F445901

General Info

Members Datasets Scaffolds Average Seq Length
447 231 894 188

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100163911|Ga0068857_1001639112
Length 204
Sequence MVARPPVKVTIAAMRLDDLEIVQAIERASFSSPWPPNAYRSELETNRLANYLVARADGEIVGYGGMWLMVDEAHITTFAVHPAWRRQRIGERLLLAFLDLAVARQAHEATLEVRLSNLPARRLYEKYGFRPVGLRPRYYSDDNEDALIMTTEPLADPRMRERLQRLRAELETAPLPRRPGESDDDEGASDLEPRGPQPEPGEPA

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
132 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
133 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
137 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.71
Rhizosphere 93.06
Stem 0
Stem Tuber 0
Unclassified 12.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100163911 3300005577 Bacteria 2018
2 JGI25406J46586_10036184 3300003203 Unclassified 1794
3 Ga0070683_100232577 3300005329 Bacteria 1752
4 Ga0070683_100353766 3300005329 Bacteria 1399
5 Ga0070683_101090272 3300005329 Unclassified 767
6 Ga0070690_100119870 3300005330 Bacteria 1765
7 Ga0070670_100008236 3300005331 Bacteria 8879
8 Ga0070670_100412976 3300005331 Bacteria 1192
9 Ga0068869_100037608 3300005334 Bacteria 3443
10 Ga0070666_10890301 3300005335 Unclassified 658
11 Ga0070680_100186953 3300005336 Bacteria 1745
12 Ga0068868_100054827 3300005338 Bacteria 3143
13 Ga0070660_100013653 3300005339 Bacteria 5837
14 Ga0070689_100256068 3300005340 Unclassified 1445
15 Ga0070687_100087085 3300005343 Bacteria 1718
16 Ga0070687_100550978 3300005343 Unclassified 785
17 Ga0070692_10312826 3300005345 Unclassified 963
18 Ga0070668_100116690 3300005347 Bacteria 2129
19 Ga0070669_100215798 3300005353 Bacteria 1515
20 Ga0070675_100012075 3300005354 Bacteria 6770
21 Ga0070675_100060837 3300005354 Bacteria 3118
22 Ga0070674_100021070 3300005356 Unclassified 4179
23 Ga0070673_100086049 3300005364 Bacteria 2560
24 Ga0070688_100019366 3300005365 Bacteria 3941
25 Ga0070659_100020159 3300005366 Bacteria 5062
26 Ga0070659_100806358 3300005366 Bacteria 817
27 Ga0070710_10176405 3300005437 Bacteria 1335
28 Ga0070710_10871510 3300005437 Bacteria 648
29 Ga0070701_10001804 3300005438 Bacteria 8081
30 Ga0070705_100021590 3300005440 Bacteria 3427
31 Ga0070705_100137963 3300005440 Bacteria 1601
32 Ga0070700_100008954 3300005441 Bacteria 5477
33 Ga0070700_100382559 3300005441 Bacteria 1053
34 Ga0070694_100010216 3300005444 Bacteria 5780
35 Ga0070694_100166932 3300005444 Bacteria 1619
36 Ga0070708_100032333 3300005445 Bacteria 4537
37 Ga0070708_100187231 3300005445 Bacteria 1936
38 Ga0070708_100198349 3300005445 Bacteria 1878
39 Ga0070708_100292450 3300005445 Bacteria 1534
40 Ga0070708_100988643 3300005445 Bacteria 789
41 Ga0070663_100371288 3300005455 Unclassified 1163
42 Ga0070663_100807731 3300005455 Unclassified 805
43 Ga0070662_100001489 3300005457 Bacteria 14413
44 Ga0070662_100125279 3300005457 Bacteria 1974
45 Ga0070662_100463553 3300005457 Bacteria 1053
46 Ga0070681_10042979 3300005458 Bacteria 4528
47 Ga0068867_100232128 3300005459 Bacteria 1492
48 Ga0070685_10011745 3300005466 Bacteria 4591
49 Ga0070706_100001506 3300005467 Bacteria 24455
50 Ga0070706_100020608 3300005467 Bacteria 6075
51 Ga0070706_100037338 3300005467 Bacteria 4487
52 Ga0070706_100443191 3300005467 Bacteria 1209
53 Ga0070707_100000802 3300005468 Bacteria 30993
54 Ga0070707_100001085 3300005468 Bacteria 26916
55 Ga0070707_100011344 3300005468 Bacteria 8306
56 Ga0070698_100021556 3300005471 Bacteria 6748
57 Ga0070698_100039727 3300005471 Bacteria 4840
58 Ga0070698_100066506 3300005471 Bacteria 3627
59 Ga0070698_100819385 3300005471 Bacteria 875
60 Ga0070699_100000974 3300005518 Bacteria 26705
61 Ga0070699_100044669 3300005518 Bacteria 3836
62 Ga0070699_100270573 3300005518 Bacteria 1520
63 Ga0070699_100375636 3300005518 Bacteria 1283
64 Ga0070679_100152181 3300005530 Bacteria 2290
65 Ga0070679_100220694 3300005530 Bacteria 1857
66 Ga0070684_100067823 3300005535 Bacteria 3134
67 Ga0070684_101083147 3300005535 Archaea 753
68 Ga0070697_100009837 3300005536 Bacteria 7459
69 Ga0070697_100172636 3300005536 Bacteria 1830
70 Ga0070697_100175390 3300005536 Bacteria 1816
71 Ga0070697_100277211 3300005536 Bacteria 1438
72 Ga0070697_100305517 3300005536 Bacteria 1368
73 Ga0070686_100692064 3300005544 Bacteria 812
74 Ga0070695_100011691 3300005545 Bacteria 5253
75 Ga0070695_100012614 3300005545 Bacteria 5074
76 Ga0070695_100052563 3300005545 Bacteria 2618
77 Ga0070695_100524396 3300005545 Unclassified 920
78 Ga0070696_100009907 3300005546 Bacteria 6375
79 Ga0070696_100014916 3300005546 Bacteria 5218
80 Ga0070696_100044312 3300005546 Bacteria 3080
81 Ga0070696_100172465 3300005546 Bacteria 1600
82 Ga0070696_100181899 3300005546 Bacteria 1560
83 Ga0070696_100428874 3300005546 Bacteria 1039
84 Ga0070693_100504159 3300005547 Unclassified 859
85 Ga0070704_100026140 3300005549 Bacteria 3853
86 Ga0070704_100041964 3300005549 Bacteria 3162
87 Ga0070704_100082761 3300005549 Bacteria 2368
88 Ga0070704_100089212 3300005549 Bacteria 2293
89 Ga0070704_100452623 3300005549 Bacteria 1106
90 Ga0068855_100243899 3300005563 Bacteria 2006
91 Ga0068857_100249928 3300005577 Unclassified 1625
92 Ga0068854_100084780 3300005578 Bacteria 2345
93 Ga0068854_100217152 3300005578 Bacteria 1511
94 Ga0068852_100121308 3300005616 Bacteria 2394
95 Ga0068859_101471055 3300005617 Unclassified 752
96 Ga0068864_100002582 3300005618 Bacteria 14956
97 Ga0068861_100009590 3300005719 Bacteria 6689
98 Ga0068870_10024895 3300005840 Bacteria 2965
99 Ga0068870_10405946 3300005840 Bacteria 888
100 Ga0068863_100343732 3300005841 Bacteria 1452
101 Ga0068858_100012676 3300005842 Bacteria 7942
102 Ga0068858_100615639 3300005842 Bacteria 1054
103 Ga0068858_100893431 3300005842 Bacteria 869
104 Ga0068860_100270376 3300005843 Bacteria 1659
105 Ga0068862_100023085 3300005844 Bacteria 5209
106 Ga0081539_10008675 3300005985 Bacteria 8755
107 Ga0070712_100436516 3300006175 Bacteria 1088
108 Ga0068871_100619082 3300006358 Unclassified 986
109 Ga0075428_100247688 3300006844 Bacteria 1921
110 Ga0075428_100550986 3300006844 Bacteria 1233
111 Ga0075433_10224142 3300006852 Bacteria 1670
112 Ga0075433_10224419 3300006852 Bacteria 1668
113 Ga0075433_10227120 3300006852 Bacteria 1658
114 Ga0075433_10322244 3300006852 Bacteria 1367
115 Ga0075434_100204716 3300006871 Bacteria 1994
116 Ga0075434_100269019 3300006871 Bacteria 1724
117 Ga0075434_100407790 3300006871 Bacteria 1380
118 Ga0075434_100410622 3300006871 Bacteria 1375
119 Ga0068865_100134731 3300006881 Bacteria 1854
120 Ga0097620_101471173 3300006931 Unclassified 752
121 Ga0075435_100353962 3300007076 Bacteria 1259
122 Ga0075435_100385804 3300007076 Bacteria 1204
123 Ga0105240_10965304 3300009093 Unclassified 913
124 Ga0111539_10024002 3300009094 Bacteria 7490
125 Ga0111539_10047696 3300009094 Bacteria 5119
126 Ga0111539_10164881 3300009094 Bacteria 2591
127 Ga0111539_10501149 3300009094 Bacteria 1414
128 Ga0105245_10045451 3300009098 Bacteria 3922
129 Ga0105245_10115424 3300009098 Bacteria 2502
130 Ga0105245_10405047 3300009098 Bacteria 1364
131 Ga0105245_10919555 3300009098 Bacteria 917
132 Ga0114129_10066098 3300009147 Bacteria 5044
133 Ga0114129_10092022 3300009147 Bacteria 4201
134 Ga0114129_10433492 3300009147 Bacteria 1727
135 Ga0105243_10007511 3300009148 Bacteria 8379
136 Ga0105243_10643725 3300009148 Bacteria 1026
137 Ga0105241_11082842 3300009174 Bacteria 754
138 Ga0105242_10039309 3300009176 Unclassified 3807
139 Ga0105242_10676629 3300009176 Bacteria 1007
140 Ga0105248_10277653 3300009177 Bacteria 1886
141 Ga0105248_10506718 3300009177 Bacteria 1361
142 Ga0105237_10567642 3300009545 Unclassified 1141
143 Ga0105249_10006625 3300009553 Bacteria 10077
144 Ga0105249_10247296 3300009553 Bacteria 1766
145 Ga0105249_10385755 3300009553 Bacteria 1428
146 Ga0105249_11531026 3300009553 Bacteria 739
147 Ga0105239_10050450 3300010375 Bacteria 4564
148 Ga0105239_10601074 3300010375 Bacteria 1255
149 Ga0105246_10042085 3300011119 Bacteria 3092
150 Ga0105246_10261535 3300011119 Bacteria 1379
151 Ga0157378_10072274 3300013297 Bacteria 3100
152 Ga0157378_10824447 3300013297 Bacteria 955
153 Ga0163162_10583578 3300013306 Bacteria 1245
154 Ga0163162_10851263 3300013306 Unclassified 1027
155 Ga0163163_10128784 3300014325 Unclassified 2570
156 Ga0163163_10141841 3300014325 Bacteria 2445
157 Ga0163163_10185287 3300014325 Bacteria 2129
158 Ga0163163_10225802 3300014325 Bacteria 1922
159 Ga0163163_10456684 3300014325 Bacteria 1338
160 Ga0157380_10138818 3300014326 Unclassified 2085
161 Ga0157380_10159466 3300014326 Bacteria 1959
162 Ga0157380_10438402 3300014326 Bacteria 1251
163 Ga0157380_10582722 3300014326 Bacteria 1103
164 Ga0157380_10639874 3300014326 Unclassified 1059
165 Ga0157380_10885300 3300014326 Bacteria 918
166 Ga0182008_10024869 3300014497 Bacteria 3045
167 Ga0157377_10000477 3300014745 Bacteria 17247
168 Ga0157377_10081876 3300014745 Bacteria 1889
169 Ga0157377_10227393 3300014745 Bacteria 1198
170 Ga0157377_10560557 3300014745 Bacteria 809
171 Ga0157379_10026399 3300014968 Bacteria 5170
172 Ga0157379_10171982 3300014968 Bacteria 1956
173 Ga0157376_11452648 3300014969 Bacteria 718
174 Ga0207653_10021738 3300025885 Bacteria 2035
175 Ga0207692_10031815 3300025898 Bacteria 2530
176 Ga0207647_10136218 3300025904 Bacteria 1441
177 Ga0207643_10004287 3300025908 Bacteria 7670
178 Ga0207643_10114529 3300025908 Bacteria 1591
179 Ga0207684_10000870 3300025910 Bacteria 34476
180 Ga0207684_10045070 3300025910 Bacteria 3741
181 Ga0207684_10097309 3300025910 Bacteria 2512
182 Ga0207684_10110488 3300025910 Bacteria 2353
183 Ga0207684_10435916 3300025910 Unclassified 1126
184 Ga0207693_10454111 3300025915 Bacteria 1001
185 Ga0207662_10000302 3300025918 Bacteria 22724
186 Ga0207662_10323935 3300025918 Bacteria 1029
187 Ga0207662_10333923 3300025918 Bacteria 1014
188 Ga0207662_10573311 3300025918 Bacteria 783
189 Ga0207657_10043447 3300025919 Bacteria 3958
190 Ga0207652_10155631 3300025921 Bacteria 2048
191 Ga0207652_10348304 3300025921 Bacteria 1337
192 Ga0207652_10444679 3300025921 Unclassified 1169
193 Ga0207652_10612902 3300025921 Unclassified 975
194 Ga0207646_10002298 3300025922 Bacteria 22695
195 Ga0207646_10006239 3300025922 Bacteria 12386
196 Ga0207646_10021043 3300025922 Bacteria 6032
197 Ga0207681_10548389 3300025923 Bacteria 951
198 Ga0207694_10226741 3300025924 Bacteria 1525
199 Ga0207650_10362637 3300025925 Bacteria 1194
200 Ga0207650_10379411 3300025925 Bacteria 1167
201 Ga0207659_10090558 3300025926 Bacteria 2283
202 Ga0207687_10755547 3300025927 Bacteria 828
203 Ga0207690_10088014 3300025932 Bacteria 2187
204 Ga0207706_10216585 3300025933 Bacteria 1677
205 Ga0207706_10358052 3300025933 Bacteria 1268
206 Ga0207686_10020251 3300025934 Bacteria 3798
207 Ga0207686_10073240 3300025934 Bacteria 2209
208 Ga0207709_10023042 3300025935 Bacteria 3540
209 Ga0207709_10417259 3300025935 Unclassified 1030
210 Ga0207670_10039638 3300025936 Bacteria 3086
211 Ga0207669_10034392 3300025937 Bacteria 2871
212 Ga0207669_10046178 3300025937 Bacteria 2572
213 Ga0207669_10346369 3300025937 Bacteria 1146
214 Ga0207704_10180463 3300025938 Bacteria 1525
215 Ga0207665_10422891 3300025939 Bacteria 1018
216 Ga0207691_10136331 3300025940 Bacteria 2164
217 Ga0207689_10276272 3300025942 Bacteria 1391
218 Ga0207689_10812512 3300025942 Bacteria 789
219 Ga0207661_10728893 3300025944 Bacteria 912
220 Ga0207679_10061109 3300025945 Bacteria 2803
221 Ga0207679_10335311 3300025945 Bacteria 1314
222 Ga0207667_10297860 3300025949 Bacteria 1648
223 Ga0207651_10073329 3300025960 Bacteria 2434
224 Ga0207651_10186792 3300025960 Bacteria 1650
225 Ga0207712_10287880 3300025961 Bacteria 1343
226 Ga0207668_10142490 3300025972 Bacteria 1845
227 Ga0207668_10343554 3300025972 Bacteria 1246
228 Ga0207640_10209277 3300025981 Unclassified 1484
229 Ga0207640_10471664 3300025981 Unclassified 1039
230 Ga0207677_10116932 3300026023 Bacteria 1997
231 Ga0207677_10158932 3300026023 Bacteria 1753
232 Ga0207678_10012627 3300026067 Bacteria 7420
233 Ga0207708_10203851 3300026075 Bacteria 1579
234 Ga0207708_10300129 3300026075 Bacteria 1306
235 Ga0207641_10228845 3300026088 Bacteria 1727
236 Ga0207648_10002453 3300026089 Bacteria 19935
237 Ga0207648_10341136 3300026089 Bacteria 1349
238 Ga0207648_10633862 3300026089 Bacteria 987
239 Ga0207648_10675255 3300026089 Bacteria 956
240 Ga0207676_10077002 3300026095 Bacteria 2697
241 Ga0207674_10009899 3300026116 Bacteria 10845
242 Ga0207674_10427777 3300026116 Bacteria 1279
243 Ga0207675_100034079 3300026118 Bacteria 4745
244 Ga0207675_100093206 3300026118 Bacteria 2833
245 Ga0207675_100241285 3300026118 Bacteria 1746
246 Ga0207675_100522275 3300026118 Bacteria 1184
247 Ga0207698_10016390 3300026142 Bacteria 4992
248 Ga0207698_10410015 3300026142 Bacteria 1297
249 Ga0209971_1062249 3300027682 Bacteria 903
250 Ga0209998_10010920 3300027717 Bacteria 1880
251 Ga0207428_10351865 3300027907 Bacteria 1084
252 Ga0268266_10123172 3300028379 Bacteria 2310
253 Ga0268265_10230038 3300028380 Bacteria 1629
254 Ga0268265_10587631 3300028380 Unclassified 1062
255 Ga0268264_10092522 3300028381 Bacteria 2610
256 Ga0268264_10122126 3300028381 Bacteria 2297
257 Ga0265337_1015100 3300028556 Bacteria 2539
258 Ga0265326_10001281 3300028558 Bacteria 8924
259 Ga0265326_10060402 3300028558 Unclassified 1072
260 Ga0265319_1039484 3300028563 Bacteria 1600
261 Ga0265334_10003142 3300028573 Bacteria 7538
262 Ga0265318_10028399 3300028577 Bacteria 2188
263 Ga0265322_10030830 3300028654 Bacteria 1531
264 Ga0265322_10032948 3300028654 Bacteria 1477
265 Ga0265336_10011807 3300028666 Bacteria 2956
266 Ga0265338_10190313 3300028800 Bacteria 1556
267 Ga0265324_10021313 3300029957 Bacteria 2324
268 Ga0265324_10128422 3300029957 Unclassified 861
269 Ga0265330_10061054 3300031235 Bacteria 1640
270 Ga0265332_10009359 3300031238 Bacteria 4375
271 Ga0265328_10007515 3300031239 Bacteria 4539
272 Ga0265320_10045175 3300031240 Bacteria 2165
273 Ga0265320_10118983 3300031240 Bacteria 1206
274 Ga0265325_10177323 3300031241 Bacteria 994
275 Ga0265329_10058780 3300031242 Bacteria 1217
276 Ga0265329_10105173 3300031242 Bacteria 900
277 Ga0265340_10009255 3300031247 Bacteria 5290
278 Ga0265339_10022395 3300031249 Bacteria 3662
279 Ga0265316_10041768 3300031344 Bacteria 3668
280 Ga0265316_10055139 3300031344 Bacteria 3110
281 Ga0307408_100529703 3300031548 Bacteria 1036
282 Ga0265313_10015313 3300031595 Bacteria 4474
283 Ga0265314_10000951 3300031711 Bacteria 34010
284 Ga0265314_10082067 3300031711 Bacteria 2122
285 Ga0265314_10222421 3300031711 Bacteria 1101
286 Ga0265342_10095867 3300031712 Bacteria 1695
287 Ga0307405_10217975 3300031731 Bacteria 1398
288 Ga0307413_10488711 3300031824 Bacteria 986
289 Ga0307406_10737386 3300031901 Unclassified 826
290 Ga0307407_10187144 3300031903 Unclassified 1377
291 Ga0307409_100399599 3300031995 Unclassified 1312
292 Ga0307416_100095884 3300032002 Bacteria 2563
293 Ga0307416_101333840 3300032002 Unclassified 823
294 Ga0307416_101835249 3300032002 Bacteria 710
295 Ga0307414_10199860 3300032004 Bacteria 1625
296 Ga0307411_10126667 3300032005 Bacteria 1859
297 Ga0307415_100242195 3300032126 Bacteria 1459
298 Ga0373961_0070958 3300035241 Bacteria 1077
299 Ga0373931_0055582 3300035691 Bacteria 2119
300 Ga0373947_0429745 3300035725 Bacteria 893
301 Ga0373947_0644061 3300035725 Bacteria 723
302 Ga0373925_0509435 3300037068 Bacteria 988
303 Ga0395905_0499419 3300037471 Unclassified 1117
304 Ga0395901_0276428 3300038443 Bacteria 1746
305 Ga0439465_0078315 3300041413 Bacteria 1117
306 Ga0451853_2539212 3300041512 Bacteria 821
307 Ga0450910_028033 3300042147 Bacteria 875
308 Ga0466967_0629401 3300045976 Bacteria 1060
309 Ga0495596_0200105 3300046500 Bacteria 776
310 Ga0495630_0475802 3300046517 Unclassified 958
311 Ga0495659_0310529 3300046664 Bacteria 668
312 Ga0495604_0494475 3300047317 Unclassified 794
313 Ga0495680_0255491 3300047322 Unclassified 1241
314 Ga0495675_0138190 3300047444 Bacteria 1512
315 Ga0495602_0296761 3300048088 Bacteria 1184
316 Ga0496100_0857169 3300048903 Unclassified 713
317 Ga0496102_0098955 3300048905 Bacteria 2707
318 Ga0496102_0254694 3300048905 Bacteria 1655
319 Ga0496103_0020538 3300048906 Bacteria 3968
320 Ga0496104_0023813 3300048907 Bacteria 5630
321 Ga0496104_0137660 3300048907 Bacteria 2346
322 Ga0496104_0949273 3300048907 Unclassified 764
323 Ga0496105_0164183 3300048908 Bacteria 1822
324 Ga0496106_0083018 3300048909 Unclassified 2464
325 Ga0496107_0095856 3300048910 Bacteria 2171
326 Ga0496108_0007105 3300048911 Bacteria 9069
327 Ga0496108_0045070 3300048911 Bacteria 3682
328 Ga0496109_0002739 3300048912 Bacteria 14777
329 Ga0496109_0077981 3300048912 Bacteria 3049
330 Ga0496109_0128160 3300048912 Bacteria 2367
331 Ga0496110_0226554 3300048913 Bacteria 1700
332 Ga0496111_0004110 3300048914 Bacteria 9137
333 Ga0496111_0037540 3300048914 Bacteria 3467
334 Ga0496111_0045449 3300048914 Bacteria 3160
335 Ga0496111_0093734 3300048914 Bacteria 2202
336 Ga0496112_0085172 3300048915 Bacteria 3127
337 Ga0496112_0154556 3300048915 Bacteria 2261
338 Ga0496112_0266323 3300048915 Bacteria 1662
339 Ga0496112_0385996 3300048915 Bacteria 1341
340 Ga0496113_0003174 3300048916 Bacteria 9787
341 Ga0496113_0038100 3300048916 Unclassified 3533
342 Ga0496113_0110227 3300048916 Bacteria 2141
343 Ga0496114_0078072 3300048917 Bacteria 2793
344 Ga0496114_0100613 3300048917 Bacteria 2467
345 Ga0496114_0314624 3300048917 Bacteria 1383
346 Ga0501031_0046398 3300049568 Bacteria 2833
347 Ga0501031_0088484 3300049568 Bacteria 2019
348 Ga0501031_0264026 3300049568 Bacteria 1118
349 Ga0501032_0300816 3300049569 Bacteria 1037
350 Ga0501033_0263041 3300049570 Bacteria 1221
351 Ga0501033_0331517 3300049570 Bacteria 1068
352 Ga0501036_0069454 3300049572 Bacteria 2980
353 Ga0501036_0487101 3300049572 Unclassified 1026
354 Ga0501038_0045993 3300049574 Bacteria 3786
355 Ga0501038_0140055 3300049574 Bacteria 1980
356 Ga0501038_0303655 3300049574 Bacteria 1252
357 Ga0501039_0058782 3300049575 Bacteria 2979
358 Ga0501039_0221742 3300049575 Bacteria 1486
359 Ga0501039_0250786 3300049575 Bacteria 1392
360 Ga0501040_0060053 3300049576 Bacteria 2612
361 Ga0501040_0107003 3300049576 Bacteria 1954
362 Ga0501041_0009800 3300049577 Bacteria 5639
363 Ga0501041_0028371 3300049577 Bacteria 3376
364 Ga0501041_0247929 3300049577 Bacteria 1119
365 Ga0501042_0103244 3300049578 Bacteria 2051
366 Ga0501042_0586003 3300049578 Bacteria 811
367 Ga0501046_0163475 3300049580 Bacteria 1673
368 Ga0501046_0215101 3300049580 Bacteria 1425
369 Ga0501048_0032119 3300049582 Bacteria 3796
370 Ga0501048_0163590 3300049582 Bacteria 1575
371 Ga0501068_0036074 3300049584 Bacteria 2955
372 Ga0501069_0015429 3300049585 Bacteria 4094
373 Ga0501070_0729456 3300049586 Unclassified 782
374 Ga0501071_0015219 3300049587 Bacteria 5278
375 Ga0501071_0331771 3300049587 Unclassified 1156
376 Ga0501071_0830621 3300049587 Unclassified 712
377 Ga0501072_0006111 3300049588 Bacteria 9186
378 Ga0501072_0026751 3300049588 Bacteria 4500
379 Ga0501072_0139035 3300049588 Bacteria 1936
380 Ga0501073_0182759 3300049589 Bacteria 1451
381 Ga0501074_0092288 3300049590 Bacteria 2168
382 Ga0501074_0120556 3300049590 Bacteria 1876
383 Ga0501074_0128797 3300049590 Bacteria 1811
384 Ga0501074_0134754 3300049590 Bacteria 1767
385 Ga0501075_0094361 3300049591 Bacteria 2271
386 Ga0501075_0116197 3300049591 Bacteria 2034
387 Ga0501075_0180107 3300049591 Bacteria 1612
388 Ga0501075_0200835 3300049591 Bacteria 1520
389 Ga0501075_0631857 3300049591 Unclassified 816
390 Ga0501076_0021284 3300049592 Bacteria 4973
391 Ga0501076_0115116 3300049592 Bacteria 2176
392 Ga0501076_0202914 3300049592 Bacteria 1619
393 Ga0501076_0213180 3300049592 Bacteria 1578
394 Ga0501076_0217540 3300049592 Bacteria 1561
395 Ga0501076_0312424 3300049592 Unclassified 1289
396 Ga0501077_0040650 3300049593 Bacteria 2962
397 Ga0501077_0279270 3300049593 Bacteria 1063
398 Ga0501077_0567847 3300049593 Unclassified 728
399 Ga0501079_0029839 3300049741 Bacteria 4189
400 Ga0501079_0036536 3300049741 Bacteria 3784
401 Ga0501079_0198920 3300049741 Bacteria 1565
402 Ga0501079_0254580 3300049741 Bacteria 1372
403 Ga0501079_0544026 3300049741 Bacteria 913
404 Ga0501080_0116805 3300049742 Bacteria 2473
405 Ga0501080_0161467 3300049742 Bacteria 2069
406 Ga0501080_0165296 3300049742 Bacteria 2042
407 Ga0501080_1328694 3300049742 Unclassified 615
408 Ga0501081_0021813 3300049743 Bacteria 4278
409 Ga0501081_0069104 3300049743 Bacteria 2460
410 Ga0501081_0317679 3300049743 Bacteria 1144
411 Ga0501081_0320282 3300049743 Bacteria 1139
412 Ga0501083_0150322 3300049744 Bacteria 1525
413 Ga0501083_0155745 3300049744 Bacteria 1496
414 Ga0501035_0197689 3300049822 Bacteria 1726
415 Ga0501035_0303230 3300049822 Bacteria 1345
416 Ga0501035_0382405 3300049822 Unclassified 1174
417 Ga0501035_1029852 3300049822 Bacteria 646
418 Ga0501044_0369969 3300049823 Bacteria 1350
419 Ga0501044_0680916 3300049823 Bacteria 915
420 Ga0501045_0005291 3300049824 Bacteria 8939
421 Ga0501045_0028604 3300049824 Bacteria 4022
422 Ga0501045_0090186 3300049824 Bacteria 2265
423 nmdc:mga05p37_218877_c1 3300050507 Bacteria 2299
424 nmdc:mga05p37_32227_c2 3300050507 Bacteria 3366
425 nmdc:mga05p37_900601_c1 3300050507 Bacteria 954
426 nmdc:mga08y16_30731_c1 3300050511 Bacteria 5648
427 nmdc:mga0n895_1185995_c1 3300050512 Bacteria 738
428 nmdc:mga0n895_28919_c1 3300050512 Bacteria 5278
429 nmdc:mga0rr50_611803_c1 3300050513 Bacteria 929
430 nmdc:mga0a205_228868_c1 3300050515 Bacteria 1743
431 nmdc:mga0a205_32788_c1 3300050515 Bacteria 4979
432 nmdc:mga0a205_846609_c1 3300050515 Unclassified 762
433 Ga0495612_0007807 3300053078 Bacteria 4365
434 Ga0501084_0047456 3300054114 Bacteria 3597
435 Ga0501084_0069465 3300054114 Bacteria 2949
436 Ga0501084_0192969 3300054114 Bacteria 1718
437 Ga0501084_0341816 3300054114 Unclassified 1264
438 Ga0590075_008398 3300059424 Bacteria 2466
439 Ga0590077_016578 3300059426 Bacteria 1547
440 Ga0501082_0099256 3300060353 Bacteria 2517
441 Ga0501082_0300133 3300060353 Bacteria 1399
442 Ga0501082_0499368 3300060353 Unclassified 1063
443 Ga0501082_1190059 3300060353 Unclassified 666
444 Ga0530510_0001239 3300061734 Bacteria 17030
445 Ga0530510_0062297 3300061734 Bacteria 2700
446 Ga0530510_0110486 3300061734 Bacteria 2013
447 Ga0530510_0331209 3300061734 Bacteria 1142
448 Ga0068857_100163911
449 JGI25406J46586_10036184
450 Ga0070683_100232577
451 Ga0070683_100353766
452 Ga0070683_101090272
453 Ga0070690_100119870
454 Ga0070670_100008236
455 Ga0070670_100412976
456 Ga0068869_100037608
457 Ga0070666_10890301
458 Ga0070680_100186953
459 Ga0068868_100054827
460 Ga0070660_100013653
461 Ga0070689_100256068
462 Ga0070687_100087085
463 Ga0070687_100550978
464 Ga0070692_10312826
465 Ga0070668_100116690
466 Ga0070669_100215798
467 Ga0070675_100012075
468 Ga0070675_100060837
469 Ga0070674_100021070
470 Ga0070673_100086049
471 Ga0070688_100019366
472 Ga0070659_100020159
473 Ga0070659_100806358
474 Ga0070710_10176405
475 Ga0070710_10871510
476 Ga0070701_10001804
477 Ga0070705_100021590
478 Ga0070705_100137963
479 Ga0070700_100008954
480 Ga0070700_100382559
481 Ga0070694_100010216
482 Ga0070694_100166932
483 Ga0070708_100032333
484 Ga0070708_100187231
485 Ga0070708_100198349
486 Ga0070708_100292450
487 Ga0070708_100988643
488 Ga0070663_100371288
489 Ga0070663_100807731
490 Ga0070662_100001489
491 Ga0070662_100125279
492 Ga0070662_100463553
493 Ga0070681_10042979
494 Ga0068867_100232128
495 Ga0070685_10011745
496 Ga0070706_100001506
497 Ga0070706_100020608
498 Ga0070706_100037338
499 Ga0070706_100443191
500 Ga0070707_100000802
501 Ga0070707_100001085
502 Ga0070707_100011344
503 Ga0070698_100021556
504 Ga0070698_100039727
505 Ga0070698_100066506
506 Ga0070698_100819385
507 Ga0070699_100000974
508 Ga0070699_100044669
509 Ga0070699_100270573
510 Ga0070699_100375636
511 Ga0070679_100152181
512 Ga0070679_100220694
513 Ga0070684_100067823
514 Ga0070684_101083147
515 Ga0070697_100009837
516 Ga0070697_100172636
517 Ga0070697_100175390
518 Ga0070697_100277211
519 Ga0070697_100305517
520 Ga0070686_100692064
521 Ga0070695_100011691
522 Ga0070695_100012614
523 Ga0070695_100052563
524 Ga0070695_100524396
525 Ga0070696_100009907
526 Ga0070696_100014916
527 Ga0070696_100044312
528 Ga0070696_100172465
529 Ga0070696_100181899
530 Ga0070696_100428874
531 Ga0070693_100504159
532 Ga0070704_100026140
533 Ga0070704_100041964
534 Ga0070704_100082761
535 Ga0070704_100089212
536 Ga0070704_100452623
537 Ga0068855_100243899
538 Ga0068857_100249928
539 Ga0068854_100084780
540 Ga0068854_100217152
541 Ga0068852_100121308
542 Ga0068859_101471055
543 Ga0068864_100002582
544 Ga0068861_100009590
545 Ga0068870_10024895
546 Ga0068870_10405946
547 Ga0068863_100343732
548 Ga0068858_100012676
549 Ga0068858_100615639
550 Ga0068858_100893431
551 Ga0068860_100270376
552 Ga0068862_100023085
553 Ga0081539_10008675
554 Ga0070712_100436516
555 Ga0068871_100619082
556 Ga0075428_100247688
557 Ga0075428_100550986
558 Ga0075433_10224142
559 Ga0075433_10224419
560 Ga0075433_10227120
561 Ga0075433_10322244
562 Ga0075434_100204716
563 Ga0075434_100269019
564 Ga0075434_100407790
565 Ga0075434_100410622
566 Ga0068865_100134731
567 Ga0097620_101471173
568 Ga0075435_100353962
569 Ga0075435_100385804
570 Ga0105240_10965304
571 Ga0111539_10024002
572 Ga0111539_10047696
573 Ga0111539_10164881
574 Ga0111539_10501149
575 Ga0105245_10045451
576 Ga0105245_10115424
577 Ga0105245_10405047
578 Ga0105245_10919555
579 Ga0114129_10066098
580 Ga0114129_10092022
581 Ga0114129_10433492
582 Ga0105243_10007511
583 Ga0105243_10643725
584 Ga0105241_11082842
585 Ga0105242_10039309
586 Ga0105242_10676629
587 Ga0105248_10277653
588 Ga0105248_10506718
589 Ga0105237_10567642
590 Ga0105249_10006625
591 Ga0105249_10247296
592 Ga0105249_10385755
593 Ga0105249_11531026
594 Ga0105239_10050450
595 Ga0105239_10601074
596 Ga0105246_10042085
597 Ga0105246_10261535
598 Ga0157378_10072274
599 Ga0157378_10824447
600 Ga0163162_10583578
601 Ga0163162_10851263
602 Ga0163163_10128784
603 Ga0163163_10141841
604 Ga0163163_10185287
605 Ga0163163_10225802
606 Ga0163163_10456684
607 Ga0157380_10138818
608 Ga0157380_10159466
609 Ga0157380_10438402
610 Ga0157380_10582722
611 Ga0157380_10639874
612 Ga0157380_10885300
613 Ga0182008_10024869
614 Ga0157377_10000477
615 Ga0157377_10081876
616 Ga0157377_10227393
617 Ga0157377_10560557
618 Ga0157379_10026399
619 Ga0157379_10171982
620 Ga0157376_11452648
621 Ga0207653_10021738
622 Ga0207692_10031815
623 Ga0207647_10136218
624 Ga0207643_10004287
625 Ga0207643_10114529
626 Ga0207684_10000870
627 Ga0207684_10045070
628 Ga0207684_10097309
629 Ga0207684_10110488
630 Ga0207684_10435916
631 Ga0207693_10454111
632 Ga0207662_10000302
633 Ga0207662_10323935
634 Ga0207662_10333923
635 Ga0207662_10573311
636 Ga0207657_10043447
637 Ga0207652_10155631
638 Ga0207652_10348304
639 Ga0207652_10444679
640 Ga0207652_10612902
641 Ga0207646_10002298
642 Ga0207646_10006239
643 Ga0207646_10021043
644 Ga0207681_10548389
645 Ga0207694_10226741
646 Ga0207650_10362637
647 Ga0207650_10379411
648 Ga0207659_10090558
649 Ga0207687_10755547
650 Ga0207690_10088014
651 Ga0207706_10216585
652 Ga0207706_10358052
653 Ga0207686_10020251
654 Ga0207686_10073240
655 Ga0207709_10023042
656 Ga0207709_10417259
657 Ga0207670_10039638
658 Ga0207669_10034392
659 Ga0207669_10046178
660 Ga0207669_10346369
661 Ga0207704_10180463
662 Ga0207665_10422891
663 Ga0207691_10136331
664 Ga0207689_10276272
665 Ga0207689_10812512
666 Ga0207661_10728893
667 Ga0207679_10061109
668 Ga0207679_10335311
669 Ga0207667_10297860
670 Ga0207651_10073329
671 Ga0207651_10186792
672 Ga0207712_10287880
673 Ga0207668_10142490
674 Ga0207668_10343554
675 Ga0207640_10209277
676 Ga0207640_10471664
677 Ga0207677_10116932
678 Ga0207677_10158932
679 Ga0207678_10012627
680 Ga0207708_10203851
681 Ga0207708_10300129
682 Ga0207641_10228845
683 Ga0207648_10002453
684 Ga0207648_10341136
685 Ga0207648_10633862
686 Ga0207648_10675255
687 Ga0207676_10077002
688 Ga0207674_10009899
689 Ga0207674_10427777
690 Ga0207675_100034079
691 Ga0207675_100093206
692 Ga0207675_100241285
693 Ga0207675_100522275
694 Ga0207698_10016390
695 Ga0207698_10410015
696 Ga0209971_1062249
697 Ga0209998_10010920
698 Ga0207428_10351865
699 Ga0268266_10123172
700 Ga0268265_10230038
701 Ga0268265_10587631
702 Ga0268264_10092522
703 Ga0268264_10122126
704 Ga0265337_1015100
705 Ga0265326_10001281
706 Ga0265326_10060402
707 Ga0265319_1039484
708 Ga0265334_10003142
709 Ga0265318_10028399
710 Ga0265322_10030830
711 Ga0265322_10032948
712 Ga0265336_10011807
713 Ga0265338_10190313
714 Ga0265324_10021313
715 Ga0265324_10128422
716 Ga0265330_10061054
717 Ga0265332_10009359
718 Ga0265328_10007515
719 Ga0265320_10045175
720 Ga0265320_10118983
721 Ga0265325_10177323
722 Ga0265329_10058780
723 Ga0265329_10105173
724 Ga0265340_10009255
725 Ga0265339_10022395
726 Ga0265316_10041768
727 Ga0265316_10055139
728 Ga0307408_100529703
729 Ga0265313_10015313
730 Ga0265314_10000951
731 Ga0265314_10082067
732 Ga0265314_10222421
733 Ga0265342_10095867
734 Ga0307405_10217975
735 Ga0307413_10488711
736 Ga0307406_10737386
737 Ga0307407_10187144
738 Ga0307409_100399599
739 Ga0307416_100095884
740 Ga0307416_101333840
741 Ga0307416_101835249
742 Ga0307414_10199860
743 Ga0307411_10126667
744 Ga0307415_100242195
745 Ga0373961_0070958
746 Ga0373931_0055582
747 Ga0373947_0429745
748 Ga0373947_0644061
749 Ga0373925_0509435
750 Ga0395905_0499419
751 Ga0395901_0276428
752 Ga0439465_0078315
753 Ga0451853_2539212
754 Ga0450910_028033
755 Ga0466967_0629401
756 Ga0495596_0200105
757 Ga0495630_0475802
758 Ga0495659_0310529
759 Ga0495604_0494475
760 Ga0495680_0255491
761 Ga0495675_0138190
762 Ga0495602_0296761
763 Ga0496100_0857169
764 Ga0496102_0098955
765 Ga0496102_0254694
766 Ga0496103_0020538
767 Ga0496104_0023813
768 Ga0496104_0137660
769 Ga0496104_0949273
770 Ga0496105_0164183
771 Ga0496106_0083018
772 Ga0496107_0095856
773 Ga0496108_0007105
774 Ga0496108_0045070
775 Ga0496109_0002739
776 Ga0496109_0077981
777 Ga0496109_0128160
778 Ga0496110_0226554
779 Ga0496111_0004110
780 Ga0496111_0037540
781 Ga0496111_0045449
782 Ga0496111_0093734
783 Ga0496112_0085172
784 Ga0496112_0154556
785 Ga0496112_0266323
786 Ga0496112_0385996
787 Ga0496113_0003174
788 Ga0496113_0038100
789 Ga0496113_0110227
790 Ga0496114_0078072
791 Ga0496114_0100613
792 Ga0496114_0314624
793 Ga0501031_0046398
794 Ga0501031_0088484
795 Ga0501031_0264026
796 Ga0501032_0300816
797 Ga0501033_0263041
798 Ga0501033_0331517
799 Ga0501036_0069454
800 Ga0501036_0487101
801 Ga0501038_0045993
802 Ga0501038_0140055
803 Ga0501038_0303655
804 Ga0501039_0058782
805 Ga0501039_0221742
806 Ga0501039_0250786
807 Ga0501040_0060053
808 Ga0501040_0107003
809 Ga0501041_0009800
810 Ga0501041_0028371
811 Ga0501041_0247929
812 Ga0501042_0103244
813 Ga0501042_0586003
814 Ga0501046_0163475
815 Ga0501046_0215101
816 Ga0501048_0032119
817 Ga0501048_0163590
818 Ga0501068_0036074
819 Ga0501069_0015429
820 Ga0501070_0729456
821 Ga0501071_0015219
822 Ga0501071_0331771
823 Ga0501071_0830621
824 Ga0501072_0006111
825 Ga0501072_0026751
826 Ga0501072_0139035
827 Ga0501073_0182759
828 Ga0501074_0092288
829 Ga0501074_0120556
830 Ga0501074_0128797
831 Ga0501074_0134754
832 Ga0501075_0094361
833 Ga0501075_0116197
834 Ga0501075_0180107
835 Ga0501075_0200835
836 Ga0501075_0631857
837 Ga0501076_0021284
838 Ga0501076_0115116
839 Ga0501076_0202914
840 Ga0501076_0213180
841 Ga0501076_0217540
842 Ga0501076_0312424
843 Ga0501077_0040650
844 Ga0501077_0279270
845 Ga0501077_0567847
846 Ga0501079_0029839
847 Ga0501079_0036536
848 Ga0501079_0198920
849 Ga0501079_0254580
850 Ga0501079_0544026
851 Ga0501080_0116805
852 Ga0501080_0161467
853 Ga0501080_0165296
854 Ga0501080_1328694
855 Ga0501081_0021813
856 Ga0501081_0069104
857 Ga0501081_0317679
858 Ga0501081_0320282
859 Ga0501083_0150322
860 Ga0501083_0155745
861 Ga0501035_0197689
862 Ga0501035_0303230
863 Ga0501035_0382405
864 Ga0501035_1029852
865 Ga0501044_0369969
866 Ga0501044_0680916
867 Ga0501045_0005291
868 Ga0501045_0028604
869 Ga0501045_0090186
870 nmdc:mga05p37_218877_c1
871 nmdc:mga05p37_32227_c2
872 nmdc:mga05p37_900601_c1
873 nmdc:mga08y16_30731_c1
874 nmdc:mga0n895_1185995_c1
875 nmdc:mga0n895_28919_c1
876 nmdc:mga0rr50_611803_c1
877 nmdc:mga0a205_228868_c1
878 nmdc:mga0a205_32788_c1
879 nmdc:mga0a205_846609_c1
880 Ga0495612_0007807
881 Ga0501084_0047456
882 Ga0501084_0069465
883 Ga0501084_0192969
884 Ga0501084_0341816
885 Ga0590075_008398
886 Ga0590077_016578
887 Ga0501082_0099256
888 Ga0501082_0300133
889 Ga0501082_0499368
890 Ga0501082_1190059
891 Ga0530510_0001239
892 Ga0530510_0062297
893 Ga0530510_0110486
894 Ga0530510_0331209

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

19

129

0.92

PF08445

FR47

FR47-like protein

63

138

0.86

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

17

141

0.86

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

47

131

0.8

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

8

130

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5isv-assembly2.cif.gz_B crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli 0.9089 8 157
4pv6-assembly8.cif.gz_N crystal structure analysis of ard1 from thermoplasma volcanium 0.9089 9 155
4qvt-assembly5.cif.gz_H crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.9052 10 132
4qvt-assembly2.cif.gz_D crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.905 10 132
2cnt-assembly4.cif.gz_D rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea. 0.9039 8 155
ID Description Score Start End Superfamily
af_Q2FWL1_1_136_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9547 20 156 3.40.630.30
af_Q2FWL1_1_136_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9411 20 156 3.40.630.30
af_Q58925_1_145_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9403 10 152 3.40.630.30
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9346 60 100 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9219 107 150 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A833HQK6-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9935 7 152 GO:0005737
GO:0008999
AF-A0A358QZ38-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9935 14 152 GO:0005737
GO:0008999
GO:0016020
AF-A0A7C7A2I4-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9911 9 153 GO:0005737
GO:0005840
GO:0008999
AF-A0A847N7Z0-F1-model_v4 Ribosomal protein S18-alanine N-acetyltransferase 0.9875 6 152 GO:0005840
GO:0008080
AF-A0A1F7TMZ6-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase 0.9827 9 154 GO:0008080

Map