F445959

General Info

Members Datasets Scaffolds Average Seq Length
447 332 894 117

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10190174|Ga0207699_101901741
Length 130
Sequence MRVNVLVSFDTPMMNDKINLDAKLATFSEHYQPRTVAQLNDNDVMVVKLKGPFVWHKHDETDDFFLVLRGTLDIELRDRVVTLGPGELFVVPKGVEHRPVAREEVHLLLIEPTGTPNTGDSRTAAPRRLA

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
227 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
228 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
246 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
247 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
248 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
269 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
270 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
271 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
272 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
273 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
274 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
275 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
276 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
277 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
278 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
279 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
280 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
283 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
284 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
285 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
286 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
287 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
288 2738541337 Pelomonas sp. BT06 Isolate Unclassified
289 2791355199
290 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
291 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
292 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
293 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
294 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
295 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
296 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
297 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
298 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
299 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
300 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
301 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
302 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
303 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
304 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
305 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
306 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
307 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
308 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
309 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
310 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
311 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
312 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
313 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
314 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
315 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
316 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
317 2922368715
318 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
319 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
320 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
321 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
322 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
323 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
324 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
325 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
326 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
327 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
328 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
329 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
330 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
331 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
332 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.99
Metatranscriptomes 0
Isolates 11.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.75
Nodule 6.71
Rhizoplane 4.03
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 2.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10190174 3300025906 Bacteria 1385
2 JGI24739J22299_10042114 3300001989 Bacteria 1515
3 JGI24735J21928_10156468 3300002067 Bacteria 658
4 JGI25153J46596_10001642 3300003215 Bacteria 13270
5 JGI25153J46596_10015322 3300003215 Bacteria 3129
6 rootL2_10140017 3300003322 Bacteria 2061
7 JGI25160J50197_1016506 3300003354 Bacteria 2377
8 Ga0055542_1003412 3300003762 Bacteria 4319
9 Ga0055526_1041654 3300003771 Bacteria 1141
10 Ga0055543_1021373 3300004625 Bacteria 1180
11 Ga0065165_1008543 3300005262 Bacteria 4764
12 Ga0070676_10551775 3300005328 Bacteria 825
13 Ga0070690_100577137 3300005330 Bacteria 851
14 Ga0070670_100409357 3300005331 Bacteria 1198
15 Ga0070670_101094215 3300005331 Bacteria 727
16 Ga0070677_10257933 3300005333 Bacteria 869
17 Ga0070666_10134490 3300005335 Bacteria 1719
18 Ga0068868_100111736 3300005338 Bacteria 2221
19 Ga0070689_101269508 3300005340 Bacteria 663
20 Ga0070668_100162103 3300005347 Bacteria 1815
21 Ga0070669_100357490 3300005353 Bacteria 1187
22 Ga0070669_100363956 3300005353 Bacteria 1177
23 Ga0070669_100407455 3300005353 Bacteria 1114
24 Ga0070669_100493238 3300005353 Bacteria 1015
25 Ga0070675_100179543 3300005354 Bacteria 1830
26 Ga0070675_100723120 3300005354 Bacteria 907
27 Ga0070675_100723121 3300005354 Bacteria 907
28 Ga0070671_100172011 3300005355 Bacteria 1832
29 Ga0070674_100046614 3300005356 Bacteria 2966
30 Ga0070673_100849662 3300005364 Bacteria 845
31 Ga0070673_101159966 3300005364 Bacteria 723
32 Ga0070688_101018096 3300005365 Bacteria 659
33 Ga0070688_101324142 3300005365 Bacteria 582
34 Ga0070659_100390875 3300005366 Bacteria 1173
35 Ga0070703_10249906 3300005406 Bacteria 719
36 Ga0070709_10035425 3300005434 Bacteria 3033
37 Ga0070714_100023755 3300005435 Bacteria 5041
38 Ga0070714_100762258 3300005435 Bacteria 936
39 Ga0070714_100815462 3300005435 Bacteria 904
40 Ga0070714_102103202 3300005435 Bacteria 550
41 Ga0070713_100055655 3300005436 Bacteria 3288
42 Ga0070710_10048027 3300005437 Bacteria 2383
43 Ga0070711_101646743 3300005439 Bacteria 562
44 Ga0070708_101786103 3300005445 Bacteria 571
45 Ga0070663_100065517 3300005455 Bacteria 2630
46 Ga0070678_100072947 3300005456 Bacteria 2575
47 Ga0070678_100753877 3300005456 Bacteria 881
48 Ga0070662_101060125 3300005457 Bacteria 695
49 Ga0070681_11272780 3300005458 Bacteria 658
50 Ga0068867_100101337 3300005459 Bacteria 2200
51 Ga0068867_101589749 3300005459 Bacteria 611
52 Ga0070707_101791446 3300005468 Bacteria 581
53 Ga0070698_100140350 3300005471 Bacteria 2368
54 Ga0070698_100220850 3300005471 Bacteria 1828
55 Ga0068853_100544340 3300005539 Bacteria 1099
56 Ga0068853_101034884 3300005539 Bacteria 791
57 Ga0068853_101786101 3300005539 Bacteria 596
58 Ga0070672_100121502 3300005543 Bacteria 2138
59 Ga0070672_100902452 3300005543 Bacteria 781
60 Ga0070686_100219418 3300005544 Bacteria 1373
61 Ga0070686_100441329 3300005544 Bacteria 999
62 Ga0070696_100265315 3300005546 Bacteria 1304
63 Ga0070665_100008665 3300005548 Bacteria 10293
64 Ga0070665_100257079 3300005548 Bacteria 1748
65 Ga0070665_100823760 3300005548 Bacteria 941
66 Ga0070665_101773606 3300005548 Bacteria 624
67 Ga0068855_100130859 3300005563 Bacteria 2866
68 Ga0068857_100170731 3300005577 Bacteria 1977
69 Ga0068854_100652421 3300005578 Bacteria 904
70 Ga0068856_100079545 3300005614 Bacteria 3251
71 Ga0068852_100278419 3300005616 Bacteria 1612
72 Ga0068852_100438545 3300005616 Bacteria 1291
73 Ga0068864_100605934 3300005618 Bacteria 1063
74 Ga0068866_10581730 3300005718 Bacteria 753
75 Ga0068870_10285836 3300005840 Bacteria 1036
76 Ga0068863_100070964 3300005841 Bacteria 3295
77 Ga0068858_100222449 3300005842 Bacteria 1788
78 Ga0068860_100012024 3300005843 Bacteria 8525
79 Ga0081455_10027745 3300005937 Bacteria 5184
80 Ga0081455_10712602 3300005937 Bacteria 638
81 Ga0081538_10142872 3300005981 Unclassified 1099
82 Ga0081540_1003598 3300005983 Bacteria 12163
83 Ga0081540_1035101 3300005983 Bacteria 2694
84 Ga0081540_1043690 3300005983 Bacteria 2295
85 Ga0081540_1051399 3300005983 Bacteria 2038
86 Ga0081540_1100814 3300005983 Bacteria 1244
87 Ga0070717_10004184 3300006028 Bacteria 10400
88 Ga0070717_10700656 3300006028 Bacteria 920
89 Ga0075365_10766965 3300006038 Bacteria 681
90 Ga0075368_10003147 3300006042 Bacteria 5481
91 Ga0075364_10033611 3300006051 Bacteria 3304
92 Ga0070712_100152295 3300006175 Bacteria 1777
93 Ga0070712_100202573 3300006175 Bacteria 1560
94 Ga0075362_10042783 3300006177 Bacteria 2004
95 Ga0075362_10094522 3300006177 Bacteria 1391
96 Ga0075367_10031731 3300006178 Bacteria 3035
97 Ga0075366_10010406 3300006195 Bacteria 5224
98 Ga0075428_100166242 3300006844 Bacteria 2393
99 Ga0075431_100092764 3300006847 Bacteria 3117
100 Ga0075434_101288244 3300006871 Bacteria 742
101 Ga0075429_100535638 3300006880 Unclassified 1026
102 Ga0068865_100970803 3300006881 Bacteria 743
103 Ga0075435_101246322 3300007076 Unclassified 651
104 Ga0075435_101340093 3300007076 Bacteria 627
105 Ga0099794_10351881 3300007265 Bacteria 766
106 Ga0111539_10163136 3300009094 Bacteria 2606
107 Ga0111539_10465138 3300009094 Bacteria 1473
108 Ga0111539_12051723 3300009094 Bacteria 663
109 Ga0114129_11520573 3300009147 Bacteria 822
110 Ga0105243_10981467 3300009148 Bacteria 846
111 Ga0105241_10476997 3300009174 Bacteria 1108
112 Ga0105242_10828764 3300009176 Bacteria 918
113 Ga0105248_10236746 3300009177 Bacteria 2055
114 Ga0105237_10084260 3300009545 Bacteria 3169
115 Ga0105237_10894247 3300009545 Bacteria 895
116 Ga0105237_11741386 3300009545 Bacteria 631
117 Ga0105238_10263859 3300009551 Bacteria 1702
118 Ga0105249_11225605 3300009553 Bacteria 821
119 Ga0105239_10078516 3300010375 Bacteria 3633
120 Ga0105239_10199340 3300010375 Bacteria 2242
121 Ga0105239_10374953 3300010375 Bacteria 1608
122 Ga0105239_10758258 3300010375 Bacteria 1111
123 Ga0157369_12364623 3300013105 Bacteria 538
124 Ga0157374_10016270 3300013296 Bacteria 6536
125 Ga0157378_10392396 3300013297 Bacteria 1365
126 Ga0157378_11412671 3300013297 Bacteria 739
127 Ga0157375_12794308 3300013308 Bacteria 584
128 Ga0157380_10621132 3300014326 Bacteria 1073
129 Ga0157380_12139970 3300014326 Bacteria 623
130 Ga0182008_10402271 3300014497 Bacteria 736
131 Ga0157377_10218907 3300014745 Bacteria 1218
132 Ga0157376_11126871 3300014969 Bacteria 811
133 Ga0163161_10328219 3300017792 Bacteria 1211
134 Ga0163161_10919606 3300017792 Bacteria 742
135 Ga0213876_10001872 3300021384 Bacteria 12662
136 Ga0209148_1000709 3300025254 Bacteria 26771
137 Ga0209233_1001780 3300025261 Bacteria 8297
138 Ga0209233_1005782 3300025261 Bacteria 4064
139 Ga0209455_1002909 3300025272 Bacteria 6321
140 Ga0209673_1029520 3300025273 Bacteria 1744
141 Ga0209564_1004419 3300025295 Bacteria 8615
142 Ga0209758_1000794 3300025297 Bacteria 44893
143 Ga0209758_1004112 3300025297 Bacteria 12464
144 Ga0209758_1107767 3300025297 Bacteria 777
145 Ga0209758_1137533 3300025297 Bacteria 637
146 Ga0207426_1001034 3300025302 Bacteria 26567
147 Ga0207426_1001857 3300025302 Bacteria 15502
148 Ga0207426_1004466 3300025302 Bacteria 6810
149 Ga0209051_1072280 3300025303 Bacteria 1032
150 Ga0209257_1010614 3300025304 Bacteria 4617
151 Ga0209257_1036771 3300025304 Bacteria 1500
152 Ga0207697_10092002 3300025315 Bacteria 1286
153 Ga0207682_10007521 3300025893 Bacteria 4334
154 Ga0207692_10293578 3300025898 Bacteria 987
155 Ga0207688_10050585 3300025901 Bacteria 2326
156 Ga0207688_10050825 3300025901 Bacteria 2322
157 Ga0207647_10004805 3300025904 Bacteria 10003
158 Ga0207699_10086906 3300025906 Bacteria 1954
159 Ga0207643_10256039 3300025908 Bacteria 1079
160 Ga0207684_10916506 3300025910 Bacteria 736
161 Ga0207654_10560582 3300025911 Bacteria 812
162 Ga0207671_10227755 3300025914 Bacteria 1462
163 Ga0207693_10075417 3300025915 Bacteria 2641
164 Ga0207693_10239748 3300025915 Bacteria 1423
165 Ga0207662_10138093 3300025918 Bacteria 1542
166 Ga0207646_10288531 3300025922 Bacteria 1483
167 Ga0207681_10232389 3300025923 Bacteria 1432
168 Ga0207681_10350924 3300025923 Bacteria 1181
169 Ga0207694_10331923 3300025924 Bacteria 1256
170 Ga0207694_10766177 3300025924 Bacteria 815
171 Ga0207700_10110257 3300025928 Bacteria 2213
172 Ga0207700_10247454 3300025928 Bacteria 1522
173 Ga0207664_10251774 3300025929 Bacteria 1542
174 Ga0207664_11144382 3300025929 Bacteria 695
175 Ga0207644_10253223 3300025931 Bacteria 1405
176 Ga0207706_10873307 3300025933 Bacteria 761
177 Ga0207709_10753611 3300025935 Bacteria 783
178 Ga0207670_10342635 3300025936 Bacteria 1182
179 Ga0207669_10076277 3300025937 Bacteria 2127
180 Ga0207704_10058289 3300025938 Bacteria 2377
181 Ga0207691_10109536 3300025940 Bacteria 2457
182 Ga0207691_10874967 3300025940 Bacteria 753
183 Ga0207691_11561813 3300025940 Bacteria 538
184 Ga0207711_10976455 3300025941 Bacteria 786
185 Ga0207651_10735449 3300025960 Bacteria 871
186 Ga0207712_10832615 3300025961 Bacteria 813
187 Ga0207712_11022541 3300025961 Bacteria 734
188 Ga0207640_10638029 3300025981 Bacteria 906
189 Ga0207677_10080935 3300026023 Bacteria 2329
190 Ga0207703_10161041 3300026035 Bacteria 1965
191 Ga0207703_11768417 3300026035 Bacteria 594
192 Ga0207639_10918129 3300026041 Bacteria 819
193 Ga0207678_10218267 3300026067 Bacteria 1632
194 Ga0207702_10255302 3300026078 Bacteria 1648
195 Ga0207641_10054099 3300026088 Bacteria 3405
196 Ga0207648_10029777 3300026089 Bacteria 4841
197 Ga0207676_10580834 3300026095 Bacteria 1074
198 Ga0207676_10631473 3300026095 Bacteria 1032
199 Ga0207674_10311198 3300026116 Bacteria 1524
200 Ga0207674_11059170 3300026116 Bacteria 780
201 Ga0207675_100695926 3300026118 Bacteria 1025
202 Ga0207683_10032197 3300026121 Bacteria 4554
203 Ga0209813_10036372 3300027866 Bacteria 1479
204 Ga0268266_10596643 3300028379 Bacteria 1061
205 Ga0268264_10050758 3300028381 Bacteria 3455
206 Ga0268264_12412572 3300028381 Bacteria 532
207 Ga0265316_10776310 3300031344 Bacteria 673
208 Ga0307513_10122002 3300031456 Bacteria 2571
209 Ga0307513_10379621 3300031456 Bacteria 1153
210 Ga0307416_100358790 3300032002 Bacteria 1479
211 Ga0307414_10968689 3300032004 Bacteria 782
212 Ga0373926_0084927 3300035083 Bacteria 1174
213 Ga0373934_0001898 3300035086 Bacteria 7658
214 Ga0373944_0255056 3300035089 Bacteria 648
215 Ga0373923_0011615 3300035111 Unclassified 3236
216 Ga0373945_0019547 3300035116 Bacteria 2314
217 Ga0373954_0009379 3300035118 Bacteria 4306
218 Ga0373956_0008661 3300035119 Bacteria 4118
219 Ga0373957_0031516 3300035120 Unclassified 1948
220 Ga0373955_0008259 3300035172 Bacteria 4828
221 Ga0373931_1160730 3300035691 Bacteria 528
222 Ga0373935_0120322 3300035692 Bacteria 1753
223 Ga0373927_0052924 3300035695 Bacteria 2625
224 Ga0373933_0014419 3300035724 Bacteria 4396
225 Ga0373947_0002303 3300035725 Bacteria 11551
226 Ga0373937_0035599 3300036401 Bacteria 4532
227 Ga0373925_0220848 3300037068 Bacteria 1512
228 Ga0395905_0091361 3300037471 Bacteria 2854
229 Ga0395905_0363119 3300037471 Bacteria 1341
230 Ga0436365_1285876 3300039437 Bacteria 1202
231 Ga0436365_1869970 3300039437 Bacteria 25445
232 Ga0451853_2998989 3300041512 Bacteria 985
233 Ga0451577_0015845 3300042876 Bacteria 6995
234 Ga0466965_0655188 3300044683 Bacteria 600
235 Ga0466966_0115434 3300044684 Bacteria 1653
236 Ga0466959_0051371 3300045049 Bacteria 3024
237 Ga0466967_0051029 3300045976 Bacteria 3624
238 Ga0466967_1673847 3300045976 Bacteria 634
239 Ga0495592_0050022 3300046454 Bacteria 3106
240 Ga0495603_0591783 3300046455 Bacteria 635
241 Ga0495629_0004044 3300046459 Bacteria 11024
242 Ga0495629_0062899 3300046459 Bacteria 2592
243 Ga0495629_0321356 3300046459 Bacteria 1058
244 Ga0495638_0012740 3300046460 Bacteria 5748
245 Ga0495638_0268512 3300046460 Bacteria 932
246 Ga0495641_0321172 3300046461 Bacteria 699
247 Ga0495641_0331457 3300046461 Bacteria 687
248 Ga0495651_0039849 3300046462 Bacteria 3655
249 Ga0495653_0002091 3300046463 Bacteria 15723
250 Ga0495580_0092640 3300046472 Bacteria 2103
251 Ga0495639_0009858 3300046475 Bacteria 4101
252 Ga0495639_0457539 3300046475 Bacteria 649
253 Ga0495664_0072206 3300046477 Bacteria 2062
254 Ga0495664_0133403 3300046477 Bacteria 1504
255 Ga0495664_0742357 3300046477 Bacteria 579
256 Ga0495606_0080914 3300046507 Bacteria 2020
257 Ga0495608_0013037 3300046511 Bacteria 5767
258 Ga0495618_0018473 3300046514 Bacteria 4280
259 Ga0495620_0082803 3300046515 Bacteria 1296
260 Ga0495620_0123368 3300046515 Bacteria 1020
261 Ga0495628_0012203 3300046516 Bacteria 7243
262 Ga0495628_0230709 3300046516 Bacteria 1388
263 Ga0495630_0007347 3300046517 Bacteria 7868
264 Ga0495630_0764386 3300046517 Bacteria 738
265 Ga0495630_1302196 3300046517 Bacteria 548
266 Ga0495643_0023068 3300046522 Bacteria 3541
267 Ga0495663_0159347 3300046525 Bacteria 774
268 Ga0495652_0014481 3300046529 Bacteria 7078
269 Ga0495652_0095093 3300046529 Bacteria 2429
270 Ga0495652_0699166 3300046529 Bacteria 682
271 Ga0495665_0054266 3300046531 Bacteria 2117
272 Ga0495665_0102441 3300046531 Bacteria 1502
273 Ga0495640_0014007 3300046533 Bacteria 6085
274 Ga0495586_0116358 3300046535 Bacteria 1491
275 Ga0495587_0030338 3300046536 Bacteria 3279
276 Ga0495597_0065437 3300046542 Bacteria 1577
277 Ga0495645_0003554 3300046543 Bacteria 10556
278 Ga0495645_0131783 3300046543 Bacteria 1751
279 Ga0495622_0051673 3300046557 Bacteria 1906
280 Ga0495667_0002172 3300046559 Bacteria 13091
281 Ga0495656_0465358 3300046615 Bacteria 667
282 Ga0495668_0008450 3300046616 Bacteria 6433
283 Ga0495634_0111446 3300046642 Unclassified 1759
284 Ga0495611_0375960 3300046648 Bacteria 651
285 Ga0495635_0002068 3300046663 Bacteria 13604
286 Ga0495588_0028210 3300046674 Bacteria 2808
287 Ga0495588_0410350 3300046674 Bacteria 711
288 Ga0495657_0005149 3300046675 Bacteria 10356
289 Ga0495657_0032171 3300046675 Bacteria 3663
290 Ga0495599_0000812 3300046678 Bacteria 17556
291 Ga0495623_0087233 3300046679 Bacteria 1922
292 Ga0495646_0021021 3300046680 Bacteria 4125
293 Ga0495646_0207080 3300046680 Bacteria 1066
294 Ga0495647_0182973 3300046681 Bacteria 912
295 Ga0495658_0001881 3300046683 Bacteria 10722
296 Ga0495613_0091825 3300046689 Unclassified 2199
297 Ga0495613_0202937 3300046689 Bacteria 1397
298 Ga0495624_0114045 3300046690 Bacteria 1661
299 Ga0495624_0693287 3300046690 Bacteria 605
300 Ga0495624_0964099 3300046690 Unclassified 501
301 Ga0495649_0049410 3300046694 Bacteria 2285
302 Ga0495589_0284112 3300046794 Bacteria 769
303 Ga0495600_0005721 3300046809 Bacteria 7512
304 Ga0495600_0031542 3300046809 Bacteria 3434
305 Ga0495581_0036866 3300047315 Bacteria 2829
306 Ga0495581_0070806 3300047315 Bacteria 2017
307 Ga0495581_0227817 3300047315 Unclassified 1090
308 Ga0495604_0004626 3300047317 Bacteria 10904
309 Ga0495604_0044693 3300047317 Bacteria 3458
310 Ga0495674_0005513 3300047319 Bacteria 12138
311 Ga0495676_0193271 3300047321 Bacteria 1418
312 Ga0495676_0277252 3300047321 Bacteria 1136
313 Ga0495687_016553 3300047443 Bacteria 3706
314 Ga0495675_0001235 3300047444 Bacteria 15478
315 Ga0495685_024153 3300047447 Bacteria 2092
316 Ga0495684_0006447 3300047471 Bacteria 9110
317 Ga0495593_0003233 3300047673 Bacteria 9769
318 Ga0495593_0113294 3300047673 Unclassified 1384
319 Ga0495602_0041344 3300048088 Bacteria 4212
320 Ga0495614_0011218 3300048089 Bacteria 3944
321 Ga0495615_0009336 3300048090 Bacteria 1926
322 Ga0495615_0090843 3300048090 Bacteria 851
323 Ga0495626_0111560 3300048091 Bacteria 1184
324 Ga0496100_0071659 3300048903 Bacteria 2314
325 Ga0496101_0370233 3300048904 Bacteria 1127
326 Ga0496101_0877453 3300048904 Unclassified 707
327 Ga0496102_0027788 3300048905 Bacteria 5052
328 Ga0496103_0017904 3300048906 Bacteria 4245
329 Ga0496104_0010801 3300048907 Bacteria 8168
330 Ga0496104_0879028 3300048907 Bacteria 801
331 Ga0496105_0021264 3300048908 Bacteria 5250
332 Ga0496105_0058900 3300048908 Bacteria 3169
333 Ga0496105_0891442 3300048908 Bacteria 671
334 Ga0496108_1767244 3300048911 Bacteria 507
335 Ga0496109_0076087 3300048912 Bacteria 3087
336 Ga0496110_0064308 3300048913 Bacteria 3242
337 Ga0496113_0095567 3300048916 Bacteria 2297
338 Ga0496113_0128078 3300048916 Bacteria 1989
339 Ga0496114_0660197 3300048917 Bacteria 919
340 Ga0496114_1029607 3300048917 Bacteria 707
341 Ga0496115_0058198 3300048918 Bacteria 3110
342 Ga0496116_0120667 3300048919 Bacteria 1518
343 Ga0496117_0027496 3300048920 Bacteria 4432
344 Ga0496118_0167484 3300048921 Bacteria 1348
345 Ga0496118_0193424 3300048921 Bacteria 1214
346 Ga0496119_0006473 3300048922 Bacteria 10827
347 Ga0496119_0046574 3300048922 Bacteria 2707
348 Ga0496120_0033025 3300048923 Bacteria 3113
349 Ga0496120_0376865 3300048923 Bacteria 632
350 Ga0496123_0143236 3300048926 Bacteria 1303
351 Ga0496123_0278807 3300048926 Bacteria 809
352 Ga0496124_0040838 3300048927 Bacteria 4009
353 Ga0496124_0157283 3300048927 Bacteria 1776
354 Ga0496124_0184698 3300048927 Bacteria 1601
355 Ga0496125_0171595 3300048928 Bacteria 1457
356 Ga0496125_0348036 3300048928 Bacteria 886
357 Ga0496125_0474553 3300048928 Bacteria 710
358 Ga0496126_0129727 3300048929 Bacteria 2179
359 Ga0495682_0159267 3300049460 Bacteria 804
360 Ga0501067_0070294 3300049583 Bacteria 1938
361 Ga0501079_0794115 3300049741 Bacteria 745
362 Ga0501083_0488790 3300049744 Bacteria 801
363 nmdc:mga03683_105033_c1 3300050489 Bacteria 1244
364 nmdc:mga03683_563420_c1 3300050489 Bacteria 555
365 nmdc:mga00v17_44427_c1 3300050491 Bacteria 2679
366 nmdc:mga0yw44_792340_c1 3300050492 Bacteria 644
367 nmdc:mga0k408_284255_c1 3300050493 Bacteria 987
368 nmdc:mga0k408_90319_c1 3300050493 Bacteria 1799
369 nmdc:mga06z11_150505_c1 3300050494 Bacteria 1323
370 nmdc:mga04h51_41470_c1 3300050495 Bacteria 1505
371 nmdc:mga08y16_71188_c1 3300050511 Bacteria 3624
372 nmdc:mga0n895_812320_c1 3300050512 Bacteria 925
373 nmdc:mga0rr50_1151627_c1 3300050513 Unclassified 659
374 nmdc:mga0rr50_1260915_c1 3300050513 Bacteria 627
375 nmdc:mga0sz30_17804_c1 3300050516 Bacteria 2837
376 nmdc:mga0sz30_44593_c1 3300050516 Bacteria 1869
377 Ga0495601_0005000 3300053077 Bacteria 7694
378 Ga0495612_0002653 3300053078 Bacteria 7380
379 Ga0500610_0391480 3300053079 Bacteria 569
380 Ga0495619_0127366 3300053085 Unclassified 1748
381 Ga0500646_0246961 3300053090 Bacteria 627
382 Ga0500651_0118163 3300053093 Bacteria 1612
383 Ga0500641_0005657 3300053096 Bacteria 4427
384 Ga0500641_0187840 3300053096 Bacteria 885
385 Ga0500569_004622 3300053109 Bacteria 2905
386 Ga0500595_078117 3300053119 Bacteria 972
387 Ga0500658_0089678 3300053134 Bacteria 1328
388 Ga0500577_0098507 3300053142 Bacteria 1192
389 Ga0500577_0106687 3300053142 Bacteria 1151
390 Ga0500590_198466 3300053148 Bacteria 852
391 Ga0500604_0148498 3300053151 Bacteria 795
392 Ga0500633_0186872 3300053160 Bacteria 777
393 Ga0500639_259755 3300053163 Bacteria 688
394 Ga0500552_046478 3300053733 Bacteria 723
395 Ga0500601_000210 3300053737 Bacteria 11688
396 Ga0501084_1260911 3300054114 Bacteria 620
397 2511399296 2511231028 Bacteria 8046582
398 2513644391 2513237094 Bacteria 8789602
399 2513652889 2513237095 Bacteria 8976980
400 2513876011 2513237139 Bacteria 8737671
401 2517103347 2517093001 Bacteria 9002274
402 2617354506 2617270735 Bacteria 9163226
403 2739056936 2738541337 Bacteria 6183410
404 2793083220
405 2805917456 2802429603 Bacteria 8777136
406 2818242441 2816332527 Bacteria 8933356
407 2824679465 2824671348 Bacteria 8369588
408 2824696083 2824687955 Bacteria 8360029
409 2824700815 2824696289 Bacteria 8335049
410 2824711836 2824704595 Bacteria 9667483
411 2824762984 2824753945 Bacteria 9787441
412 2824764734 2824763712 Bacteria 9792355
413 2824774182 2824773399 Bacteria 8360218
414 2838127648 2838122688 Bacteria 8803140
415 2841952583 2841949485 Bacteria 8680857
416 2841967539 2841966195 Bacteria 8673214
417 2841979063 2841974524 Bacteria 8931498
418 2841986607 2841983080 Bacteria 8395090
419 2844317839 2844315083 Bacteria 8138177
420 2847945240 2847939898 Bacteria 8606328
421 2849080583 2849076700 Bacteria 7039503
422 2876766581 2876761206 Bacteria 10111113
423 2885372539 2885366525 Bacteria 8326213
424 2888382603 2888378607 Bacteria 9652610
425 2889037216 2889033259 Bacteria 9099371
426 2903735516 2903727486 Bacteria 8281579
427 2904694937 2904690495 Bacteria 9412302
428 2904718357 2904711408 Bacteria 9771557
429 2906607587 2906602504 Bacteria 8295279
430 2906633752 2906626472 Bacteria 8826946
431 2908759923 2908756301 Bacteria 8864324
432 2922375381
433 2935692998 2935684952 Bacteria 9590419
434 2935719606 2935713505 Bacteria 9608509
435 2935729627 2935722832 Bacteria 9608746
436 2935739489 2935732158 Bacteria 9706831
437 2935748527 2935741537 Bacteria 9707219
438 2935756886 2935750917 Bacteria 9590372
439 2935812557 2935810662 Bacteria 9401221
440 2936039150 2936037263 Bacteria 9446081
441 2936058290 2936055302 Bacteria 8785755
442 2940562800 2940556831 Bacteria 9590747
443 2941537893 2941531003 Bacteria 7653939
444 3005713618 3005710791 Bacteria 7622528
445 3005721009 3005718088 Bacteria 8283608
446 8016590963 8016583857 Bacteria 10421953
447 8019656581 8019648815 Bacteria 10014479
448 Ga0207699_10190174
449 JGI24739J22299_10042114
450 JGI24735J21928_10156468
451 JGI25153J46596_10001642
452 JGI25153J46596_10015322
453 rootL2_10140017
454 JGI25160J50197_1016506
455 Ga0055542_1003412
456 Ga0055526_1041654
457 Ga0055543_1021373
458 Ga0065165_1008543
459 Ga0070676_10551775
460 Ga0070690_100577137
461 Ga0070670_100409357
462 Ga0070670_101094215
463 Ga0070677_10257933
464 Ga0070666_10134490
465 Ga0068868_100111736
466 Ga0070689_101269508
467 Ga0070668_100162103
468 Ga0070669_100357490
469 Ga0070669_100363956
470 Ga0070669_100407455
471 Ga0070669_100493238
472 Ga0070675_100179543
473 Ga0070675_100723120
474 Ga0070675_100723121
475 Ga0070671_100172011
476 Ga0070674_100046614
477 Ga0070673_100849662
478 Ga0070673_101159966
479 Ga0070688_101018096
480 Ga0070688_101324142
481 Ga0070659_100390875
482 Ga0070703_10249906
483 Ga0070709_10035425
484 Ga0070714_100023755
485 Ga0070714_100762258
486 Ga0070714_100815462
487 Ga0070714_102103202
488 Ga0070713_100055655
489 Ga0070710_10048027
490 Ga0070711_101646743
491 Ga0070708_101786103
492 Ga0070663_100065517
493 Ga0070678_100072947
494 Ga0070678_100753877
495 Ga0070662_101060125
496 Ga0070681_11272780
497 Ga0068867_100101337
498 Ga0068867_101589749
499 Ga0070707_101791446
500 Ga0070698_100140350
501 Ga0070698_100220850
502 Ga0068853_100544340
503 Ga0068853_101034884
504 Ga0068853_101786101
505 Ga0070672_100121502
506 Ga0070672_100902452
507 Ga0070686_100219418
508 Ga0070686_100441329
509 Ga0070696_100265315
510 Ga0070665_100008665
511 Ga0070665_100257079
512 Ga0070665_100823760
513 Ga0070665_101773606
514 Ga0068855_100130859
515 Ga0068857_100170731
516 Ga0068854_100652421
517 Ga0068856_100079545
518 Ga0068852_100278419
519 Ga0068852_100438545
520 Ga0068864_100605934
521 Ga0068866_10581730
522 Ga0068870_10285836
523 Ga0068863_100070964
524 Ga0068858_100222449
525 Ga0068860_100012024
526 Ga0081455_10027745
527 Ga0081455_10712602
528 Ga0081538_10142872
529 Ga0081540_1003598
530 Ga0081540_1035101
531 Ga0081540_1043690
532 Ga0081540_1051399
533 Ga0081540_1100814
534 Ga0070717_10004184
535 Ga0070717_10700656
536 Ga0075365_10766965
537 Ga0075368_10003147
538 Ga0075364_10033611
539 Ga0070712_100152295
540 Ga0070712_100202573
541 Ga0075362_10042783
542 Ga0075362_10094522
543 Ga0075367_10031731
544 Ga0075366_10010406
545 Ga0075428_100166242
546 Ga0075431_100092764
547 Ga0075434_101288244
548 Ga0075429_100535638
549 Ga0068865_100970803
550 Ga0075435_101246322
551 Ga0075435_101340093
552 Ga0099794_10351881
553 Ga0111539_10163136
554 Ga0111539_10465138
555 Ga0111539_12051723
556 Ga0114129_11520573
557 Ga0105243_10981467
558 Ga0105241_10476997
559 Ga0105242_10828764
560 Ga0105248_10236746
561 Ga0105237_10084260
562 Ga0105237_10894247
563 Ga0105237_11741386
564 Ga0105238_10263859
565 Ga0105249_11225605
566 Ga0105239_10078516
567 Ga0105239_10199340
568 Ga0105239_10374953
569 Ga0105239_10758258
570 Ga0157369_12364623
571 Ga0157374_10016270
572 Ga0157378_10392396
573 Ga0157378_11412671
574 Ga0157375_12794308
575 Ga0157380_10621132
576 Ga0157380_12139970
577 Ga0182008_10402271
578 Ga0157377_10218907
579 Ga0157376_11126871
580 Ga0163161_10328219
581 Ga0163161_10919606
582 Ga0213876_10001872
583 Ga0209148_1000709
584 Ga0209233_1001780
585 Ga0209233_1005782
586 Ga0209455_1002909
587 Ga0209673_1029520
588 Ga0209564_1004419
589 Ga0209758_1000794
590 Ga0209758_1004112
591 Ga0209758_1107767
592 Ga0209758_1137533
593 Ga0207426_1001034
594 Ga0207426_1001857
595 Ga0207426_1004466
596 Ga0209051_1072280
597 Ga0209257_1010614
598 Ga0209257_1036771
599 Ga0207697_10092002
600 Ga0207682_10007521
601 Ga0207692_10293578
602 Ga0207688_10050585
603 Ga0207688_10050825
604 Ga0207647_10004805
605 Ga0207699_10086906
606 Ga0207643_10256039
607 Ga0207684_10916506
608 Ga0207654_10560582
609 Ga0207671_10227755
610 Ga0207693_10075417
611 Ga0207693_10239748
612 Ga0207662_10138093
613 Ga0207646_10288531
614 Ga0207681_10232389
615 Ga0207681_10350924
616 Ga0207694_10331923
617 Ga0207694_10766177
618 Ga0207700_10110257
619 Ga0207700_10247454
620 Ga0207664_10251774
621 Ga0207664_11144382
622 Ga0207644_10253223
623 Ga0207706_10873307
624 Ga0207709_10753611
625 Ga0207670_10342635
626 Ga0207669_10076277
627 Ga0207704_10058289
628 Ga0207691_10109536
629 Ga0207691_10874967
630 Ga0207691_11561813
631 Ga0207711_10976455
632 Ga0207651_10735449
633 Ga0207712_10832615
634 Ga0207712_11022541
635 Ga0207640_10638029
636 Ga0207677_10080935
637 Ga0207703_10161041
638 Ga0207703_11768417
639 Ga0207639_10918129
640 Ga0207678_10218267
641 Ga0207702_10255302
642 Ga0207641_10054099
643 Ga0207648_10029777
644 Ga0207676_10580834
645 Ga0207676_10631473
646 Ga0207674_10311198
647 Ga0207674_11059170
648 Ga0207675_100695926
649 Ga0207683_10032197
650 Ga0209813_10036372
651 Ga0268266_10596643
652 Ga0268264_10050758
653 Ga0268264_12412572
654 Ga0265316_10776310
655 Ga0307513_10122002
656 Ga0307513_10379621
657 Ga0307416_100358790
658 Ga0307414_10968689
659 Ga0373926_0084927
660 Ga0373934_0001898
661 Ga0373944_0255056
662 Ga0373923_0011615
663 Ga0373945_0019547
664 Ga0373954_0009379
665 Ga0373956_0008661
666 Ga0373957_0031516
667 Ga0373955_0008259
668 Ga0373931_1160730
669 Ga0373935_0120322
670 Ga0373927_0052924
671 Ga0373933_0014419
672 Ga0373947_0002303
673 Ga0373937_0035599
674 Ga0373925_0220848
675 Ga0395905_0091361
676 Ga0395905_0363119
677 Ga0436365_1285876
678 Ga0436365_1869970
679 Ga0451853_2998989
680 Ga0451577_0015845
681 Ga0466965_0655188
682 Ga0466966_0115434
683 Ga0466959_0051371
684 Ga0466967_0051029
685 Ga0466967_1673847
686 Ga0495592_0050022
687 Ga0495603_0591783
688 Ga0495629_0004044
689 Ga0495629_0062899
690 Ga0495629_0321356
691 Ga0495638_0012740
692 Ga0495638_0268512
693 Ga0495641_0321172
694 Ga0495641_0331457
695 Ga0495651_0039849
696 Ga0495653_0002091
697 Ga0495580_0092640
698 Ga0495639_0009858
699 Ga0495639_0457539
700 Ga0495664_0072206
701 Ga0495664_0133403
702 Ga0495664_0742357
703 Ga0495606_0080914
704 Ga0495608_0013037
705 Ga0495618_0018473
706 Ga0495620_0082803
707 Ga0495620_0123368
708 Ga0495628_0012203
709 Ga0495628_0230709
710 Ga0495630_0007347
711 Ga0495630_0764386
712 Ga0495630_1302196
713 Ga0495643_0023068
714 Ga0495663_0159347
715 Ga0495652_0014481
716 Ga0495652_0095093
717 Ga0495652_0699166
718 Ga0495665_0054266
719 Ga0495665_0102441
720 Ga0495640_0014007
721 Ga0495586_0116358
722 Ga0495587_0030338
723 Ga0495597_0065437
724 Ga0495645_0003554
725 Ga0495645_0131783
726 Ga0495622_0051673
727 Ga0495667_0002172
728 Ga0495656_0465358
729 Ga0495668_0008450
730 Ga0495634_0111446
731 Ga0495611_0375960
732 Ga0495635_0002068
733 Ga0495588_0028210
734 Ga0495588_0410350
735 Ga0495657_0005149
736 Ga0495657_0032171
737 Ga0495599_0000812
738 Ga0495623_0087233
739 Ga0495646_0021021
740 Ga0495646_0207080
741 Ga0495647_0182973
742 Ga0495658_0001881
743 Ga0495613_0091825
744 Ga0495613_0202937
745 Ga0495624_0114045
746 Ga0495624_0693287
747 Ga0495624_0964099
748 Ga0495649_0049410
749 Ga0495589_0284112
750 Ga0495600_0005721
751 Ga0495600_0031542
752 Ga0495581_0036866
753 Ga0495581_0070806
754 Ga0495581_0227817
755 Ga0495604_0004626
756 Ga0495604_0044693
757 Ga0495674_0005513
758 Ga0495676_0193271
759 Ga0495676_0277252
760 Ga0495687_016553
761 Ga0495675_0001235
762 Ga0495685_024153
763 Ga0495684_0006447
764 Ga0495593_0003233
765 Ga0495593_0113294
766 Ga0495602_0041344
767 Ga0495614_0011218
768 Ga0495615_0009336
769 Ga0495615_0090843
770 Ga0495626_0111560
771 Ga0496100_0071659
772 Ga0496101_0370233
773 Ga0496101_0877453
774 Ga0496102_0027788
775 Ga0496103_0017904
776 Ga0496104_0010801
777 Ga0496104_0879028
778 Ga0496105_0021264
779 Ga0496105_0058900
780 Ga0496105_0891442
781 Ga0496108_1767244
782 Ga0496109_0076087
783 Ga0496110_0064308
784 Ga0496113_0095567
785 Ga0496113_0128078
786 Ga0496114_0660197
787 Ga0496114_1029607
788 Ga0496115_0058198
789 Ga0496116_0120667
790 Ga0496117_0027496
791 Ga0496118_0167484
792 Ga0496118_0193424
793 Ga0496119_0006473
794 Ga0496119_0046574
795 Ga0496120_0033025
796 Ga0496120_0376865
797 Ga0496123_0143236
798 Ga0496123_0278807
799 Ga0496124_0040838
800 Ga0496124_0157283
801 Ga0496124_0184698
802 Ga0496125_0171595
803 Ga0496125_0348036
804 Ga0496125_0474553
805 Ga0496126_0129727
806 Ga0495682_0159267
807 Ga0501067_0070294
808 Ga0501079_0794115
809 Ga0501083_0488790
810 nmdc:mga03683_105033_c1
811 nmdc:mga03683_563420_c1
812 nmdc:mga00v17_44427_c1
813 nmdc:mga0yw44_792340_c1
814 nmdc:mga0k408_284255_c1
815 nmdc:mga0k408_90319_c1
816 nmdc:mga06z11_150505_c1
817 nmdc:mga04h51_41470_c1
818 nmdc:mga08y16_71188_c1
819 nmdc:mga0n895_812320_c1
820 nmdc:mga0rr50_1151627_c1
821 nmdc:mga0rr50_1260915_c1
822 nmdc:mga0sz30_17804_c1
823 nmdc:mga0sz30_44593_c1
824 Ga0495601_0005000
825 Ga0495612_0002653
826 Ga0500610_0391480
827 Ga0495619_0127366
828 Ga0500646_0246961
829 Ga0500651_0118163
830 Ga0500641_0005657
831 Ga0500641_0187840
832 Ga0500569_004622
833 Ga0500595_078117
834 Ga0500658_0089678
835 Ga0500577_0098507
836 Ga0500577_0106687
837 Ga0500590_198466
838 Ga0500604_0148498
839 Ga0500633_0186872
840 Ga0500639_259755
841 Ga0500552_046478
842 Ga0500601_000210
843 Ga0501084_1260911
844 2511399296
845 2513644391
846 2513652889
847 2513876011
848 2517103347
849 2617354506
850 2739056936
851 2793083220
852 2805917456
853 2818242441
854 2824679465
855 2824696083
856 2824700815
857 2824711836
858 2824762984
859 2824764734
860 2824774182
861 2838127648
862 2841952583
863 2841967539
864 2841979063
865 2841986607
866 2844317839
867 2847945240
868 2849080583
869 2876766581
870 2885372539
871 2888382603
872 2889037216
873 2903735516
874 2904694937
875 2904718357
876 2906607587
877 2906633752
878 2908759923
879 2922375381
880 2935692998
881 2935719606
882 2935729627
883 2935739489
884 2935748527
885 2935756886
886 2935812557
887 2936039150
888 2936058290
889 2940562800
890 2941537893
891 3005713618
892 3005721009
893 8016590963
894 8019656581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

43

111

0.87

PF02311

AraC_binding

AraC-like ligand binding domain

52

115

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9941 5 99
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9173 5 99
2i45-assembly3.cif.gz_E crystal structure of protein nmb1881 from neisseria meningitidis 0.9043 3 100
2i45-assembly4.cif.gz_H crystal structure of protein nmb1881 from neisseria meningitidis 0.9022 3 100
2i45-assembly1.cif.gz_B crystal structure of protein nmb1881 from neisseria meningitidis 0.8992 4 100
ID Description Score Start End Superfamily
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9581 1 99 2.60.120.10
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9385 1 99 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9043 28 97 2.60.120.10
af_O06336_46_171_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8927 28 97 2.60.120.10
af_P76555_101_233_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8904 28 97 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2D5N4Q3-F1-model_v4 Mannose-6-phosphate isomerase 0.9946 3 99 GO:0016853
AF-A0A537BVB2-F1-model_v4 Cupin domain-containing protein 0.9934 6 94
AF-A0A2E8EV71-F1-model_v4 Cupin type-2 domain-containing protein 0.9929 26 107
AF-A0A381XP78-F1-model_v4 Cupin type-2 domain-containing protein 0.9926 3 107
AF-A0A7V7ZPI9-F1-model_v4 Cupin domain-containing protein 0.9921 3 100

Map