F445906

General Info

Members Datasets Scaffolds Average Seq Length
447 177 894 235

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10127081|Ga0081455_101270812
Length 251
Sequence VTRELVYGRQPVREVLRAGKRQILELLVTERALASESWLRDVPGLRLQIVPERRLNEAARAAEHQGVVAFCEPYRYADAHELVVGESPLLVCLDQVTDPHNLGAVIRSAEGAGANGIVITERNAARVTAAVCKASAGAVEHLPVAVVVNLARYLEEIKGPQLWVWAADGGAETSVWQADFVTGVVLVFGAEGRGLRPGVRRVCDDAFSVPLAGHVDSLNVSVAAGVALFEVARQRGGRGEAAVTDATSGHP

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
108 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
111 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
119 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
120 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
121 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
122 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 3.13
Rhizosphere 96.42
Stem 0
Stem Tuber 0
Unclassified 3.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10127081 3300005937 Bacteria 1999
2 JGI25407J50210_10020516 3300003373 Bacteria 1718
3 Ga0070676_10091221 3300005328 Bacteria 1867
4 Ga0070683_100242721 3300005329 Bacteria 1713
5 Ga0070680_100222612 3300005336 Bacteria 1593
6 Ga0070680_100276374 3300005336 Bacteria 1422
7 Ga0068868_100047012 3300005338 Bacteria 3380
8 Ga0070691_10013941 3300005341 Bacteria 3689
9 Ga0070668_100374545 3300005347 Bacteria 1210
10 Ga0070675_100311905 3300005354 Bacteria 1388
11 Ga0070674_100015812 3300005356 Bacteria 4719
12 Ga0070674_100073063 3300005356 Bacteria 2430
13 Ga0070674_100352001 3300005356 Bacteria 1190
14 Ga0070688_100184298 3300005365 Bacteria 1450
15 Ga0070659_100201872 3300005366 Bacteria 1637
16 Ga0070709_10500759 3300005434 Bacteria 923
17 Ga0070714_100093718 3300005435 Bacteria 2634
18 Ga0070714_100126440 3300005435 Bacteria 2280
19 Ga0070713_100085338 3300005436 Bacteria 2704
20 Ga0070711_100056907 3300005439 Bacteria 2705
21 Ga0070711_100108025 3300005439 Bacteria 2038
22 Ga0070705_100004551 3300005440 Bacteria 6748
23 Ga0070705_100053333 3300005440 Bacteria 2367
24 Ga0070694_100140336 3300005444 Bacteria 1755
25 Ga0070708_100026805 3300005445 Bacteria 4937
26 Ga0070678_100049745 3300005456 Bacteria 3027
27 Ga0070662_100170109 3300005457 Bacteria 1711
28 Ga0070706_100093911 3300005467 Bacteria 2783
29 Ga0070707_100710966 3300005468 Unclassified 968
30 Ga0070698_100006551 3300005471 Bacteria 12630
31 Ga0070684_100548718 3300005535 Bacteria 1072
32 Ga0070697_100025494 3300005536 Bacteria 4716
33 Ga0070697_100172565 3300005536 Bacteria 1831
34 Ga0070672_100400510 3300005543 Bacteria 1176
35 Ga0070686_100090422 3300005544 Bacteria 2046
36 Ga0070696_100182206 3300005546 Bacteria 1558
37 Ga0070704_100219605 3300005549 Bacteria 1545
38 Ga0070664_100090964 3300005564 Bacteria 2641
39 Ga0068857_100001516 3300005577 Bacteria 18537
40 Ga0068857_100434151 3300005577 Bacteria 1226
41 Ga0068854_100017443 3300005578 Bacteria 4803
42 Ga0070702_100030844 3300005615 Bacteria 2927
43 Ga0068852_100058483 3300005616 Bacteria 3339
44 Ga0068866_10255198 3300005718 Bacteria 1075
45 Ga0068861_100325943 3300005719 Bacteria 1339
46 Ga0068870_10032021 3300005840 Bacteria 2669
47 Ga0068858_100215729 3300005842 Bacteria 1817
48 Ga0068860_100374025 3300005843 Bacteria 1406
49 Ga0068862_100620553 3300005844 Bacteria 1040
50 Ga0081455_10048652 3300005937 Bacteria 3661
51 Ga0081455_10056876 3300005937 Bacteria 3318
52 Ga0081455_10065883 3300005937 Bacteria 3027
53 Ga0081538_10000266 3300005981 Bacteria 59679
54 Ga0081538_10000334 3300005981 Bacteria 53496
55 Ga0081538_10001790 3300005981 Bacteria 21685
56 Ga0081538_10002327 3300005981 Bacteria 18750
57 Ga0081538_10011455 3300005981 Bacteria 7181
58 Ga0081538_10041299 3300005981 Bacteria 2929
59 Ga0081538_10054797 3300005981 Bacteria 2353
60 Ga0081538_10060477 3300005981 Bacteria 2178
61 Ga0081538_10094257 3300005981 Bacteria 1534
62 Ga0081539_10001821 3300005985 Bacteria 33639
63 Ga0075364_10213222 3300006051 Bacteria 1310
64 Ga0070715_10178783 3300006163 Bacteria 1062
65 Ga0070712_100044907 3300006175 Bacteria 3048
66 Ga0075428_100070397 3300006844 Bacteria 3824
67 Ga0075428_100109853 3300006844 Bacteria 3004
68 Ga0075428_100358594 3300006844 Bacteria 1564
69 Ga0075428_100483239 3300006844 Bacteria 1326
70 Ga0075430_100007562 3300006846 Bacteria 9176
71 Ga0075430_100198680 3300006846 Bacteria 1666
72 Ga0075431_100003203 3300006847 Bacteria 15834
73 Ga0075431_100039670 3300006847 Bacteria 4851
74 Ga0075431_100461347 3300006847 Bacteria 1265
75 Ga0075429_100002220 3300006880 Bacteria 16257
76 Ga0075429_100093325 3300006880 Bacteria 2625
77 Ga0075429_100453422 3300006880 Bacteria 1124
78 Ga0068865_100004149 3300006881 Bacteria 8713
79 Ga0111539_10006538 3300009094 Bacteria 15020
80 Ga0111539_10011354 3300009094 Bacteria 11184
81 Ga0111539_10328320 3300009094 Bacteria 1780
82 Ga0111539_10389960 3300009094 Bacteria 1622
83 Ga0105245_10086040 3300009098 Bacteria 2882
84 Ga0105245_10240488 3300009098 Bacteria 1755
85 Ga0105245_10368685 3300009098 Bacteria 1427
86 Ga0105245_10432736 3300009098 Bacteria 1321
87 Ga0105247_10193886 3300009101 Bacteria 1362
88 Ga0114129_10042557 3300009147 Bacteria 6395
89 Ga0114129_10093655 3300009147 Bacteria 4161
90 Ga0114129_10288730 3300009147 Bacteria 2189
91 Ga0105243_10008877 3300009148 Bacteria 7692
92 Ga0105243_10120042 3300009148 Bacteria 2215
93 Ga0105248_10056032 3300009177 Bacteria 4422
94 Ga0105249_10351919 3300009553 Bacteria 1492
95 Ga0105239_10347189 3300010375 Bacteria 1675
96 Ga0105239_10746696 3300010375 Bacteria 1120
97 Ga0105246_10038787 3300011119 Bacteria 3205
98 Ga0157371_10343304 3300013102 Bacteria 1086
99 Ga0157378_10609577 3300013297 Bacteria 1104
100 Ga0157380_10111262 3300014326 Bacteria 2302
101 Ga0207653_10023237 3300025885 Bacteria 1974
102 Ga0207653_10084881 3300025885 Unclassified 1101
103 Ga0207692_10134622 3300025898 Bacteria 1399
104 Ga0207642_10283532 3300025899 Bacteria 954
105 Ga0207688_10031645 3300025901 Bacteria 2922
106 Ga0207685_10022668 3300025905 Bacteria 2126
107 Ga0207693_10015096 3300025915 Bacteria 6200
108 Ga0207660_10244708 3300025917 Bacteria 1414
109 Ga0207646_10614705 3300025922 Unclassified 975
110 Ga0207659_10534916 3300025926 Bacteria 995
111 Ga0207687_10327539 3300025927 Bacteria 1242
112 Ga0207664_10010803 3300025929 Bacteria 6461
113 Ga0207664_10098276 3300025929 Bacteria 2413
114 Ga0207706_10140961 3300025933 Unclassified 2121
115 Ga0207706_10152385 3300025933 Bacteria 2033
116 Ga0207706_10493863 3300025933 Bacteria 1057
117 Ga0207686_10204354 3300025934 Bacteria 1416
118 Ga0207709_10151194 3300025935 Bacteria 1608
119 Ga0207709_10191208 3300025935 Bacteria 1454
120 Ga0207669_10044941 3300025937 Bacteria 2599
121 Ga0207669_10199089 3300025937 Bacteria 1452
122 Ga0207704_10010586 3300025938 Bacteria 4505
123 Ga0207665_10009728 3300025939 Bacteria 6311
124 Ga0207689_10059651 3300025942 Bacteria 3138
125 Ga0207661_10254749 3300025944 Bacteria 1561
126 Ga0207679_10102149 3300025945 Bacteria 2244
127 Ga0207668_10095907 3300025972 Bacteria 2191
128 Ga0207648_10025051 3300026089 Bacteria 5318
129 Ga0207648_10144281 3300026089 Bacteria 2099
130 Ga0207674_10002266 3300026116 Bacteria 24376
131 Ga0207674_10236772 3300026116 Bacteria 1773
132 Ga0207675_100186598 3300026118 Bacteria 1988
133 Ga0207675_100202545 3300026118 Bacteria 1907
134 Ga0207675_100306621 3300026118 Bacteria 1547
135 Ga0207683_10417189 3300026121 Bacteria 1236
136 Ga0207428_10012174 3300027907 Bacteria 7568
137 Ga0207428_10078941 3300027907 Bacteria 2574
138 Ga0207428_10158162 3300027907 Bacteria 1722
139 Ga0307408_100339407 3300031548 Unclassified 1271
140 Ga0307405_10008184 3300031731 Bacteria 5288
141 Ga0307405_10041759 3300031731 Bacteria 2787
142 Ga0307413_10042081 3300031824 Bacteria 2681
143 Ga0307410_10071900 3300031852 Bacteria 2400
144 Ga0307410_10152971 3300031852 Unclassified 1720
145 Ga0307410_10184192 3300031852 Bacteria 1583
146 Ga0307406_10017631 3300031901 Bacteria 4160
147 Ga0307406_10134878 3300031901 Bacteria 1738
148 Ga0307407_10040473 3300031903 Bacteria 2599
149 Ga0307407_10308718 3300031903 Bacteria 1106
150 Ga0307412_10087825 3300031911 Unclassified 2167
151 Ga0307409_100037826 3300031995 Bacteria 3561
152 Ga0307416_100008814 3300032002 Bacteria 6543
153 Ga0307416_100293574 3300032002 Unclassified 1611
154 Ga0307416_100747497 3300032002 Bacteria 1070
155 Ga0307414_10071968 3300032004 Bacteria 2496
156 Ga0307411_10034983 3300032005 Bacteria 3132
157 Ga0307415_100000129 3300032126 Bacteria 32651
158 Ga0307415_100031218 3300032126 Bacteria 3429
159 Ga0395899_0001532 3300037312 Bacteria 19519
160 Ga0395899_0005365 3300037312 Bacteria 9958
161 Ga0395899_0028856 3300037312 Bacteria 4175
162 Ga0395899_0049340 3300037312 Bacteria 3129
163 Ga0395899_0071255 3300037312 Bacteria 2543
164 Ga0395899_0071729 3300037312 Bacteria 2535
165 Ga0395900_0001092 3300037418 Bacteria 34499
166 Ga0395900_0010297 3300037418 Bacteria 9567
167 Ga0395900_0018054 3300037418 Bacteria 7201
168 Ga0395900_0053555 3300037418 Bacteria 4153
169 Ga0395900_0230362 3300037418 Unclassified 1863
170 Ga0395900_0298674 3300037418 Unclassified 1597
171 Ga0395898_0003847 3300037466 Bacteria 16619
172 Ga0395898_0006659 3300037466 Bacteria 12323
173 Ga0395898_0012940 3300037466 Bacteria 8606
174 Ga0395898_0053652 3300037466 Bacteria 3937
175 Ga0395898_0069057 3300037466 Bacteria 3419
176 Ga0395898_0122418 3300037466 Unclassified 2492
177 Ga0395898_0138952 3300037466 Bacteria 2326
178 Ga0395898_0141851 3300037466 Bacteria 2300
179 Ga0395905_0015077 3300037471 Bacteria 7361
180 Ga0395905_0045092 3300037471 Bacteria 4135
181 Ga0395905_0067676 3300037471 Bacteria 3345
182 Ga0395905_0118404 3300037471 Bacteria 2489
183 Ga0395905_0155738 3300037471 Bacteria 2149
184 Ga0395905_0488216 3300037471 Bacteria 1131
185 Ga0395901_0001542 3300038443 Bacteria 23884
186 Ga0395901_0001665 3300038443 Bacteria 22941
187 Ga0395901_0021007 3300038443 Bacteria 6687
188 Ga0395901_0071607 3300038443 Bacteria 3613
189 Ga0395901_0082562 3300038443 Bacteria 3357
190 Ga0395901_0088177 3300038443 Bacteria 3245
191 Ga0395901_0109521 3300038443 Bacteria 2900
192 Ga0395901_0347794 3300038443 Bacteria 1530
193 Ga0395901_0882234 3300038443 Bacteria 877
194 Ga0395901_0983919 3300038443 Bacteria 820
195 Ga0451793_0138128 3300041452 Bacteria 3016
196 Ga0451847_0779560 3300041503 Bacteria 3795
197 Ga0439448_0009043 3300042005 Bacteria 2930
198 Ga0439434_0017018 3300042435 Bacteria 2174
199 Ga0439460_0045336 3300042461 Bacteria 1304
200 Ga0439460_0071566 3300042461 Bacteria 1075
201 Ga0466960_0048480 3300044901 Bacteria 2042
202 Ga0451576_0048335 3300045051 Bacteria 4469
203 Ga0495653_0214057 3300046463 Bacteria 1300
204 Ga0495653_0252208 3300046463 Bacteria 1171
205 Ga0495584_0064581 3300046491 Bacteria 1840
206 Ga0495607_0081675 3300046501 Bacteria 1775
207 Ga0495583_0050391 3300046506 Bacteria 1903
208 Ga0495637_0041704 3300046520 Bacteria 1967
209 Ga0495644_0021626 3300046523 Bacteria 2453
210 Ga0495663_0014555 3300046525 Bacteria 2206
211 Ga0495598_0052057 3300046537 Bacteria 1236
212 Ga0495609_0067108 3300046538 Bacteria 1580
213 Ga0495633_0079578 3300046558 Bacteria 1526
214 Ga0495611_0178271 3300046648 Bacteria 993
215 Ga0495670_0042000 3300046691 Bacteria 2282
216 Ga0495589_0098356 3300046794 Unclassified 1417
217 Ga0495589_0189934 3300046794 Unclassified 972
218 Ga0496102_0121871 3300048905 Bacteria 2436
219 Ga0496108_0120447 3300048911 Bacteria 2250
220 Ga0496108_0148767 3300048911 Bacteria 2020
221 Ga0496109_0060237 3300048912 Bacteria 3468
222 Ga0496109_0267210 3300048912 Bacteria 1611
223 Ga0496110_0040384 3300048913 Bacteria 4067
224 Ga0496110_0108048 3300048913 Bacteria 2498
225 Ga0496111_0001544 3300048914 Bacteria 13251
226 Ga0496111_0292892 3300048914 Bacteria 1207
227 Ga0496112_0211330 3300048915 Bacteria 1897
228 Ga0496113_0099802 3300048916 Bacteria 2249
229 Ga0496114_0206240 3300048917 Unclassified 1723
230 Ga0496115_0047567 3300048918 Bacteria 3431
231 Ga0501031_0000665 3300049568 Bacteria 20412
232 Ga0501031_0001180 3300049568 Bacteria 15898
233 Ga0501031_0007788 3300049568 Bacteria 6972
234 Ga0501031_0020930 3300049568 Bacteria 4264
235 Ga0501031_0046093 3300049568 Bacteria 2844
236 Ga0501031_0100283 3300049568 Bacteria 1889
237 Ga0501031_0135849 3300049568 Bacteria 1607
238 Ga0501032_0002266 3300049569 Bacteria 15125
239 Ga0501032_0024706 3300049569 Bacteria 4146
240 Ga0501032_0103470 3300049569 Bacteria 1886
241 Ga0501033_0000970 3300049570 Bacteria 26044
242 Ga0501033_0001320 3300049570 Bacteria 22068
243 Ga0501033_0034357 3300049570 Bacteria 3805
244 Ga0501033_0066554 3300049570 Bacteria 2649
245 Ga0501034_0018720 3300049571 Bacteria 7096
246 Ga0501034_0170963 3300049571 Bacteria 2140
247 Ga0501034_1081094 3300049571 Bacteria 684
248 Ga0501036_0002135 3300049572 Bacteria 15421
249 Ga0501036_0022106 3300049572 Bacteria 5350
250 Ga0501036_0034751 3300049572 Bacteria 4264
251 Ga0501036_0065227 3300049572 Bacteria 3082
252 Ga0501036_0164792 3300049572 Bacteria 1868
253 Ga0501036_0257730 3300049572 Bacteria 1461
254 Ga0501037_0000585 3300049573 Bacteria 28681
255 Ga0501037_0001262 3300049573 Bacteria 18641
256 Ga0501037_0137381 3300049573 Bacteria 1750
257 Ga0501037_0179662 3300049573 Bacteria 1502
258 Ga0501038_0000177 3300049574 Bacteria 54091
259 Ga0501038_0008034 3300049574 Bacteria 9715
260 Ga0501038_0033382 3300049574 Bacteria 4534
261 Ga0501038_0231578 3300049574 Bacteria 1470
262 Ga0501039_0001133 3300049575 Bacteria 19632
263 Ga0501039_0007182 3300049575 Bacteria 8486
264 Ga0501039_0062053 3300049575 Bacteria 2895
265 Ga0501039_0126513 3300049575 Bacteria 2004
266 Ga0501039_0296749 3300049575 Bacteria 1270
267 Ga0501040_0001892 3300049576 Bacteria 13446
268 Ga0501040_0009464 3300049576 Bacteria 6355
269 Ga0501040_0012648 3300049576 Bacteria 5534
270 Ga0501040_0013116 3300049576 Bacteria 5450
271 Ga0501040_0050987 3300049576 Bacteria 2831
272 Ga0501040_0064561 3300049576 Bacteria 2520
273 Ga0501040_0362248 3300049576 Bacteria 1039
274 Ga0501041_0000163 3300049577 Bacteria 29499
275 Ga0501041_0000303 3300049577 Bacteria 23908
276 Ga0501041_0001936 3300049577 Bacteria 11621
277 Ga0501041_0005686 3300049577 Bacteria 7284
278 Ga0501041_0117800 3300049577 Bacteria 1649
279 Ga0501041_0192066 3300049577 Bacteria 1279
280 Ga0501041_0192227 3300049577 Bacteria 1278
281 Ga0501042_0000311 3300049578 Bacteria 24307
282 Ga0501042_0000400 3300049578 Bacteria 21956
283 Ga0501042_0001340 3300049578 Bacteria 14391
284 Ga0501042_0017951 3300049578 Bacteria 4892
285 Ga0501042_0137471 3300049578 Bacteria 1761
286 Ga0501042_0189274 3300049578 Bacteria 1484
287 Ga0501042_0217016 3300049578 Bacteria 1380
288 Ga0501043_0001309 3300049579 Bacteria 21780
289 Ga0501043_0010095 3300049579 Bacteria 7402
290 Ga0501043_0057811 3300049579 Bacteria 3044
291 Ga0501043_0076858 3300049579 Bacteria 2623
292 Ga0501043_0182793 3300049579 Bacteria 1633
293 Ga0501043_0323534 3300049579 Bacteria 1175
294 Ga0501046_0000477 3300049580 Bacteria 40124
295 Ga0501046_0001097 3300049580 Bacteria 26485
296 Ga0501046_0004791 3300049580 Bacteria 12198
297 Ga0501046_0014682 3300049580 Bacteria 6597
298 Ga0501046_0059102 3300049580 Bacteria 3005
299 Ga0501046_0121784 3300049580 Bacteria 1984
300 Ga0501047_0008092 3300049581 Bacteria 9923
301 Ga0501047_0041352 3300049581 Bacteria 4454
302 Ga0501048_0001130 3300049582 Bacteria 20005
303 Ga0501048_0002142 3300049582 Bacteria 15056
304 Ga0501048_0019436 3300049582 Bacteria 4983
305 Ga0501048_0043507 3300049582 Bacteria 3214
306 Ga0501048_0181583 3300049582 Bacteria 1491
307 Ga0501048_0241255 3300049582 Bacteria 1282
308 Ga0501048_0328779 3300049582 Bacteria 1089
309 Ga0501067_0041560 3300049583 Bacteria 2553
310 Ga0501068_0000082 3300049584 Bacteria 39326
311 Ga0501068_0000551 3300049584 Bacteria 19017
312 Ga0501068_0070828 3300049584 Bacteria 2127
313 Ga0501069_0000187 3300049585 Bacteria 27830
314 Ga0501069_0005424 3300049585 Bacteria 6630
315 Ga0501069_0005854 3300049585 Bacteria 6404
316 Ga0501070_0005186 3300049586 Bacteria 11098
317 Ga0501070_0009067 3300049586 Bacteria 8416
318 Ga0501070_0031943 3300049586 Bacteria 4409
319 Ga0501070_0166225 3300049586 Bacteria 1818
320 Ga0501070_0276693 3300049586 Bacteria 1370
321 Ga0501071_0003831 3300049587 Bacteria 9463
322 Ga0501071_0005814 3300049587 Bacteria 7967
323 Ga0501071_0014331 3300049587 Bacteria 5421
324 Ga0501071_0027443 3300049587 Bacteria 4005
325 Ga0501071_0028782 3300049587 Bacteria 3917
326 Ga0501071_0044367 3300049587 Bacteria 3188
327 Ga0501072_0000231 3300049588 Bacteria 41136
328 Ga0501072_0002419 3300049588 Bacteria 13971
329 Ga0501072_0010669 3300049588 Bacteria 6997
330 Ga0501072_0011033 3300049588 Bacteria 6894
331 Ga0501072_0018328 3300049588 Bacteria 5387
332 Ga0501072_0046788 3300049588 Bacteria 3406
333 Ga0501072_0056197 3300049588 Bacteria 3102
334 Ga0501072_0139976 3300049588 Bacteria 1929
335 Ga0501072_0200315 3300049588 Bacteria 1592
336 Ga0501072_0233858 3300049588 Bacteria 1464
337 Ga0501073_0004510 3300049589 Bacteria 10465
338 Ga0501073_0023200 3300049589 Bacteria 4458
339 Ga0501073_0028819 3300049589 Bacteria 3967
340 Ga0501074_0001730 3300049590 Bacteria 14917
341 Ga0501074_0002809 3300049590 Bacteria 12183
342 Ga0501074_0063390 3300049590 Bacteria 2662
343 Ga0501074_0098325 3300049590 Bacteria 2095
344 Ga0501074_0113569 3300049590 Bacteria 1938
345 Ga0501074_0480561 3300049590 Bacteria 880
346 Ga0501075_0000737 3300049591 Bacteria 20299
347 Ga0501075_0006584 3300049591 Bacteria 8002
348 Ga0501075_0010705 3300049591 Bacteria 6455
349 Ga0501075_0017847 3300049591 Bacteria 5126
350 Ga0501075_0044437 3300049591 Bacteria 3333
351 Ga0501075_0077526 3300049591 Bacteria 2515
352 Ga0501075_0090639 3300049591 Bacteria 2319
353 Ga0501076_0001896 3300049592 Bacteria 14261
354 Ga0501076_0002572 3300049592 Bacteria 12475
355 Ga0501076_0003441 3300049592 Bacteria 11104
356 Ga0501076_0006910 3300049592 Bacteria 8246
357 Ga0501076_0010540 3300049592 Bacteria 6861
358 Ga0501076_0014053 3300049592 Bacteria 6017
359 Ga0501076_0118598 3300049592 Bacteria 2142
360 Ga0501076_0119692 3300049592 Bacteria 2132
361 Ga0501076_0158614 3300049592 Bacteria 1842
362 Ga0501076_0200845 3300049592 Bacteria 1628
363 Ga0501077_0000585 3300049593 Bacteria 22042
364 Ga0501077_0001263 3300049593 Bacteria 15263
365 Ga0501077_0006768 3300049593 Bacteria 7048
366 Ga0501077_0007559 3300049593 Bacteria 6704
367 Ga0501077_0041932 3300049593 Bacteria 2912
368 Ga0501077_0057752 3300049593 Bacteria 2464
369 Ga0501077_0100239 3300049593 Bacteria 1835
370 Ga0501077_0262767 3300049593 Bacteria 1098
371 Ga0501079_0000905 3300049741 Bacteria 20337
372 Ga0501079_0003651 3300049741 Bacteria 11337
373 Ga0501079_0008480 3300049741 Bacteria 7792
374 Ga0501079_0047945 3300049741 Bacteria 3296
375 Ga0501079_0141275 3300049741 Bacteria 1875
376 Ga0501079_0178990 3300049741 Bacteria 1654
377 Ga0501079_0186082 3300049741 Bacteria 1621
378 Ga0501079_0425268 3300049741 Unclassified 1043
379 Ga0501080_0001457 3300049742 Bacteria 19916
380 Ga0501080_0008093 3300049742 Bacteria 9526
381 Ga0501080_0049003 3300049742 Bacteria 3931
382 Ga0501080_0083433 3300049742 Bacteria 2968
383 Ga0501080_0457026 3300049742 Bacteria 1144
384 Ga0501080_0477043 3300049742 Bacteria 1116
385 Ga0501081_0000232 3300049743 Bacteria 28120
386 Ga0501081_0001769 3300049743 Bacteria 13395
387 Ga0501081_0004801 3300049743 Bacteria 8685
388 Ga0501081_0015795 3300049743 Bacteria 4983
389 Ga0501081_0067476 3300049743 Bacteria 2490
390 Ga0501081_0177704 3300049743 Bacteria 1538
391 Ga0501081_0198755 3300049743 Bacteria 1453
392 Ga0501083_0000390 3300049744 Bacteria 27881
393 Ga0501083_0017512 3300049744 Bacteria 4995
394 Ga0501083_0027977 3300049744 Bacteria 3886
395 Ga0501083_0057179 3300049744 Bacteria 2612
396 Ga0501035_0002226 3300049822 Bacteria 19232
397 Ga0501035_0010250 3300049822 Bacteria 8695
398 Ga0501035_0120204 3300049822 Bacteria 2297
399 Ga0501044_0003478 3300049823 Bacteria 17738
400 Ga0501044_0087378 3300049823 Bacteria 3149
401 Ga0501044_0096229 3300049823 Bacteria 2982
402 Ga0501045_0000422 3300049824 Bacteria 25824
403 Ga0501045_0001543 3300049824 Bacteria 15335
404 Ga0501045_0016614 3300049824 Bacteria 5228
405 Ga0501045_0022963 3300049824 Bacteria 4470
406 Ga0501045_0059068 3300049824 Bacteria 2809
407 Ga0501045_0101462 3300049824 Bacteria 2130
408 Ga0501045_0124767 3300049824 Bacteria 1912
409 Ga0501045_0350868 3300049824 Bacteria 1098
410 Ga0501045_0379532 3300049824 Bacteria 1052
411 nmdc:mga05p37_1133232_c1 3300050507 Unclassified 816
412 nmdc:mga05p37_3398_c1 3300050507 Bacteria 18576
413 nmdc:mga05p37_634921_c1 3300050507 Bacteria 1199
414 nmdc:mga05p37_975695_c1 3300050507 Bacteria 904
415 nmdc:mga09592_84942_c1 3300050508 Bacteria 2700
416 nmdc:mga09592_89798_c1 3300050508 Bacteria 2625
417 nmdc:mga0qj67_12690_c1 3300050509 Bacteria 6354
418 nmdc:mga0qj67_5078_c1 3300050509 Bacteria 9578
419 nmdc:mga06r32_268062_c1 3300050510 Bacteria 1695
420 nmdc:mga06r32_451226_c1 3300050510 Bacteria 1265
421 nmdc:mga06r32_45310_c1 3300050510 Bacteria 4192
422 nmdc:mga08y16_32382_c1 3300050511 Bacteria 5497
423 Ga0495619_0087025 3300053085 Bacteria 2112
424 Ga0501084_0000400 3300054114 Bacteria 33414
425 Ga0501084_0008444 3300054114 Bacteria 8512
426 Ga0501084_0017529 3300054114 Bacteria 5955
427 Ga0501084_0044740 3300054114 Bacteria 3706
428 Ga0501084_0051411 3300054114 Bacteria 3448
429 Ga0501084_0058487 3300054114 Bacteria 3225
430 Ga0501084_0069815 3300054114 Bacteria 2942
431 Ga0501084_0487889 3300054114 Bacteria 1041
432 Ga0501082_0002758 3300060353 Bacteria 15354
433 Ga0501082_0003966 3300060353 Bacteria 12923
434 Ga0501082_0021397 3300060353 Bacteria 5579
435 Ga0501082_0029321 3300060353 Bacteria 4739
436 Ga0501082_0039360 3300060353 Bacteria 4078
437 Ga0501082_0055747 3300060353 Bacteria 3404
438 Ga0501082_0133665 3300060353 Bacteria 2152
439 Ga0501082_0343631 3300060353 Bacteria 1300
440 Ga0501082_0565672 3300060353 Bacteria 994
441 Ga0530510_0000103 3300061734 Bacteria 46247
442 Ga0530510_0001470 3300061734 Bacteria 15811
443 Ga0530510_0002850 3300061734 Bacteria 11889
444 Ga0530510_0004078 3300061734 Bacteria 10082
445 Ga0530510_0016870 3300061734 Bacteria 5172
446 Ga0530510_0140116 3300061734 Bacteria 1782
447 Ga0530510_0202255 3300061734 Bacteria 1475
448 Ga0081455_10127081
449 JGI25407J50210_10020516
450 Ga0070676_10091221
451 Ga0070683_100242721
452 Ga0070680_100222612
453 Ga0070680_100276374
454 Ga0068868_100047012
455 Ga0070691_10013941
456 Ga0070668_100374545
457 Ga0070675_100311905
458 Ga0070674_100015812
459 Ga0070674_100073063
460 Ga0070674_100352001
461 Ga0070688_100184298
462 Ga0070659_100201872
463 Ga0070709_10500759
464 Ga0070714_100093718
465 Ga0070714_100126440
466 Ga0070713_100085338
467 Ga0070711_100056907
468 Ga0070711_100108025
469 Ga0070705_100004551
470 Ga0070705_100053333
471 Ga0070694_100140336
472 Ga0070708_100026805
473 Ga0070678_100049745
474 Ga0070662_100170109
475 Ga0070706_100093911
476 Ga0070707_100710966
477 Ga0070698_100006551
478 Ga0070684_100548718
479 Ga0070697_100025494
480 Ga0070697_100172565
481 Ga0070672_100400510
482 Ga0070686_100090422
483 Ga0070696_100182206
484 Ga0070704_100219605
485 Ga0070664_100090964
486 Ga0068857_100001516
487 Ga0068857_100434151
488 Ga0068854_100017443
489 Ga0070702_100030844
490 Ga0068852_100058483
491 Ga0068866_10255198
492 Ga0068861_100325943
493 Ga0068870_10032021
494 Ga0068858_100215729
495 Ga0068860_100374025
496 Ga0068862_100620553
497 Ga0081455_10048652
498 Ga0081455_10056876
499 Ga0081455_10065883
500 Ga0081538_10000266
501 Ga0081538_10000334
502 Ga0081538_10001790
503 Ga0081538_10002327
504 Ga0081538_10011455
505 Ga0081538_10041299
506 Ga0081538_10054797
507 Ga0081538_10060477
508 Ga0081538_10094257
509 Ga0081539_10001821
510 Ga0075364_10213222
511 Ga0070715_10178783
512 Ga0070712_100044907
513 Ga0075428_100070397
514 Ga0075428_100109853
515 Ga0075428_100358594
516 Ga0075428_100483239
517 Ga0075430_100007562
518 Ga0075430_100198680
519 Ga0075431_100003203
520 Ga0075431_100039670
521 Ga0075431_100461347
522 Ga0075429_100002220
523 Ga0075429_100093325
524 Ga0075429_100453422
525 Ga0068865_100004149
526 Ga0111539_10006538
527 Ga0111539_10011354
528 Ga0111539_10328320
529 Ga0111539_10389960
530 Ga0105245_10086040
531 Ga0105245_10240488
532 Ga0105245_10368685
533 Ga0105245_10432736
534 Ga0105247_10193886
535 Ga0114129_10042557
536 Ga0114129_10093655
537 Ga0114129_10288730
538 Ga0105243_10008877
539 Ga0105243_10120042
540 Ga0105248_10056032
541 Ga0105249_10351919
542 Ga0105239_10347189
543 Ga0105239_10746696
544 Ga0105246_10038787
545 Ga0157371_10343304
546 Ga0157378_10609577
547 Ga0157380_10111262
548 Ga0207653_10023237
549 Ga0207653_10084881
550 Ga0207692_10134622
551 Ga0207642_10283532
552 Ga0207688_10031645
553 Ga0207685_10022668
554 Ga0207693_10015096
555 Ga0207660_10244708
556 Ga0207646_10614705
557 Ga0207659_10534916
558 Ga0207687_10327539
559 Ga0207664_10010803
560 Ga0207664_10098276
561 Ga0207706_10140961
562 Ga0207706_10152385
563 Ga0207706_10493863
564 Ga0207686_10204354
565 Ga0207709_10151194
566 Ga0207709_10191208
567 Ga0207669_10044941
568 Ga0207669_10199089
569 Ga0207704_10010586
570 Ga0207665_10009728
571 Ga0207689_10059651
572 Ga0207661_10254749
573 Ga0207679_10102149
574 Ga0207668_10095907
575 Ga0207648_10025051
576 Ga0207648_10144281
577 Ga0207674_10002266
578 Ga0207674_10236772
579 Ga0207675_100186598
580 Ga0207675_100202545
581 Ga0207675_100306621
582 Ga0207683_10417189
583 Ga0207428_10012174
584 Ga0207428_10078941
585 Ga0207428_10158162
586 Ga0307408_100339407
587 Ga0307405_10008184
588 Ga0307405_10041759
589 Ga0307413_10042081
590 Ga0307410_10071900
591 Ga0307410_10152971
592 Ga0307410_10184192
593 Ga0307406_10017631
594 Ga0307406_10134878
595 Ga0307407_10040473
596 Ga0307407_10308718
597 Ga0307412_10087825
598 Ga0307409_100037826
599 Ga0307416_100008814
600 Ga0307416_100293574
601 Ga0307416_100747497
602 Ga0307414_10071968
603 Ga0307411_10034983
604 Ga0307415_100000129
605 Ga0307415_100031218
606 Ga0395899_0001532
607 Ga0395899_0005365
608 Ga0395899_0028856
609 Ga0395899_0049340
610 Ga0395899_0071255
611 Ga0395899_0071729
612 Ga0395900_0001092
613 Ga0395900_0010297
614 Ga0395900_0018054
615 Ga0395900_0053555
616 Ga0395900_0230362
617 Ga0395900_0298674
618 Ga0395898_0003847
619 Ga0395898_0006659
620 Ga0395898_0012940
621 Ga0395898_0053652
622 Ga0395898_0069057
623 Ga0395898_0122418
624 Ga0395898_0138952
625 Ga0395898_0141851
626 Ga0395905_0015077
627 Ga0395905_0045092
628 Ga0395905_0067676
629 Ga0395905_0118404
630 Ga0395905_0155738
631 Ga0395905_0488216
632 Ga0395901_0001542
633 Ga0395901_0001665
634 Ga0395901_0021007
635 Ga0395901_0071607
636 Ga0395901_0082562
637 Ga0395901_0088177
638 Ga0395901_0109521
639 Ga0395901_0347794
640 Ga0395901_0882234
641 Ga0395901_0983919
642 Ga0451793_0138128
643 Ga0451847_0779560
644 Ga0439448_0009043
645 Ga0439434_0017018
646 Ga0439460_0045336
647 Ga0439460_0071566
648 Ga0466960_0048480
649 Ga0451576_0048335
650 Ga0495653_0214057
651 Ga0495653_0252208
652 Ga0495584_0064581
653 Ga0495607_0081675
654 Ga0495583_0050391
655 Ga0495637_0041704
656 Ga0495644_0021626
657 Ga0495663_0014555
658 Ga0495598_0052057
659 Ga0495609_0067108
660 Ga0495633_0079578
661 Ga0495611_0178271
662 Ga0495670_0042000
663 Ga0495589_0098356
664 Ga0495589_0189934
665 Ga0496102_0121871
666 Ga0496108_0120447
667 Ga0496108_0148767
668 Ga0496109_0060237
669 Ga0496109_0267210
670 Ga0496110_0040384
671 Ga0496110_0108048
672 Ga0496111_0001544
673 Ga0496111_0292892
674 Ga0496112_0211330
675 Ga0496113_0099802
676 Ga0496114_0206240
677 Ga0496115_0047567
678 Ga0501031_0000665
679 Ga0501031_0001180
680 Ga0501031_0007788
681 Ga0501031_0020930
682 Ga0501031_0046093
683 Ga0501031_0100283
684 Ga0501031_0135849
685 Ga0501032_0002266
686 Ga0501032_0024706
687 Ga0501032_0103470
688 Ga0501033_0000970
689 Ga0501033_0001320
690 Ga0501033_0034357
691 Ga0501033_0066554
692 Ga0501034_0018720
693 Ga0501034_0170963
694 Ga0501034_1081094
695 Ga0501036_0002135
696 Ga0501036_0022106
697 Ga0501036_0034751
698 Ga0501036_0065227
699 Ga0501036_0164792
700 Ga0501036_0257730
701 Ga0501037_0000585
702 Ga0501037_0001262
703 Ga0501037_0137381
704 Ga0501037_0179662
705 Ga0501038_0000177
706 Ga0501038_0008034
707 Ga0501038_0033382
708 Ga0501038_0231578
709 Ga0501039_0001133
710 Ga0501039_0007182
711 Ga0501039_0062053
712 Ga0501039_0126513
713 Ga0501039_0296749
714 Ga0501040_0001892
715 Ga0501040_0009464
716 Ga0501040_0012648
717 Ga0501040_0013116
718 Ga0501040_0050987
719 Ga0501040_0064561
720 Ga0501040_0362248
721 Ga0501041_0000163
722 Ga0501041_0000303
723 Ga0501041_0001936
724 Ga0501041_0005686
725 Ga0501041_0117800
726 Ga0501041_0192066
727 Ga0501041_0192227
728 Ga0501042_0000311
729 Ga0501042_0000400
730 Ga0501042_0001340
731 Ga0501042_0017951
732 Ga0501042_0137471
733 Ga0501042_0189274
734 Ga0501042_0217016
735 Ga0501043_0001309
736 Ga0501043_0010095
737 Ga0501043_0057811
738 Ga0501043_0076858
739 Ga0501043_0182793
740 Ga0501043_0323534
741 Ga0501046_0000477
742 Ga0501046_0001097
743 Ga0501046_0004791
744 Ga0501046_0014682
745 Ga0501046_0059102
746 Ga0501046_0121784
747 Ga0501047_0008092
748 Ga0501047_0041352
749 Ga0501048_0001130
750 Ga0501048_0002142
751 Ga0501048_0019436
752 Ga0501048_0043507
753 Ga0501048_0181583
754 Ga0501048_0241255
755 Ga0501048_0328779
756 Ga0501067_0041560
757 Ga0501068_0000082
758 Ga0501068_0000551
759 Ga0501068_0070828
760 Ga0501069_0000187
761 Ga0501069_0005424
762 Ga0501069_0005854
763 Ga0501070_0005186
764 Ga0501070_0009067
765 Ga0501070_0031943
766 Ga0501070_0166225
767 Ga0501070_0276693
768 Ga0501071_0003831
769 Ga0501071_0005814
770 Ga0501071_0014331
771 Ga0501071_0027443
772 Ga0501071_0028782
773 Ga0501071_0044367
774 Ga0501072_0000231
775 Ga0501072_0002419
776 Ga0501072_0010669
777 Ga0501072_0011033
778 Ga0501072_0018328
779 Ga0501072_0046788
780 Ga0501072_0056197
781 Ga0501072_0139976
782 Ga0501072_0200315
783 Ga0501072_0233858
784 Ga0501073_0004510
785 Ga0501073_0023200
786 Ga0501073_0028819
787 Ga0501074_0001730
788 Ga0501074_0002809
789 Ga0501074_0063390
790 Ga0501074_0098325
791 Ga0501074_0113569
792 Ga0501074_0480561
793 Ga0501075_0000737
794 Ga0501075_0006584
795 Ga0501075_0010705
796 Ga0501075_0017847
797 Ga0501075_0044437
798 Ga0501075_0077526
799 Ga0501075_0090639
800 Ga0501076_0001896
801 Ga0501076_0002572
802 Ga0501076_0003441
803 Ga0501076_0006910
804 Ga0501076_0010540
805 Ga0501076_0014053
806 Ga0501076_0118598
807 Ga0501076_0119692
808 Ga0501076_0158614
809 Ga0501076_0200845
810 Ga0501077_0000585
811 Ga0501077_0001263
812 Ga0501077_0006768
813 Ga0501077_0007559
814 Ga0501077_0041932
815 Ga0501077_0057752
816 Ga0501077_0100239
817 Ga0501077_0262767
818 Ga0501079_0000905
819 Ga0501079_0003651
820 Ga0501079_0008480
821 Ga0501079_0047945
822 Ga0501079_0141275
823 Ga0501079_0178990
824 Ga0501079_0186082
825 Ga0501079_0425268
826 Ga0501080_0001457
827 Ga0501080_0008093
828 Ga0501080_0049003
829 Ga0501080_0083433
830 Ga0501080_0457026
831 Ga0501080_0477043
832 Ga0501081_0000232
833 Ga0501081_0001769
834 Ga0501081_0004801
835 Ga0501081_0015795
836 Ga0501081_0067476
837 Ga0501081_0177704
838 Ga0501081_0198755
839 Ga0501083_0000390
840 Ga0501083_0017512
841 Ga0501083_0027977
842 Ga0501083_0057179
843 Ga0501035_0002226
844 Ga0501035_0010250
845 Ga0501035_0120204
846 Ga0501044_0003478
847 Ga0501044_0087378
848 Ga0501044_0096229
849 Ga0501045_0000422
850 Ga0501045_0001543
851 Ga0501045_0016614
852 Ga0501045_0022963
853 Ga0501045_0059068
854 Ga0501045_0101462
855 Ga0501045_0124767
856 Ga0501045_0350868
857 Ga0501045_0379532
858 nmdc:mga05p37_1133232_c1
859 nmdc:mga05p37_3398_c1
860 nmdc:mga05p37_634921_c1
861 nmdc:mga05p37_975695_c1
862 nmdc:mga09592_84942_c1
863 nmdc:mga09592_89798_c1
864 nmdc:mga0qj67_12690_c1
865 nmdc:mga0qj67_5078_c1
866 nmdc:mga06r32_268062_c1
867 nmdc:mga06r32_451226_c1
868 nmdc:mga06r32_45310_c1
869 nmdc:mga08y16_32382_c1
870 Ga0495619_0087025
871 Ga0501084_0000400
872 Ga0501084_0008444
873 Ga0501084_0017529
874 Ga0501084_0044740
875 Ga0501084_0051411
876 Ga0501084_0058487
877 Ga0501084_0069815
878 Ga0501084_0487889
879 Ga0501082_0002758
880 Ga0501082_0003966
881 Ga0501082_0021397
882 Ga0501082_0029321
883 Ga0501082_0039360
884 Ga0501082_0055747
885 Ga0501082_0133665
886 Ga0501082_0343631
887 Ga0501082_0565672
888 Ga0530510_0000103
889 Ga0530510_0001470
890 Ga0530510_0002850
891 Ga0530510_0004078
892 Ga0530510_0016870
893 Ga0530510_0140116
894 Ga0530510_0202255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

88

229

0.95

PF08032

SpoU_sub_bind

RNA 2'-O ribose methyltransferase substrate binding

5

77

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.954 75 235
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.9208 75 235
2ha8-assembly1.cif.gz_B methyltransferase domain of human tar (hiv-1) rna binding protein 1 0.9071 89 236
4x3m-assembly1.cif.gz_B crystal structure of ttha0275 from thermus thermophilus (hb8) in complex with adenosine in space group p212121 0.8836 3 238
1x7p-assembly1.cif.gz_B crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes in complex with the cofactor adomet 0.8758 5 238
ID Description Score Start End Superfamily
af_P9WFY5_148_322_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9668 81 236 3.40.1280.10
af_Q2G2M3_73_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9476 73 235 3.40.1280.10
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9392 77 235 3.40.1280.10
af_Q76NT0_373_525_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9387 88 230 3.40.1280.10
1x7pB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.923 84 238 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A0B0HM12-F1-model_v4 deleted 0.9706 107 235
AF-A0A3S4ZXY1-F1-model_v4 deleted 0.9702 96 237
AF-A0A7K2MRX9-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9701 73 235 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A660LFD1-F1-model_v4 Putative rRNA methylase 0.9691 3 237 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A1F9D5I0-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9675 90 237 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259

Map