
91 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
92 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
93 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
94 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
95 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
96 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
97 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
98 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
99 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
100 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
101 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
102 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
103 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
104 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
105 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
106 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
107 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
108 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
109 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
110 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
111 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
112 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
113 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
114 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
115 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
116 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
117 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
118 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
119 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
120 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
121 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
122 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
123 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
124 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
125 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
126 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
127 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
128 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
129 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
130 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
131 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
132 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
133 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
134 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
135 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
136 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
137 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
138 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
139 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
140 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
141 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
142 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
143 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
144 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
145 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
146 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
147 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
148 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
149 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
150 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
151 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
152 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
153 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
154 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
155 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
156 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
157 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
158 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
159 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
160 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
161 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
162 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
163 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
164 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
165 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
166 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
167 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
168 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
169 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
170 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
171 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
172 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
173 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
174 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
175 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
176 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
177 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
178 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
179 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
180 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
181 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
182 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
183 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
184 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
185 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
186 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
187 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
188 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
189 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
190 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
191 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
192 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
193 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
194 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
195 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
196 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
197 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
198 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
199 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
200 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
201 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
202 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
203 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
204 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
205 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
206 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
207 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
208 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
209 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
210 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
211 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
212 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
213 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
214 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
215 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
216 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
217 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
218 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
219 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
220 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
221 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
222 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
223 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
224 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
225 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
226 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
227 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
228 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
229 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
230 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
231 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
232 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
233 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
234 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
235 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
236 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
237 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
238 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
239 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
240 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
241 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
242 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
243 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
244 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
245 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
246 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
247 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
248 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
249 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
250 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
251 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
252 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
253 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
254 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
255 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
258 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
259 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
260 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
261 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
262 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
264 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
265 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
266 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
268 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
269 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
277 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
278 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
280 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
281 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
282 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
283 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
284 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
285 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
286 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
287 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
288 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
289 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
290 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
291 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
292 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
293 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
294 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
295 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
296 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
297 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
298 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
299 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
300 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
301 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
302 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
303 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
304 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
305 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
306 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
307 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
308 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
309 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
310 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
311 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
312 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
313 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
314 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
315 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
316 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
319 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
320 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
321 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
322 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
325 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
326 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
327 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
328 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
331 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
332 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
342 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
343 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
344 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
345 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
346 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
347 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
350 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
351 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
352 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
353 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
354 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
355 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
356 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
357 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
358 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
359 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
360 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
361 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
362 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
363 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
364 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
365 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
366 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
367 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
368 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
369 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
370 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
371 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
372 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
373 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
374 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.24
Metatranscriptomes 0
Isolates 45.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.46
Nodule 46.65
Rhizoplane 0.67
Rhizosphere 16.29
Stem 0
Stem Tuber 0
Unclassified 8.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000147 3300002705 Bacteria 51946
2 JGI25162J39368_1000243 3300002737 Bacteria 54503
3 JGI25154J39366_1000160 3300002738 Bacteria 51946
4 JGI25157J39369_1000190 3300002741 Bacteria 51946
5 JGI25152J39213_1008268 3300002773 Bacteria 2596
6 JGI25159J45721_1000001 3300002987 Bacteria 303489
7 JGI25151J46595_10008997 3300003187 Bacteria 4759
8 JGI25151J46595_10013706 3300003187 Bacteria 3637
9 JGI25151J46595_10041017 3300003187 Bacteria 1688
10 JGI25151J46595_10100057 3300003187 Bacteria 783
11 JGI25165J46597_1000318 3300003214 Bacteria 57977
12 JGI25165J46597_1000413 3300003214 Bacteria 44960
13 JGI25165J46597_1000468 3300003214 Bacteria 39852
14 JGI25153J46596_10003001 3300003215 Bacteria 9547
15 rootH1_10154653 3300003316 Bacteria 1769
16 rootH2_10129835 3300003320 Bacteria 1548
17 rootL2_10071775 3300003322 Bacteria 6181
18 rootH1_10168137 3300003323 Bacteria 1163
19 JGI25160J50197_1000002 3300003354 Bacteria 561707
20 JGI25160J50197_1000047 3300003354 Bacteria 136499
21 JGI25161J50226_1000033 3300003374 Bacteria 136499
22 JGI25161J50226_1000383 3300003374 Bacteria 22253
23 Ga0055539_1017692 3300003752 Bacteria 861
24 Ga0055526_1001451 3300003771 Bacteria 16860
25 Ga0055526_1003252 3300003771 Bacteria 10455
26 Ga0055526_1005299 3300003771 Bacteria 7468
27 Ga0055526_1014521 3300003771 Bacteria 3233
28 Ga0055524_1015131 3300003775 Bacteria 2826
29 Ga0055524_1069318 3300003775 Bacteria 687
30 Ga0055536_1007248 3300003781 Bacteria 4996
31 Ga0055536_1007863 3300003781 Bacteria 4693
32 Ga0055528_1000560 3300003790 Bacteria 28261
33 Ga0055528_1000920 3300003790 Bacteria 19780
34 Ga0055540_1000387 3300003792 Bacteria 36514
35 Ga0055540_1009950 3300003792 Bacteria 3215
36 Ga0055540_1024613 3300003792 Bacteria 1490
37 Ga0055531_10017638 3300003794 Bacteria 2999
38 Ga0055531_10018299 3300003794 Bacteria 2899
39 Ga0055531_10041354 3300003794 Bacteria 1335
40 Ga0055543_1000075 3300004625 Bacteria 87163
41 Ga0055543_1000137 3300004625 Bacteria 60651
42 Ga0065165_1000004 3300005262 Bacteria 377081
43 Ga0065165_1000227 3300005262 Bacteria 98928
44 Ga0070670_100015485 3300005331 Bacteria 6549
45 Ga0070665_100233693 3300005548 Bacteria 1839
46 Ga0068852_100373118 3300005616 Bacteria 1398
47 Ga0081455_10099564 3300005937 Bacteria 2338
48 Ga0075363_100134057 3300006048 Bacteria 1391
49 Ga0075366_10450295 3300006195 Bacteria 794
50 Ga0075370_10162307 3300006353 Bacteria 1312
51 Ga0075370_10393621 3300006353 Bacteria 831
52 Ga0105240_10000027 3300009093 Bacteria 348486
53 Ga0105248_11133692 3300009177 Bacteria 884
54 Ga0105237_10001067 3300009545 Bacteria 36848
55 Ga0105238_11144193 3300009551 Bacteria 802
56 Ga0123341_1000006 3300009765 Bacteria 149197
57 Ga0123342_1023248 3300009766 Bacteria 4056
58 Ga0105239_10004606 3300010375 Bacteria 16417
59 Ga0157370_10000223 3300013104 Bacteria 72025
60 Ga0182007_10003176 3300015262 Bacteria 7859
61 Ga0182005_1005289 3300015265 Bacteria 4048
62 Ga0183363_1142 3300015690 Bacteria 18090
63 Ga0214544_1000008 3300021320 Bacteria 326027
64 Ga0214542_1000010 3300021321 Bacteria 262816
65 Ga0214543_1000003 3300021327 Bacteria 692327
66 Ga0214543_1000004 3300021327 Bacteria 527190
67 Ga0228711_1000001 3300022739 Bacteria 357377
68 Ga0228710_1000001 3300022740 Bacteria 314328
69 Ga0209435_100036 3300025206 Bacteria 126970
70 Ga0209760_104687 3300025207 Bacteria 1162
71 Ga0209436_100122 3300025208 Bacteria 38333
72 Ga0209437_100033 3300025233 Bacteria 512520
73 Ga0209437_100036 3300025233 Bacteria 469153
74 Ga0207425_1003334 3300025245 Bacteria 5191
75 Ga0207425_1014224 3300025245 Bacteria 1812
76 Ga0209646_1000132 3300025246 Bacteria 126859
77 Ga0209026_1000313 3300025250 Bacteria 52121
78 Ga0209677_100562 3300025253 Bacteria 20577
79 Ga0209148_1047233 3300025254 Bacteria 570
80 Ga0209759_1000417 3300025256 Bacteria 52121
81 Ga0209129_1000078 3300025258 Bacteria 192880
82 Ga0209129_1000555 3300025258 Bacteria 25697
83 Ga0209129_1000918 3300025258 Bacteria 18003
84 Ga0209129_1006525 3300025258 Bacteria 3742
85 Ga0209233_1000056 3300025261 Bacteria 438104
86 Ga0209233_1000064 3300025261 Bacteria 392156
87 Ga0209233_1000152 3300025261 Bacteria 175910
88 Ga0209673_1000683 3300025273 Bacteria 48729
89 Ga0209673_1002334 3300025273 Bacteria 13435
90 Ga0209673_1003020 3300025273 Bacteria 10432
91 Ga0209673_1048468 3300025273 Bacteria 1144
92 Ga0209130_1000008 3300025284 Bacteria 581232
93 Ga0209130_1000038 3300025284 Bacteria 264226
94 Ga0209676_1006946 3300025292 Bacteria 5455
95 Ga0209676_1027847 3300025292 Bacteria 1771
96 Ga0209676_1070733 3300025292 Bacteria 830
97 Ga0209025_1000100 3300025294 Bacteria 229182
98 Ga0209025_1003355 3300025294 Bacteria 15349
99 Ga0209025_1016997 3300025294 Bacteria 4238
100 Ga0209025_1026967 3300025294 Bacteria 2864
101 Ga0209564_1000104 3300025295 Bacteria 219017
102 Ga0209564_1001249 3300025295 Bacteria 28285
103 Ga0209564_1003612 3300025295 Bacteria 10298
104 Ga0209564_1033107 3300025295 Bacteria 1543
105 Ga0209758_1000148 3300025297 Bacteria 166232
106 Ga0209758_1001484 3300025297 Bacteria 27414
107 Ga0209758_1001492 3300025297 Bacteria 27306
108 Ga0209758_1008477 3300025297 Bacteria 6643
109 Ga0209050_1007339 3300025298 Bacteria 6203
110 Ga0209050_1013597 3300025298 Bacteria 3599
111 Ga0209256_1000351 3300025299 Bacteria 74921
112 Ga0209256_1000723 3300025299 Bacteria 43638
113 Ga0209256_1001279 3300025299 Bacteria 27254
114 Ga0209256_1002414 3300025299 Bacteria 15324
115 Ga0207426_1000016 3300025302 Bacteria 581232
116 Ga0207426_1000081 3300025302 Bacteria 304502
117 Ga0209051_1000127 3300025303 Bacteria 142254
118 Ga0209051_1003325 3300025303 Bacteria 10637
119 Ga0209051_1006977 3300025303 Bacteria 6264
120 Ga0209051_1029046 3300025303 Bacteria 2172
121 Ga0209051_1113124 3300025303 Bacteria 704
122 Ga0209257_1004663 3300025304 Bacteria 10327
123 Ga0209257_1006889 3300025304 Bacteria 7122
124 Ga0207695_10000024 3300025913 Bacteria 632311
125 Ga0207671_10001277 3300025914 Bacteria 29618
126 Ga0207650_10020085 3300025925 Bacteria 4706
127 Ga0207711_11647235 3300025941 Bacteria 585
128 Ga0207698_10395685 3300026142 Bacteria 1319
129 Ga0209281_1000164 3300027111 Bacteria 157372
130 Ga0209282_1000007 3300027666 Bacteria 254917
131 Ga0268266_10373479 3300028379 Bacteria 1343
132 Ga0307515_10000115 3300028794 Bacteria 193697
133 Ga0307515_10003008 3300028794 Bacteria 35799
134 Ga0268256_1008389 3300030500 Bacteria 3543
135 Ga0307513_10025414 3300031456 Bacteria 6861
136 Ga0307412_10428475 3300031911 Bacteria 1084
137 Ga0315914_1000006 3300031967 Bacteria 239817
138 Ga0307409_100101473 3300031995 Bacteria 2388
139 Ga0307411_10229850 3300032005 Bacteria 1445
140 Ga0315913_1000002 3300033430 Bacteria 241452
141 Ga0315915_1000001 3300033464 Bacteria 481518
142 Ga0439436_0019881 3300041404 Bacteria 2002
143 Ga0439438_105409 3300041405 Bacteria 682
144 Ga0439465_0037515 3300041413 Bacteria 1558
145 Ga0439465_0051215 3300041413 Bacteria 1352
146 Ga0439431_0046309 3300041997 Bacteria 1119
147 Ga0439432_061178 3300042006 Bacteria 1161
148 Ga0439449_0110244 3300042007 Bacteria 1019
149 Ga0439462_0090310 3300042015 Bacteria 840
150 Ga0439434_0185162 3300042435 Bacteria 698
151 Ga0466963_0010524 3300044694 Bacteria 5603
152 Ga0466970_0005664 3300044765 Bacteria 6202
153 Ga0466957_0035064 3300044842 Bacteria 3011
154 Ga0466958_0226079 3300045836 Bacteria 1194
155 Ga0466967_0411430 3300045976 Bacteria 1317
156 Ga0495592_0080593 3300046454 Bacteria 2355
157 Ga0495629_0090839 3300046459 Bacteria 2130
158 Ga0495582_0475736 3300046473 Bacteria 722
159 Ga0495605_0000415 3300046474 Bacteria 38918
160 Ga0495639_0433113 3300046475 Bacteria 667
161 Ga0495662_0025243 3300046476 Bacteria 2869
162 Ga0495607_0108820 3300046501 Bacteria 1472
163 Ga0495606_0000485 3300046507 Bacteria 65008
164 Ga0495606_0045315 3300046507 Bacteria 2916
165 Ga0495631_0003883 3300046518 Bacteria 8081
166 Ga0495632_0025549 3300046519 Bacteria 3122
167 Ga0495652_0409200 3300046529 Bacteria 958
168 Ga0495654_0128496 3300046530 Bacteria 1140
169 Ga0495609_0035531 3300046538 Bacteria 2256
170 Ga0495668_0106516 3300046616 Bacteria 1533
171 Ga0495668_0553278 3300046616 Bacteria 635
172 Ga0495611_0071099 3300046648 Bacteria 1591
173 Ga0495625_0014663 3300046660 Bacteria 6243
174 Ga0495635_0452073 3300046663 Bacteria 849
175 Ga0495600_0078006 3300046809 Bacteria 2163
176 Ga0495681_0072990 3300047470 Bacteria 1550
177 Ga0495686_0001102 3300047472 Bacteria 32107
178 Ga0495686_0008638 3300047472 Bacteria 7439
179 Ga0496100_0006263 3300048903 Bacteria 6477
180 Ga0496101_0566837 3300048904 Bacteria 898
181 Ga0496102_0004702 3300048905 Bacteria 11555
182 Ga0496116_0005115 3300048919 Bacteria 12315
183 Ga0496117_0000337 3300048920 Bacteria 82874
184 Ga0496118_0003438 3300048921 Bacteria 19933
185 Ga0496119_0003320 3300048922 Bacteria 16787
186 Ga0496119_0008204 3300048922 Bacteria 9238
187 Ga0496120_0002453 3300048923 Bacteria 18727
188 Ga0496120_0049392 3300048923 Bacteria 2415
189 Ga0496121_0001010 3300048924 Bacteria 50285
190 Ga0496121_0044739 3300048924 Bacteria 3814
191 Ga0496121_0127351 3300048924 Bacteria 1912
192 Ga0496122_0008259 3300048925 Bacteria 11290
193 Ga0496122_0011014 3300048925 Bacteria 9240
194 Ga0496123_0008271 3300048926 Bacteria 9587
195 Ga0496124_0045642 3300048927 Bacteria 3756
196 Ga0496124_0068202 3300048927 Bacteria 2957
197 Ga0496124_0238197 3300048927 Bacteria 1355
198 Ga0496125_0034355 3300048928 Bacteria 4471
199 Ga0496125_0070122 3300048928 Bacteria 2746
200 Ga0501032_0238665 3300049569 Bacteria 1181
201 Ga0501034_0159832 3300049571 Bacteria 2225
202 Ga0501036_0680685 3300049572 Bacteria 851
203 Ga0501037_0253805 3300049573 Bacteria 1230
204 Ga0501038_0502384 3300049574 Bacteria 927
205 Ga0501046_0371796 3300049580 Bacteria 1035
206 Ga0501047_0212987 3300049581 Bacteria 1790
207 Ga0501067_0153712 3300049583 Bacteria 1282
208 Ga0501083_0200350 3300049744 Bacteria 1302
209 nmdc:mga03683_91116_c1 3300050489 Bacteria 1329
210 nmdc:mga03n38_169004_c1 3300050490 Bacteria 1112
211 nmdc:mga0yw44_25229_c1 3300050492 Bacteria 3376
212 nmdc:mga0k408_427495_c1 3300050493 Bacteria 787
213 nmdc:mga07m45_149559_c1 3300050496 Bacteria 1354
214 nmdc:mga07m45_424743_c1 3300050496 Bacteria 771
215 Ga0495601_0381825 3300053077 Bacteria 914
216 Ga0500578_0192083 3300053086 Bacteria 1253
217 Ga0500643_000233 3300053087 Bacteria 51480
218 Ga0500643_054949 3300053087 Bacteria 1128
219 Ga0500643_078736 3300053087 Bacteria 907
220 Ga0500641_0000502 3300053096 Bacteria 14083
221 Ga0500556_0015343 3300053104 Bacteria 2361
222 Ga0500556_0019087 3300053104 Bacteria 2174
223 Ga0500557_017092 3300053105 Bacteria 1996
224 Ga0500562_006766 3300053108 Bacteria 2891
225 Ga0500562_019004 3300053108 Bacteria 1775
226 Ga0500614_095093 3300053123 Bacteria 852
227 Ga0500642_0119958 3300053130 Bacteria 1230
228 Ga0500652_161914 3300053131 Bacteria 924
229 Ga0500655_023793 3300053133 Bacteria 1158
230 Ga0500658_0098851 3300053134 Bacteria 1271
231 Ga0500568_0007545 3300053139 Bacteria 5323
232 Ga0500590_000370 3300053148 Bacteria 14900
233 Ga0500616_0030938 3300053153 Bacteria 2936
234 Ga0500616_0061267 3300053153 Bacteria 1948
235 Ga0500622_0031772 3300053156 Bacteria 2770
236 Ga0500622_0042356 3300053156 Bacteria 2366
237 Ga0500627_0130048 3300053158 Bacteria 1137
238 Ga0500633_0115946 3300053160 Bacteria 994
239 Ga0500636_0254858 3300053177 Bacteria 892
240 Ga0500645_001657 3300053730 Bacteria 10941
241 Ga0500645_001840 3300053730 Bacteria 10166
242 Ga0501082_0784820 3300060353 Bacteria 833
243 Ga0466962_0366358 3300061719 Bacteria 719

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0253805 Ga0501037_0253805_731_1180 149
2 iso_pu_bacteria 2855872281 2855879012 159
3 iso_pu_bacteria 2508501122 2509107411 169
4 iso_pu_bacteria 2511231052 2511500865 169
5 iso_pu_bacteria 2512047086 2512532287 169
6 iso_pu_bacteria 2512875026 2512972382 169
7 iso_pu_bacteria 2513237086 2513583597 169
8 iso_pu_bacteria 2513237089 2513603461 169
9 iso_pu_bacteria 2513237091 2513620876 169
10 iso_pu_bacteria 2513237140 2513882810 169
11 iso_pu_bacteria 2513237143 2513905353 169
12 iso_pu_bacteria 2513237156 2513985412 169
13 iso_pu_bacteria 2513237160 2514004916 169
14 iso_pu_bacteria 2516143018 2516208748 169
15 iso_pu_bacteria 2516653046 2516892137 169
16 iso_pu_bacteria 2517487022 2517568953 169
17 iso_pu_bacteria 2524023207 2524450187 169
18 iso_pu_bacteria 2551306084 2551676326 169
19 iso_pu_bacteria 2551306085 2551687433 169
20 iso_pu_bacteria 2551306086 2551695384 169
21 iso_pu_bacteria 2551306087 2551701225 169
22 iso_pu_bacteria 2551306089 2551714688 169
23 iso_pu_bacteria 2551306090 2551715721 169
24 iso_pu_bacteria 2551306091 2551724981 169
25 iso_pu_bacteria 2551306092 2551733283 169
26 iso_pu_bacteria 2551306093 2551744635 169
27 iso_pu_bacteria 2582581316 2585329790 169
28 iso_pu_bacteria 2657244999 2657682180 169
29 iso_pu_bacteria 2690316117 2692316958 169
30 iso_pu_bacteria 2791355082 2792584027 169
31 iso_pu_bacteria 2791355091 2792622169 169
32 iso_pu_bacteria 2791355092 2792628266 169
33 iso_pu_bacteria 2791355094 2792638477 169
34 iso_pu_bacteria 2802428858 2802717596 169
35 iso_pu_bacteria 2802428859 2802723477 169
36 iso_pu_bacteria 2802428860 2802731073 169
37 iso_pu_bacteria 2802428861 2802736079 169
38 iso_pu_bacteria 2802428862 2802743710 169
39 iso_pu_bacteria 2802428863 2802750578 169
40 iso_pu_bacteria 2802429268 2804751198 169
41 iso_pu_bacteria 2838074704 2838076306 169
42 iso_pu_bacteria 2847417321 2847417973 169
43 iso_pu_bacteria 2848992105 2848992949 169
44 iso_pu_bacteria 2855839649 2855840341 169
45 iso_pu_bacteria 2858800743 2858800872 169
46 iso_pu_bacteria 2913295892 2913297574 169
47 iso_pu_bacteria 2915980308 2915986075 169
48 iso_pu_bacteria 2915986958 2915988187 169
49 iso_pu_bacteria 2915993759 2915997930 169
50 iso_pu_bacteria 2916000859 2916005675 169
51 iso_pu_bacteria 2916007675 2916012826 169
52 iso_pu_bacteria 2916014648 2916020409 169
53 iso_pu_bacteria 2916021584 2916027579 169
54 iso_pu_bacteria 2916028427 2916034564 169
55 iso_pu_bacteria 2916041962 2916043321 169
56 iso_pu_bacteria 2916048683 2916052451 169
57 iso_pu_bacteria 2916055098 2916057637 169
58 iso_pu_bacteria 2916061851 2916067975 169
59 iso_pu_bacteria 2916068649 2916073790 169
60 iso_pu_bacteria 2916076590 2916076767 169
61 iso_pu_bacteria 2921201388 2921207648 169
62 iso_pu_bacteria 2921208531 2921212493 169
63 iso_pu_bacteria 2921237296 2921243888 169
64 iso_pu_bacteria 2921250672 2921250859 169
65 iso_pu_bacteria 2921257292 2921261055 169
66 iso_pu_bacteria 2921263974 2921269314 169
67 iso_pu_bacteria 2921289301 2921294019 169
68 iso_pu_bacteria 2921296804 2921298488 169
69 iso_pu_bacteria 2924150972 2924155930 169
70 iso_pu_bacteria 2924158325 2924160466 169
71 iso_pu_bacteria 2924165586 2924172373 169
72 iso_pu_bacteria 2924172951 2924178590 169
73 iso_pu_bacteria 2924179722 2924181533 169
74 iso_pu_bacteria 2924186466 2924190250 169
75 iso_pu_bacteria 2924193448 2924195996 169
76 iso_pu_bacteria 2924207177 2924207466 169
77 iso_pu_bacteria 2924214083 2924218961 169
78 iso_pu_bacteria 2924221636 2924223015 169
79 iso_pu_bacteria 2937002841 2937003350 169
80 iso_pu_bacteria 2937009748 2937010653 169
81 iso_pu_bacteria 2937016420 2937020776 169
82 iso_pu_bacteria 2937023124 2937028031 169
83 iso_pu_bacteria 2937029754 2937029963 169
84 iso_pu_bacteria 2937036028 2937038043 169
85 iso_pu_bacteria 2937042894 2937044634 169
86 iso_pu_bacteria 2937049772 2937052684 169
87 iso_pu_bacteria 2937056579 2937061640 169
88 iso_pu_bacteria 2937063883 2937066519 169
89 iso_pu_bacteria 2937071275 2937073772 169
90 iso_pu_bacteria 2937078374 2937083138 169
91 iso_pu_bacteria 2937084907 2937085241 169
92 iso_pu_bacteria 2937091812 2937097918 169
93 iso_pu_bacteria 2937098957 2937103734 169
94 iso_pu_bacteria 2937106411 2937111552 169
95 iso_pu_bacteria 2937113482 2937118279 169
96 iso_pu_bacteria 2937119839 2937120885 169
97 iso_pu_bacteria 2937126314 2937130192 169
98 iso_pu_bacteria 2957375807 2957380122 169
99 iso_pu_bacteria 2957382221 2957385176 169
100 iso_pu_bacteria 2957388812 2957389238 169
101 iso_pu_bacteria 2957395598 2957397072 169
102 iso_pu_bacteria 2957402308 2957402713 169
103 iso_pu_bacteria 2957408893 2957415174 169
104 iso_pu_bacteria 2957415311 2957417979 169
105 iso_pu_bacteria 2957422303 2957425861 169
106 iso_pu_bacteria 2957430029 2957433181 169
107 iso_pu_bacteria 2957437181 2957439881 169
108 iso_pu_bacteria 2957443900 2957449947 169
109 iso_pu_bacteria 2957450854 2957453547 169
110 iso_pu_bacteria 2957457609 2957457867 169
111 iso_pu_bacteria 2957471148 2957474022 169
112 iso_pu_bacteria 2957478035 2957483770 169
113 iso_pu_bacteria 2957484790 2957485387 169
114 iso_pu_bacteria 2957491536 2957495888 169
115 iso_pu_bacteria 2957498199 2957499771 169
116 iso_pu_bacteria 2957505466 2957510341 169
117 iso_pu_bacteria 2960584000 2960587973 169
118 iso_pu_bacteria 2960591022 2960595475 169
119 iso_pu_bacteria 2960597568 2960600682 169
120 iso_pu_bacteria 2960603979 2960604656 169
121 iso_pu_bacteria 2960610863 2960613838 169
122 iso_pu_bacteria 2960617483 2960617599 169
123 iso_pu_bacteria 2960624210 2960624658 169
124 iso_pu_bacteria 2960631154 2960633325 169
125 iso_pu_bacteria 2960637947 2960642304 169
126 iso_pu_bacteria 2960645483 2960646533 169
127 iso_pu_bacteria 2960652885 2960656835 169
128 iso_pu_bacteria 2960660292 2960662276 169
129 iso_pu_bacteria 2960667422 2960668472 169
130 iso_pu_bacteria 2960674078 2960677558 169
131 iso_pu_bacteria 2960680706 2960684065 169
132 iso_pu_bacteria 2960687367 2960691111 169
133 iso_pu_bacteria 2960693952 2960696276 169
134 iso_pu_bacteria 2964607997 2964612056 169
135 iso_pu_bacteria 2964615318 2964617577 169
136 iso_pu_bacteria 2964628898 2964633224 169
137 iso_pu_bacteria 2964636051 2964642075 169
138 iso_pu_bacteria 2964643177 2964644416 169
139 iso_pu_bacteria 2964649959 2964652997 169
140 iso_pu_bacteria 2964656573 2964661134 169
141 iso_pu_bacteria 2964663802 2964666080 169
142 iso_pu_bacteria 2964670856 2964671188 169
143 iso_pu_bacteria 2964678106 2964683639 169
144 iso_pu_bacteria 2964691889 2964693577 169
145 iso_pu_bacteria 2964698721 2964701920 169
146 iso_pu_bacteria 2964705432 2964712429 169
147 iso_pu_bacteria 2964712639 2964713595 169
148 iso_pu_bacteria 2964719344 2964723248 169
149 iso_pu_bacteria 2967664464 2967671443 169
150 iso_pu_bacteria 2967671571 2967673742 169
151 iso_pu_bacteria 2967678726 2967678818 169
152 iso_pu_bacteria 2967686174 2967686318 169
153 iso_pu_bacteria 2967693043 2967693139 169
154 iso_pu_bacteria 2967699805 2967703427 169
155 iso_pu_bacteria 2967706974 2967709273 169
156 iso_pu_bacteria 2967714385 2967716636 169
157 iso_pu_bacteria 2967721400 2967724752 169
158 iso_pu_bacteria 2967728569 2967730663 169
159 iso_pu_bacteria 2967735183 2967741004 169
160 iso_pu_bacteria 2967742019 2967746025 169
161 iso_pu_bacteria 2967748971 2967752212 169
162 iso_pu_bacteria 2967755722 2967757629 169
163 iso_pu_bacteria 2967762386 2967763714 169
164 iso_pu_bacteria 2967775926 2967777234 169
165 iso_pu_bacteria 2970019648 2970026736 169
166 iso_pu_bacteria 2970026789 2970030418 169
167 iso_pu_bacteria 2970033650 2970039184 169
168 iso_pu_bacteria 2970040964 2970042994 169
169 iso_pu_bacteria 2970047711 2970050025 169
170 iso_pu_bacteria 2970054988 2970059714 169
171 iso_pu_bacteria 2970061556 2970067004 169
172 iso_pu_bacteria 2970068827 2970074914 169
173 iso_pu_bacteria 2970076120 2970076471 169
174 iso_pu_bacteria 2970082768 2970086582 169
175 iso_pu_bacteria 2970095765 2970102292 169
176 iso_pu_bacteria 2970102677 2970108459 169
177 iso_pu_bacteria 2970109326 2970109925 169
178 iso_pu_bacteria 2970116247 2970118073 169
179 iso_pu_bacteria 2970122695 2970128276 169
180 iso_pu_bacteria 2970129317 2970129412 169
181 iso_pu_bacteria 2970136068 2970136921 169
182 iso_pu_bacteria 2970143518 2970149046 169
183 iso_pu_bacteria 2970149975 2970153921 169
184 iso_pu_bacteria 2970156795 2970164002 169
185 iso_pu_bacteria 2970164137 2970167397 169
186 iso_pu_bacteria 2970170962 2970171498 169
187 iso_pu_bacteria 2970177841 2970182243 169
188 iso_pu_bacteria 2970184632 2970185387 169
189 iso_pu_bacteria 2970191845 2970198431 169
190 iso_pu_bacteria 2977516862 2977518598 169
191 iso_pu_bacteria 2977523885 2977527169 169
192 iso_pu_bacteria 2977530762 2977533321 169
193 iso_pu_bacteria 2977537788 2977537883 169
194 iso_pu_bacteria 2977544691 2977544834 169
195 iso_pu_bacteria 2977551784 2977551880 169
196 iso_pu_bacteria 2977565890 2977568950 169
197 iso_pu_bacteria 2977572785 2977579067 169
198 iso_pu_bacteria 2977579622 2977581600 169
199 iso_pu_bacteria 643692032 643824948 169
200 iso_pu_bacteria 648276728 648737754 169
201 iso_pu_bacteria 8003992118 8003992756 169
202 iso_pu_bacteria 8003999396 8004000085 169
203 iso_pu_bacteria 8049293176 8049293779 169
204 3300050492 nmdc:mga0yw44_25229_c1 nmdc:mga0yw44_25229_c1_2585_3100 171
205 3300002987 JGI25159J45721_1000001 JGI25159J45721_1000001249 172
206 3300003187 JGI25151J46595_10041017 JGI25151J46595_100410172 172
207 3300003187 JGI25151J46595_10100057 JGI25151J46595_101000571 172
208 3300003354 JGI25160J50197_1000002 JGI25160J50197_100000265 172
209 3300003354 JGI25160J50197_1000047 JGI25160J50197_1000047114 172
210 3300003374 JGI25161J50226_1000033 JGI25161J50226_1000033114 172
211 3300003374 JGI25161J50226_1000383 JGI25161J50226_100038312 172
212 3300003771 Ga0055526_1003252 Ga0055526_10032522 172
213 3300003781 Ga0055536_1007248 Ga0055536_10072482 172
214 3300003781 Ga0055536_1007863 Ga0055536_10078635 172
215 3300003792 Ga0055540_1000387 Ga0055540_100038715 172
216 3300003792 Ga0055540_1024613 Ga0055540_10246132 172
217 3300003794 Ga0055531_10017638 Ga0055531_100176383 172
218 3300003794 Ga0055531_10018299 Ga0055531_100182992 172
219 3300003794 Ga0055531_10041354 Ga0055531_100413542 172
220 3300004625 Ga0055543_1000075 Ga0055543_100007543 172
221 3300004625 Ga0055543_1000137 Ga0055543_100013722 172
222 3300005262 Ga0065165_1000004 Ga0065165_1000004317 172
223 3300005262 Ga0065165_1000227 Ga0065165_100022771 172
224 3300005331 Ga0070670_100015485 Ga0070670_1000154852 172
225 3300005937 Ga0081455_10099564 Ga0081455_100995643 172
226 3300006048 Ga0075363_100134057 Ga0075363_1001340572 172
227 3300006195 Ga0075366_10450295 Ga0075366_104502952 172
228 3300006353 Ga0075370_10162307 Ga0075370_101623072 172
229 3300015690 Ga0183363_1142 Ga0183363_114212 172
230 3300025208 Ga0209436_100122 Ga0209436_1001229 172
231 3300025245 Ga0207425_1014224 Ga0207425_10142242 172
232 3300025273 Ga0209673_1002334 Ga0209673_100233412 172
233 3300025273 Ga0209673_1048468 Ga0209673_10484682 172
234 3300025284 Ga0209130_1000008 Ga0209130_1000008476 172
235 3300025284 Ga0209130_1000038 Ga0209130_1000038247 172
236 3300025292 Ga0209676_1006946 Ga0209676_10069465 172
237 3300025292 Ga0209676_1027847 Ga0209676_10278471 172
238 3300025292 Ga0209676_1070733 Ga0209676_10707331 172
239 3300025294 Ga0209025_1000100 Ga0209025_100010062 172
240 3300025294 Ga0209025_1026967 Ga0209025_10269672 172
241 3300025295 Ga0209564_1000104 Ga0209564_1000104158 172
242 3300025295 Ga0209564_1033107 Ga0209564_10331072 172
243 3300025298 Ga0209050_1007339 Ga0209050_10073394 172
244 3300025298 Ga0209050_1013597 Ga0209050_10135972 172
245 3300025299 Ga0209256_1000351 Ga0209256_10003518 172
246 3300025299 Ga0209256_1000723 Ga0209256_10007234 172
247 3300025302 Ga0207426_1000016 Ga0207426_100001686 172
248 3300025302 Ga0207426_1000081 Ga0207426_1000081287 172
249 3300025303 Ga0209051_1000127 Ga0209051_100012771 172
250 3300025303 Ga0209051_1006977 Ga0209051_10069774 172
251 3300025303 Ga0209051_1113124 Ga0209051_11131241 172
252 3300025304 Ga0209257_1004663 Ga0209257_10046636 172
253 3300025304 Ga0209257_1006889 Ga0209257_10068897 172
254 3300025925 Ga0207650_10020085 Ga0207650_100200852 172
255 3300041405 Ga0439438_105409 Ga0439438_105409_139_657 172
256 3300041413 Ga0439465_0051215 Ga0439465_0051215_490_1008 172
257 3300042015 Ga0439462_0090310 Ga0439462_0090310_184_702 172
258 3300046616 Ga0495668_0553278 Ga0495668_0553278_63_584 172
259 3300048923 Ga0496120_0049392 Ga0496120_0049392_1467_1985 172
260 3300048924 Ga0496121_0044739 Ga0496121_0044739_557_1075 172
261 3300048928 Ga0496125_0034355 Ga0496125_0034355_374_892 172
262 3300050489 nmdc:mga03683_91116_c1 nmdc:mga03683_91116_c1_528_1046 172
263 3300050490 nmdc:mga03n38_169004_c1 nmdc:mga03n38_169004_c1_286_804 172
264 3300050493 nmdc:mga0k408_427495_c1 nmdc:mga0k408_427495_c1_49_567 172
265 3300050496 nmdc:mga07m45_149559_c1 nmdc:mga07m45_149559_c1_284_802 172
266 3300053087 Ga0500643_000233 Ga0500643_000233_19792_20313 172
267 3300053087 Ga0500643_054949 Ga0500643_054949_443_964 172
268 3300053087 Ga0500643_078736 Ga0500643_078736_39_560 172
269 3300053096 Ga0500641_0000502 Ga0500641_0000502_2098_2619 172
270 3300053104 Ga0500556_0015343 Ga0500556_0015343_672_1193 172
271 3300053104 Ga0500556_0019087 Ga0500556_0019087_1528_2049 172
272 3300053108 Ga0500562_006766 Ga0500562_006766_2126_2647 172
273 3300053108 Ga0500562_019004 Ga0500562_019004_1072_1593 172
274 3300053131 Ga0500652_161914 Ga0500652_161914_311_832 172
275 3300053133 Ga0500655_023793 Ga0500655_023793_214_735 172
276 3300053153 Ga0500616_0030938 Ga0500616_0030938_467_988 172
277 3300053153 Ga0500616_0061267 Ga0500616_0061267_1361_1882 172
278 3300053156 Ga0500622_0031772 Ga0500622_0031772_322_843 172
279 3300053156 Ga0500622_0042356 Ga0500622_0042356_698_1219 172
280 3300053730 Ga0500645_001657 Ga0500645_001657_9954_10475 172
281 3300053730 Ga0500645_001840 Ga0500645_001840_2437_2958 172
282 iso_pu_bacteria 2838016132 2838017090 172
283 iso_pu_bacteria 2838061910 2838067147 172
284 iso_pu_bacteria 2838068647 2838073135 172
285 3300002705 JGI25156J39149_1000147 JGI25156J39149_100014738 173
286 3300002737 JGI25162J39368_1000243 JGI25162J39368_100024320 173
287 3300002738 JGI25154J39366_1000160 JGI25154J39366_100016026 173
288 3300002741 JGI25157J39369_1000190 JGI25157J39369_100019038 173
289 3300002773 JGI25152J39213_1008268 JGI25152J39213_10082681 173
290 3300003187 JGI25151J46595_10008997 JGI25151J46595_100089975 173
291 3300003187 JGI25151J46595_10013706 JGI25151J46595_100137062 173
292 3300003214 JGI25165J46597_1000318 JGI25165J46597_100031846 173
293 3300003214 JGI25165J46597_1000413 JGI25165J46597_10004137 173
294 3300003214 JGI25165J46597_1000468 JGI25165J46597_100046811 173
295 3300003215 JGI25153J46596_10003001 JGI25153J46596_100030016 173
296 3300003316 rootH1_10154653 rootH1_101546532 173
297 3300003320 rootH2_10129835 rootH2_101298352 173
298 3300003322 rootL2_10071775 rootL2_100717751 173
299 3300003323 rootH1_10168137 rootH1_101681372 173
300 3300003752 Ga0055539_1017692 Ga0055539_10176921 173
301 3300003771 Ga0055526_1001451 Ga0055526_10014513 173
302 3300003771 Ga0055526_1005299 Ga0055526_10052992 173
303 3300003771 Ga0055526_1014521 Ga0055526_10145212 173
304 3300003775 Ga0055524_1015131 Ga0055524_10151312 173
305 3300003775 Ga0055524_1069318 Ga0055524_10693181 173
306 3300003790 Ga0055528_1000560 Ga0055528_10005609 173
307 3300003790 Ga0055528_1000920 Ga0055528_10009202 173
308 3300003792 Ga0055540_1009950 Ga0055540_10099505 173
309 3300005548 Ga0070665_100233693 Ga0070665_1002336932 173
310 3300005616 Ga0068852_100373118 Ga0068852_1003731182 173
311 3300006353 Ga0075370_10393621 Ga0075370_103936212 173
312 3300009093 Ga0105240_10000027 Ga0105240_10000027257 173
313 3300009177 Ga0105248_11133692 Ga0105248_111336922 173
314 3300009545 Ga0105237_10001067 Ga0105237_1000106714 173
315 3300009551 Ga0105238_11144193 Ga0105238_111441932 173
316 3300009765 Ga0123341_1000006 Ga0123341_100000640 173
317 3300009766 Ga0123342_1023248 Ga0123342_10232482 173
318 3300010375 Ga0105239_10004606 Ga0105239_100046067 173
319 3300013104 Ga0157370_10000223 Ga0157370_1000022355 173
320 3300015262 Ga0182007_10003176 Ga0182007_100031767 173
321 3300015265 Ga0182005_1005289 Ga0182005_10052892 173
322 3300021320 Ga0214544_1000008 Ga0214544_100000885 173
323 3300021321 Ga0214542_1000010 Ga0214542_100001041 173
324 3300021327 Ga0214543_1000003 Ga0214543_1000003334 173
325 3300021327 Ga0214543_1000004 Ga0214543_100000463 173
326 3300022739 Ga0228711_1000001 Ga0228711_1000001213 173
327 3300022740 Ga0228710_1000001 Ga0228710_1000001111 173
328 3300025206 Ga0209435_100036 Ga0209435_10003626 173
329 3300025207 Ga0209760_104687 Ga0209760_1046872 173
330 3300025233 Ga0209437_100033 Ga0209437_100033121 173
331 3300025233 Ga0209437_100036 Ga0209437_100036373 173
332 3300025245 Ga0207425_1003334 Ga0207425_10033345 173
333 3300025246 Ga0209646_1000132 Ga0209646_100013226 173
334 3300025250 Ga0209026_1000313 Ga0209026_100031337 173
335 3300025253 Ga0209677_100562 Ga0209677_10056212 173
336 3300025254 Ga0209148_1047233 Ga0209148_10472331 173
337 3300025256 Ga0209759_1000417 Ga0209759_100041737 173
338 3300025258 Ga0209129_1000078 Ga0209129_1000078185 173
339 3300025258 Ga0209129_1000555 Ga0209129_10005557 173
340 3300025258 Ga0209129_1000918 Ga0209129_100091810 173
341 3300025258 Ga0209129_1006525 Ga0209129_10065252 173
342 3300025261 Ga0209233_1000056 Ga0209233_1000056218 173
343 3300025261 Ga0209233_1000064 Ga0209233_1000064305 173
344 3300025261 Ga0209233_1000152 Ga0209233_100015259 173
345 3300025273 Ga0209673_1000683 Ga0209673_100068317 173
346 3300025273 Ga0209673_1003020 Ga0209673_10030203 173
347 3300025294 Ga0209025_1003355 Ga0209025_10033552 173
348 3300025294 Ga0209025_1016997 Ga0209025_10169975 173
349 3300025295 Ga0209564_1001249 Ga0209564_10012499 173
350 3300025295 Ga0209564_1003612 Ga0209564_10036122 173
351 3300025297 Ga0209758_1000148 Ga0209758_100014865 173
352 3300025297 Ga0209758_1001484 Ga0209758_10014845 173
353 3300025297 Ga0209758_1001492 Ga0209758_100149220 173
354 3300025297 Ga0209758_1008477 Ga0209758_10084777 173
355 3300025299 Ga0209256_1001279 Ga0209256_100127927 173
356 3300025299 Ga0209256_1002414 Ga0209256_100241412 173
357 3300025303 Ga0209051_1003325 Ga0209051_10033252 173
358 3300025303 Ga0209051_1029046 Ga0209051_10290462 173
359 3300025913 Ga0207695_10000024 Ga0207695_10000024374 173
360 3300025914 Ga0207671_10001277 Ga0207671_1000127722 173
361 3300025941 Ga0207711_11647235 Ga0207711_116472351 173
362 3300026142 Ga0207698_10395685 Ga0207698_103956852 173
363 3300027111 Ga0209281_1000164 Ga0209281_1000164118 173
364 3300027666 Ga0209282_1000007 Ga0209282_100000738 173
365 3300028379 Ga0268266_10373479 Ga0268266_103734792 173
366 3300028794 Ga0307515_10000115 Ga0307515_1000011518 173
367 3300028794 Ga0307515_10003008 Ga0307515_1000300820 173
368 3300030500 Ga0268256_1008389 Ga0268256_10083894 173
369 3300031456 Ga0307513_10025414 Ga0307513_100254141 173
370 3300031911 Ga0307412_10428475 Ga0307412_104284752 173
371 3300031967 Ga0315914_1000006 Ga0315914_1000006204 173
372 3300031995 Ga0307409_100101473 Ga0307409_1001014732 173
373 3300032005 Ga0307411_10229850 Ga0307411_102298502 173
374 3300033430 Ga0315913_1000002 Ga0315913_100000238 173
375 3300033464 Ga0315915_1000001 Ga0315915_1000001448 173
376 3300041404 Ga0439436_0019881 Ga0439436_0019881_594_1121 173
377 3300041413 Ga0439465_0037515 Ga0439465_0037515_665_1189 173
378 3300041997 Ga0439431_0046309 Ga0439431_0046309_123_647 173
379 3300042006 Ga0439432_061178 Ga0439432_061178_312_839 173
380 3300042007 Ga0439449_0110244 Ga0439449_0110244_121_645 173
381 3300042435 Ga0439434_0185162 Ga0439434_0185162_88_615 173
382 3300044694 Ga0466963_0010524 Ga0466963_0010524_424_945 173
383 3300044765 Ga0466970_0005664 Ga0466970_0005664_565_1086 173
384 3300044842 Ga0466957_0035064 Ga0466957_0035064_1945_2466 173
385 3300045836 Ga0466958_0226079 Ga0466958_0226079_390_911 173
386 3300045976 Ga0466967_0411430 Ga0466967_0411430_542_1063 173
387 3300046454 Ga0495592_0080593 Ga0495592_0080593_1452_1988 173
388 3300046459 Ga0495629_0090839 Ga0495629_0090839_811_1347 173
389 3300046473 Ga0495582_0475736 Ga0495582_0475736_137_673 173
390 3300046474 Ga0495605_0000415 Ga0495605_0000415_14418_14942 173
391 3300046475 Ga0495639_0433113 Ga0495639_0433113_78_614 173
392 3300046476 Ga0495662_0025243 Ga0495662_0025243_1035_1571 173
393 3300046501 Ga0495607_0108820 Ga0495607_0108820_254_778 173
394 3300046507 Ga0495606_0000485 Ga0495606_0000485_23050_23577 173
395 3300046507 Ga0495606_0045315 Ga0495606_0045315_493_1020 173
396 3300046518 Ga0495631_0003883 Ga0495631_0003883_7000_7524 173
397 3300046519 Ga0495632_0025549 Ga0495632_0025549_2359_2883 173
398 3300046529 Ga0495652_0409200 Ga0495652_0409200_60_596 173
399 3300046530 Ga0495654_0128496 Ga0495654_0128496_455_979 173
400 3300046538 Ga0495609_0035531 Ga0495609_0035531_1311_1835 173
401 3300046616 Ga0495668_0106516 Ga0495668_0106516_47_571 173
402 3300046648 Ga0495611_0071099 Ga0495611_0071099_393_917 173
403 3300046660 Ga0495625_0014663 Ga0495625_0014663_5333_5857 173
404 3300046663 Ga0495635_0452073 Ga0495635_0452073_218_754 173
405 3300046809 Ga0495600_0078006 Ga0495600_0078006_539_1159 173
406 3300047470 Ga0495681_0072990 Ga0495681_0072990_891_1412 173
407 3300047472 Ga0495686_0001102 Ga0495686_0001102_30508_31035 173
408 3300047472 Ga0495686_0008638 Ga0495686_0008638_387_914 173
409 3300048903 Ga0496100_0006263 Ga0496100_0006263_5521_6042 173
410 3300048904 Ga0496101_0566837 Ga0496101_0566837_117_644 173
411 3300048905 Ga0496102_0004702 Ga0496102_0004702_9801_10322 173
412 3300048919 Ga0496116_0005115 Ga0496116_0005115_6209_6730 173
413 3300048920 Ga0496117_0000337 Ga0496117_0000337_30579_31100 173
414 3300048921 Ga0496118_0003438 Ga0496118_0003438_11818_12339 173
415 3300048922 Ga0496119_0003320 Ga0496119_0003320_6770_7291 173
416 3300048922 Ga0496119_0008204 Ga0496119_0008204_321_848 173
417 3300048923 Ga0496120_0002453 Ga0496120_0002453_10612_11133 173
418 3300048924 Ga0496121_0001010 Ga0496121_0001010_13818_14339 173
419 3300048924 Ga0496121_0127351 Ga0496121_0127351_971_1498 173
420 3300048925 Ga0496122_0008259 Ga0496122_0008259_270_797 173
421 3300048925 Ga0496122_0011014 Ga0496122_0011014_1223_1744 173
422 3300048926 Ga0496123_0008271 Ga0496123_0008271_7497_8018 173
423 3300048927 Ga0496124_0045642 Ga0496124_0045642_2858_3385 173
424 3300048927 Ga0496124_0068202 Ga0496124_0068202_1956_2477 173
425 3300048927 Ga0496124_0238197 Ga0496124_0238197_93_617 173
426 3300048928 Ga0496125_0070122 Ga0496125_0070122_354_875 173
427 3300049569 Ga0501032_0238665 Ga0501032_0238665_153_677 173
428 3300049571 Ga0501034_0159832 Ga0501034_0159832_269_793 173
429 3300049572 Ga0501036_0680685 Ga0501036_0680685_155_679 173
430 3300049574 Ga0501038_0502384 Ga0501038_0502384_105_629 173
431 3300049580 Ga0501046_0371796 Ga0501046_0371796_493_1017 173
432 3300049581 Ga0501047_0212987 Ga0501047_0212987_614_1138 173
433 3300049583 Ga0501067_0153712 Ga0501067_0153712_292_816 173
434 3300049744 Ga0501083_0200350 Ga0501083_0200350_82_609 173
435 3300050496 nmdc:mga07m45_424743_c1 nmdc:mga07m45_424743_c1_93_617 173
436 3300053077 Ga0495601_0381825 Ga0495601_0381825_265_801 173
437 3300053086 Ga0500578_0192083 Ga0500578_0192083_242_766 173
438 3300053105 Ga0500557_017092 Ga0500557_017092_866_1390 173
439 3300053123 Ga0500614_095093 Ga0500614_095093_25_561 173
440 3300053130 Ga0500642_0119958 Ga0500642_0119958_11_535 173
441 3300053134 Ga0500658_0098851 Ga0500658_0098851_322_861 173
442 3300053139 Ga0500568_0007545 Ga0500568_0007545_4452_4991 173
443 3300053148 Ga0500590_000370 Ga0500590_000370_13963_14499 173
444 3300053158 Ga0500627_0130048 Ga0500627_0130048_231_755 173
445 3300053160 Ga0500633_0115946 Ga0500633_0115946_357_896 173
446 3300053177 Ga0500636_0254858 Ga0500636_0254858_255_875 173
447 3300060353 Ga0501082_0784820 Ga0501082_0784820_142_666 173
448 3300061719 Ga0466962_0366358 Ga0466962_0366358_92_613 173

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08002

DUF1697

Protein of unknown function (DUF1697)

1

133

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hiy-assembly1.cif.gz_B the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7991 2 167
2hiy-assembly1.cif.gz_A the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7975 1 168
3v97-assembly2.cif.gz_B crystal structure of bifunctional methyltransferase ycby (rlmlk) from escherichia coli, sah binding 0.7774 1 50
2hiy-assembly1.cif.gz_A the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7733 1 168
3v8v-assembly1.cif.gz_A crystal structure of bifunctional methyltransferase ycby (rlmlk) from escherichia coli, sam binding 0.7729 1 51
ID Description Score Start End Superfamily
af_O06552_36_123_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.8949 2 83 3.30.70.1280
af_Q54C13_1_90_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.8691 1 87 3.30.70.1280
3bp1A01 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8622 50 81 3.30.1130.10
af_Q54C13_1_90_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.8343 1 87 3.30.70.1280
2hiyB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.8205 1 88 3.30.70.1280
ID Description Score Start End GO Terms
AF-A0A7W5TRN7-F1-model_v4 Uncharacterized protein (DUF1697 family) 0.9816 21 173
AF-A0A7Y2QB25-F1-model_v4 DUF1697 domain-containing protein 0.9753 52 172
AF-A0A7W5TRN7-F1-model_v4 Uncharacterized protein (DUF1697 family) 0.9753 21 173
AF-A0A1B9SPG8-F1-model_v4 DUF1697 domain-containing protein 0.9674 1 173
AF-A0A560LVU7-F1-model_v4 Uncharacterized protein (DUF1697 family) 0.9615 1 172

Feature Viewer

pLDDT pTM Quality
92.61 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map