F445893

General Info

Members Datasets Scaffolds Average Seq Length
447 196 894 287

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100101075|Ga0070705_1001010752
Length 285
Sequence MKPLTLGRLRVSAVVERAGPTRPTWLLPDATPEAVERHREWLAPHFMDEKGRFLQSIHAFVIQAPGFTALVDTCVGNDKDRGGRAPFHMMQTTFLEDLKAAGVAPESVDLVVCTHLHVDHVGWNTRLDSGRWVPTFPRARHLFARREWEHWSSESSADDTKRIMADSVTPVLDAGLADLVAMDHRVSDEMWFEPTPGHTPGHVSVRLRAGGAEAVITGDLMHCPVQVAEPDWCSHFDSDPDQARKTRRAFCERYADTAVAVLGTHFHHPTAGRIVRHGPTWRFVT

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
132 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
133 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
134 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
135 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
143 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
144 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.57
Rhizosphere 98.43
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100101075 3300005440 Bacteria 1821
2 JGI25406J46586_10006346 3300003203 Bacteria 5455
3 Ga0070676_10003364 3300005328 Bacteria 8325
4 Ga0070670_100000405 3300005331 Bacteria 35470
5 Ga0068869_100000097 3300005334 Bacteria 40779
6 Ga0068869_100192631 3300005334 Unclassified 1604
7 Ga0070680_100000471 3300005336 Bacteria 27561
8 Ga0070680_100112153 3300005336 Bacteria 2271
9 Ga0070682_100000307 3300005337 Bacteria 33950
10 Ga0068868_100025280 3300005338 Bacteria 4515
11 Ga0070660_100000902 3300005339 Bacteria 19862
12 Ga0070689_100024060 3300005340 Bacteria 4567
13 Ga0070691_10005988 3300005341 Bacteria 5549
14 Ga0070691_10027357 3300005341 Bacteria 2661
15 Ga0070687_100022799 3300005343 Bacteria 2966
16 Ga0070661_100006119 3300005344 Bacteria 8283
17 Ga0070692_10000056 3300005345 Bacteria 21887
18 Ga0070668_100565749 3300005347 Bacteria 991
19 Ga0070669_100053850 3300005353 Bacteria 2946
20 Ga0070669_100212512 3300005353 Bacteria 1527
21 Ga0070659_100000270 3300005366 Bacteria 40752
22 Ga0070667_100158199 3300005367 Bacteria 1994
23 Ga0070703_10001078 3300005406 Bacteria 8494
24 Ga0070703_10009471 3300005406 Bacteria 2747
25 Ga0070703_10060662 3300005406 Bacteria 1237
26 Ga0070705_100000180 3300005440 Bacteria 36882
27 Ga0070700_100044089 3300005441 Bacteria 2745
28 Ga0070694_100000116 3300005444 Bacteria 38891
29 Ga0070694_100029173 3300005444 Bacteria 3598
30 Ga0070708_100037599 3300005445 Bacteria 4224
31 Ga0070708_100080618 3300005445 Bacteria 2945
32 Ga0070708_100127298 3300005445 Bacteria 2355
33 Ga0070708_100149779 3300005445 Bacteria 2169
34 Ga0070663_100002839 3300005455 Bacteria 9844
35 Ga0070662_100000635 3300005457 Bacteria 21249
36 Ga0070662_100032345 3300005457 Bacteria 3676
37 Ga0070681_10023378 3300005458 Bacteria 6215
38 Ga0068867_100078203 3300005459 Bacteria 2488
39 Ga0070706_100016134 3300005467 Bacteria 6898
40 Ga0070706_100033571 3300005467 Bacteria 4737
41 Ga0070706_100104029 3300005467 Bacteria 2640
42 Ga0070706_100111887 3300005467 Bacteria 2541
43 Ga0070706_100263793 3300005467 Bacteria 1608
44 Ga0070706_100302420 3300005467 Bacteria 1492
45 Ga0070707_100048016 3300005468 Bacteria 4088
46 Ga0070707_100068833 3300005468 Bacteria 3407
47 Ga0070707_100132361 3300005468 Bacteria 2426
48 Ga0070707_100136066 3300005468 Bacteria 2390
49 Ga0070707_100154176 3300005468 Bacteria 2237
50 Ga0070707_100188941 3300005468 Bacteria 2008
51 Ga0070698_100004229 3300005471 Bacteria 15783
52 Ga0070698_100006689 3300005471 Bacteria 12503
53 Ga0070698_100062598 3300005471 Bacteria 3753
54 Ga0070698_100117925 3300005471 Bacteria 2616
55 Ga0070698_100215053 3300005471 Bacteria 1856
56 Ga0070698_100274395 3300005471 Bacteria 1618
57 Ga0070699_100002198 3300005518 Bacteria 17645
58 Ga0070699_100010506 3300005518 Bacteria 8009
59 Ga0070679_100001552 3300005530 Bacteria 20534
60 Ga0070684_100052067 3300005535 Bacteria 3559
61 Ga0070697_100034755 3300005536 Bacteria 4064
62 Ga0070697_100036110 3300005536 Bacteria 3991
63 Ga0070697_100118051 3300005536 Bacteria 2216
64 Ga0068853_100000092 3300005539 Bacteria 61530
65 Ga0070695_100000460 3300005545 Bacteria 21193
66 Ga0070695_100001435 3300005545 Bacteria 13214
67 Ga0070695_100015255 3300005545 Bacteria 4636
68 Ga0070695_100103849 3300005545 Bacteria 1918
69 Ga0070696_100000132 3300005546 Bacteria 40213
70 Ga0070696_100071121 3300005546 Bacteria 2448
71 Ga0070696_100076759 3300005546 Bacteria 2359
72 Ga0070696_100162240 3300005546 Bacteria 1647
73 Ga0070696_100203562 3300005546 Bacteria 1479
74 Ga0070693_100000263 3300005547 Bacteria 24707
75 Ga0070693_100022435 3300005547 Bacteria 3357
76 Ga0070693_100172341 3300005547 Bacteria 1387
77 Ga0070704_100009671 3300005549 Bacteria 5841
78 Ga0070704_100084109 3300005549 Bacteria 2351
79 Ga0070704_100221521 3300005549 Bacteria 1538
80 Ga0068855_100000493 3300005563 Bacteria 48771
81 Ga0070664_100003829 3300005564 Bacteria 12149
82 Ga0068857_100014041 3300005577 Bacteria 6971
83 Ga0068857_100040021 3300005577 Bacteria 4156
84 Ga0068854_100003342 3300005578 Bacteria 9998
85 Ga0068856_100000198 3300005614 Bacteria 63839
86 Ga0068852_100064857 3300005616 Bacteria 3185
87 Ga0068859_100000460 3300005617 Bacteria 40339
88 Ga0068859_100249341 3300005617 Bacteria 1866
89 Ga0068859_100440630 3300005617 Bacteria 1399
90 Ga0068861_100005384 3300005719 Bacteria 8658
91 Ga0068861_100193506 3300005719 Bacteria 1702
92 Ga0068861_100622880 3300005719 Bacteria 993
93 Ga0068870_10000316 3300005840 Bacteria 17898
94 Ga0068870_10021489 3300005840 Bacteria 3157
95 Ga0068863_100081240 3300005841 Bacteria 3070
96 Ga0068858_100007874 3300005842 Bacteria 10272
97 Ga0068860_100054302 3300005843 Bacteria 3808
98 Ga0068860_100078574 3300005843 Bacteria 3137
99 Ga0068860_100390071 3300005843 Bacteria 1376
100 Ga0068862_100000785 3300005844 Bacteria 31460
101 Ga0068862_100005520 3300005844 Bacteria 10565
102 Ga0068862_100016565 3300005844 Bacteria 6137
103 Ga0068862_100057528 3300005844 Bacteria 3335
104 Ga0081455_10003031 3300005937 Bacteria 19578
105 Ga0081539_10000020 3300005985 Bacteria 366549
106 Ga0070716_100020805 3300006173 Bacteria 3448
107 Ga0075428_100000409 3300006844 Bacteria 42695
108 Ga0075428_100001496 3300006844 Bacteria 24994
109 Ga0075428_100083200 3300006844 Bacteria 3491
110 Ga0075430_100000648 3300006846 Bacteria 26549
111 Ga0075430_100006658 3300006846 Bacteria 9745
112 Ga0075430_100020820 3300006846 Bacteria 5576
113 Ga0075431_100000115 3300006847 Bacteria 51366
114 Ga0075431_100000728 3300006847 Bacteria 28423
115 Ga0075431_100008175 3300006847 Bacteria 10452
116 Ga0075431_100009651 3300006847 Bacteria 9695
117 Ga0075431_100020981 3300006847 Bacteria 6676
118 Ga0075431_100026771 3300006847 Bacteria 5914
119 Ga0075431_100064976 3300006847 Bacteria 3768
120 Ga0075431_100072949 3300006847 Bacteria 3542
121 Ga0075431_100080627 3300006847 Bacteria 3360
122 Ga0075431_100168523 3300006847 Bacteria 2251
123 Ga0075433_10000669 3300006852 Bacteria 23231
124 Ga0075433_10000948 3300006852 Bacteria 20482
125 Ga0075433_10010206 3300006852 Bacteria 7532
126 Ga0075433_10029884 3300006852 Bacteria 4645
127 Ga0075433_10075422 3300006852 Bacteria 2968
128 Ga0075433_10115585 3300006852 Bacteria 2380
129 Ga0075434_100025842 3300006871 Bacteria 5748
130 Ga0075434_100030509 3300006871 Bacteria 5309
131 Ga0075434_100032295 3300006871 Bacteria 5163
132 Ga0075434_100566119 3300006871 Bacteria 1156
133 Ga0075429_100000116 3300006880 Bacteria 45959
134 Ga0075429_100002059 3300006880 Bacteria 16755
135 Ga0075429_100006697 3300006880 Bacteria 9989
136 Ga0075429_100021611 3300006880 Bacteria 5578
137 Ga0075429_100100746 3300006880 Bacteria 2522
138 Ga0075436_100156915 3300006914 Bacteria 1603
139 Ga0097620_100000460 3300006931 Bacteria 40339
140 Ga0097620_100249365 3300006931 Bacteria 1866
141 Ga0097620_100440650 3300006931 Bacteria 1399
142 Ga0075435_100024258 3300007076 Bacteria 4704
143 Ga0075435_100028605 3300007076 Bacteria 4372
144 Ga0075435_100062296 3300007076 Bacteria 3027
145 Ga0075435_100075622 3300007076 Bacteria 2758
146 Ga0099794_10047828 3300007265 Bacteria 2052
147 Ga0111539_10002338 3300009094 Bacteria 25243
148 Ga0111539_10072572 3300009094 Bacteria 4059
149 Ga0105245_10065485 3300009098 Bacteria 3287
150 Ga0114129_10000541 3300009147 Bacteria 46363
151 Ga0114129_10000579 3300009147 Bacteria 45143
152 Ga0114129_10006799 3300009147 Bacteria 16238
153 Ga0114129_10007717 3300009147 Bacteria 15305
154 Ga0114129_10008727 3300009147 Bacteria 14450
155 Ga0114129_10036794 3300009147 Bacteria 6911
156 Ga0114129_10053997 3300009147 Bacteria 5634
157 Ga0114129_10067235 3300009147 Bacteria 4999
158 Ga0114129_10073027 3300009147 Bacteria 4780
159 Ga0114129_10094868 3300009147 Bacteria 4132
160 Ga0114129_10150944 3300009147 Bacteria 3180
161 Ga0114129_10249773 3300009147 Bacteria 2382
162 Ga0114129_10349377 3300009147 Bacteria 1959
163 Ga0114129_10514347 3300009147 Bacteria 1562
164 Ga0114129_10612375 3300009147 Bacteria 1410
165 Ga0105243_10062680 3300009148 Bacteria 2977
166 Ga0105243_10116475 3300009148 Bacteria 2245
167 Ga0105243_10688081 3300009148 Bacteria 995
168 Ga0105241_10000067 3300009174 Bacteria 79719
169 Ga0105241_10073289 3300009174 Bacteria 2663
170 Ga0105242_10048202 3300009176 Bacteria 3462
171 Ga0105242_10630629 3300009176 Bacteria 1040
172 Ga0105248_10309410 3300009177 Bacteria 1779
173 Ga0105237_10026655 3300009545 Bacteria 5907
174 Ga0105246_10037563 3300011119 Bacteria 3250
175 Ga0157373_10000417 3300013100 Bacteria 34189
176 Ga0157369_10051008 3300013105 Bacteria 4479
177 Ga0163162_10327457 3300013306 Bacteria 1664
178 Ga0157372_10000377 3300013307 Bacteria 49407
179 Ga0157372_10182905 3300013307 Bacteria 2427
180 Ga0157375_10042212 3300013308 Bacteria 4413
181 Ga0207653_10002930 3300025885 Bacteria 5418
182 Ga0207653_10104232 3300025885 Bacteria 1006
183 Ga0207645_10000478 3300025907 Bacteria 33059
184 Ga0207643_10000192 3300025908 Bacteria 42326
185 Ga0207643_10054450 3300025908 Bacteria 2274
186 Ga0207684_10000960 3300025910 Bacteria 32371
187 Ga0207684_10001301 3300025910 Bacteria 27465
188 Ga0207684_10008063 3300025910 Bacteria 9399
189 Ga0207684_10040611 3300025910 Bacteria 3944
190 Ga0207684_10084219 3300025910 Bacteria 2708
191 Ga0207684_10196037 3300025910 Bacteria 1742
192 Ga0207684_10263809 3300025910 Bacteria 1486
193 Ga0207654_10004153 3300025911 Bacteria 7301
194 Ga0207654_10046553 3300025911 Bacteria 2474
195 Ga0207707_10000124 3300025912 Bacteria 79966
196 Ga0207660_10000223 3300025917 Bacteria 36482
197 Ga0207660_10255581 3300025917 Bacteria 1384
198 Ga0207662_10009728 3300025918 Bacteria 5302
199 Ga0207657_10000049 3300025919 Bacteria 110963
200 Ga0207649_10007112 3300025920 Bacteria 6083
201 Ga0207652_10000551 3300025921 Bacteria 38041
202 Ga0207646_10001330 3300025922 Bacteria 30700
203 Ga0207646_10001461 3300025922 Bacteria 29246
204 Ga0207646_10002247 3300025922 Bacteria 22994
205 Ga0207646_10017455 3300025922 Bacteria 6715
206 Ga0207646_10162814 3300025922 Bacteria 2013
207 Ga0207646_10234428 3300025922 Bacteria 1658
208 Ga0207681_10030300 3300025923 Bacteria 3526
209 Ga0207690_10004705 3300025932 Bacteria 8057
210 Ga0207706_10001547 3300025933 Bacteria 22776
211 Ga0207706_10119083 3300025933 Bacteria 2322
212 Ga0207706_10141481 3300025933 Bacteria 2117
213 Ga0207709_10170543 3300025935 Unclassified 1527
214 Ga0207670_10022408 3300025936 Bacteria 3914
215 Ga0207665_10005462 3300025939 Bacteria 8482
216 Ga0207689_10000041 3300025942 Bacteria 93210
217 Ga0207679_10000244 3300025945 Bacteria 41582
218 Ga0207667_10006807 3300025949 Bacteria 13809
219 Ga0207712_10464434 3300025961 Bacteria 1076
220 Ga0207640_10007656 3300025981 Bacteria 5967
221 Ga0207639_10003147 3300026041 Bacteria 11095
222 Ga0207678_10010296 3300026067 Bacteria 8208
223 Ga0207708_10015970 3300026075 Bacteria 5638
224 Ga0207708_10268184 3300026075 Bacteria 1380
225 Ga0207702_10000908 3300026078 Bacteria 30723
226 Ga0207648_10112793 3300026089 Bacteria 2387
227 Ga0207648_10194948 3300026089 Bacteria 1796
228 Ga0207676_10009666 3300026095 Bacteria 6860
229 Ga0207674_10000492 3300026116 Bacteria 52003
230 Ga0207674_10015857 3300026116 Bacteria 8261
231 Ga0207675_100002438 3300026118 Bacteria 18425
232 Ga0207698_10102004 3300026142 Bacteria 2381
233 Ga0209968_1001696 3300027526 Bacteria 3330
234 Ga0209982_1002843 3300027552 Bacteria 2440
235 Ga0209983_1001578 3300027665 Bacteria 5049
236 Ga0209588_1019892 3300027671 Bacteria 2099
237 Ga0209971_1000086 3300027682 Bacteria 28580
238 Ga0209966_1000159 3300027695 Bacteria 28434
239 Ga0209998_10000025 3300027717 Bacteria 63698
240 Ga0209974_10002937 3300027876 Bacteria 6184
241 Ga0207428_10000063 3300027907 Bacteria 151868
242 Ga0207428_10293298 3300027907 Unclassified 1205
243 Ga0207428_10336539 3300027907 Bacteria 1112
244 Ga0268265_10019170 3300028380 Bacteria 4750
245 Ga0268265_10019270 3300028380 Bacteria 4738
246 Ga0268265_10042164 3300028380 Bacteria 3384
247 Ga0268264_10011296 3300028381 Bacteria 7376
248 Ga0307408_100078523 3300031548 Bacteria 2461
249 Ga0307408_100102873 3300031548 Bacteria 2179
250 Ga0307410_10034453 3300031852 Bacteria 3280
251 Ga0307406_10104191 3300031901 Bacteria 1939
252 Ga0307407_10151549 3300031903 Bacteria 1507
253 Ga0307412_10120360 3300031911 Bacteria 1889
254 Ga0307409_100351478 3300031995 Bacteria 1391
255 Ga0307416_100014036 3300032002 Bacteria 5468
256 Ga0307411_10024806 3300032005 Bacteria 3581
257 Ga0307415_100182225 3300032126 Bacteria 1649
258 Ga0373948_0020989 3300034817 Bacteria 1248
259 Ga0373929_0006229 3300035085 Bacteria 2154
260 Ga0373940_0007887 3300035088 Bacteria 2421
261 Ga0373949_0015999 3300035090 Bacteria 1680
262 Ga0373951_0025561 3300035091 Bacteria 1372
263 Ga0373941_0126473 3300035115 Bacteria 916
264 Ga0395899_0092303 3300037312 Bacteria 2193
265 Ga0395898_0110168 3300037466 Bacteria 2639
266 Ga0395905_0362361 3300037471 Bacteria 1342
267 Ga0395901_0085204 3300038443 Bacteria 3303
268 Ga0439448_0000977 3300042005 Bacteria 7097
269 Ga0439450_001039 3300042008 Bacteria 3911
270 Ga0439455_0016282 3300042012 Bacteria 1718
271 Ga0439459_0000056 3300042438 Bacteria 9287
272 Ga0439459_0024622 3300042438 Bacteria 1182
273 Ga0451577_0010353 3300042876 Bacteria 8923
274 Ga0451577_0011707 3300042876 Bacteria 8282
275 Ga0451577_0024310 3300042876 Bacteria 5512
276 Ga0451577_0089646 3300042876 Bacteria 2744
277 Ga0453683_0003814 3300044673 Bacteria 10968
278 Ga0453683_0006417 3300044673 Bacteria 8069
279 Ga0453684_0022539 3300044712 Bacteria 9336
280 Ga0453684_0138253 3300044712 Bacteria 2913
281 Ga0453684_0537680 3300044712 Bacteria 1289
282 Ga0451576_0017873 3300045051 Bacteria 7788
283 Ga0451576_0100218 3300045051 Bacteria 3012
284 Ga0451576_0180088 3300045051 Bacteria 2206
285 Ga0451576_0276143 3300045051 Bacteria 1757
286 Ga0495584_0133104 3300046491 Bacteria 1262
287 Ga0495642_0080396 3300046528 Unclassified 1372
288 Ga0495669_0207288 3300046684 Bacteria 938
289 Ga0496102_0054727 3300048905 Bacteria 3639
290 Ga0496102_0304628 3300048905 Bacteria 1502
291 Ga0496106_0037094 3300048909 Bacteria 3646
292 Ga0496107_0376580 3300048910 Bacteria 1056
293 Ga0496109_0340730 3300048912 Unclassified 1416
294 Ga0496110_0102094 3300048913 Bacteria 2572
295 Ga0496112_0008394 3300048915 Bacteria 9253
296 Ga0501031_0121433 3300049568 Bacteria 1707
297 Ga0501033_0361237 3300049570 Bacteria 1016
298 Ga0501036_0078571 3300049572 Bacteria 2791
299 Ga0501037_0065066 3300049573 Bacteria 2657
300 Ga0501038_0135161 3300049574 Bacteria 2021
301 Ga0501039_0009933 3300049575 Bacteria 7258
302 Ga0501039_0055507 3300049575 Bacteria 3068
303 Ga0501039_0321229 3300049575 Bacteria 1217
304 Ga0501040_0003789 3300049576 Bacteria 9808
305 Ga0501041_0002997 3300049577 Bacteria 9681
306 Ga0501041_0020256 3300049577 Bacteria 3975
307 Ga0501041_0113601 3300049577 Bacteria 1681
308 Ga0501042_0023379 3300049578 Bacteria 4325
309 Ga0501046_0001555 3300049580 Bacteria 21904
310 Ga0501046_0093811 3300049580 Bacteria 2307
311 Ga0501046_0158277 3300049580 Bacteria 1705
312 Ga0501047_0007515 3300049581 Bacteria 10257
313 Ga0501048_0000372 3300049582 Bacteria 31090
314 Ga0501048_0033551 3300049582 Bacteria 3708
315 Ga0501067_0038062 3300049583 Bacteria 2671
316 Ga0501068_0051897 3300049584 Bacteria 2482
317 Ga0501068_0071970 3300049584 Bacteria 2111
318 Ga0501070_0230850 3300049586 Bacteria 1516
319 Ga0501071_0004702 3300049587 Bacteria 8678
320 Ga0501071_0146204 3300049587 Bacteria 1762
321 Ga0501071_0148604 3300049587 Bacteria 1747
322 Ga0501071_0181679 3300049587 Bacteria 1576
323 Ga0501072_0001951 3300049588 Bacteria 15365
324 Ga0501072_0019392 3300049588 Bacteria 5256
325 Ga0501072_0025572 3300049588 Bacteria 4599
326 Ga0501072_0112438 3300049588 Bacteria 2168
327 Ga0501072_0119863 3300049588 Bacteria 2096
328 Ga0501072_0143087 3300049588 Bacteria 1907
329 Ga0501074_0001088 3300049590 Bacteria 17731
330 Ga0501074_0028977 3300049590 Bacteria 4011
331 Ga0501075_0006196 3300049591 Bacteria 8220
332 Ga0501075_0017683 3300049591 Bacteria 5149
333 Ga0501075_0024672 3300049591 Bacteria 4413
334 Ga0501075_0026301 3300049591 Bacteria 4283
335 Ga0501075_0092002 3300049591 Bacteria 2302
336 Ga0501075_0194347 3300049591 Bacteria 1548
337 Ga0501076_0006304 3300049592 Bacteria 8597
338 Ga0501076_0025727 3300049592 Bacteria 4556
339 Ga0501076_0060391 3300049592 Bacteria 3016
340 Ga0501076_0067287 3300049592 Bacteria 2860
341 Ga0501077_0030710 3300049593 Bacteria 3419
342 Ga0501077_0042455 3300049593 Bacteria 2891
343 Ga0501077_0049444 3300049593 Bacteria 2672
344 Ga0501077_0170608 3300049593 Bacteria 1382
345 Ga0501079_0001157 3300049741 Bacteria 18453
346 Ga0501079_0023904 3300049741 Bacteria 4688
347 Ga0501079_0025169 3300049741 Bacteria 4565
348 Ga0501079_0110927 3300049741 Bacteria 2131
349 Ga0501079_0118453 3300049741 Bacteria 2058
350 Ga0501079_0123218 3300049741 Bacteria 2016
351 Ga0501079_0212122 3300049741 Bacteria 1513
352 Ga0501080_0032694 3300049742 Bacteria 4853
353 Ga0501080_0177014 3300049742 Bacteria 1965
354 Ga0501080_0215192 3300049742 Bacteria 1760
355 Ga0501080_0227582 3300049742 Bacteria 1705
356 Ga0501080_0233227 3300049742 Bacteria 1682
357 Ga0501081_0000533 3300049743 Bacteria 21486
358 Ga0501081_0004539 3300049743 Bacteria 8913
359 Ga0501081_0017011 3300049743 Bacteria 4807
360 Ga0501081_0018792 3300049743 Bacteria 4591
361 Ga0501081_0099658 3300049743 Bacteria 2053
362 Ga0501081_0134775 3300049743 Bacteria 1767
363 Ga0501083_0009083 3300049744 Bacteria 7020
364 Ga0501035_0150913 3300049822 Bacteria 2017
365 Ga0501045_0000116 3300049824 Bacteria 40786
366 Ga0501045_0018570 3300049824 Bacteria 4947
367 Ga0501045_0075303 3300049824 Bacteria 2486
368 Ga0501045_0314501 3300049824 Bacteria 1165
369 nmdc:mga05p37_10296_c1 3300050507 Bacteria 11105
370 nmdc:mga05p37_10313_c1 3300050507 Bacteria 11096
371 nmdc:mga05p37_11625_c2 3300050507 Bacteria 9764
372 nmdc:mga05p37_142007_c1 3300050507 Bacteria 2941
373 nmdc:mga05p37_16691_c1 3300050507 Bacteria 8847
374 nmdc:mga05p37_4306_c1 3300050507 Bacteria 16620
375 nmdc:mga05p37_4708_c1 3300050507 Bacteria 15935
376 nmdc:mga05p37_55448_c1 3300050507 Bacteria 4159
377 nmdc:mga05p37_589815_c1 3300050507 Bacteria 1257
378 nmdc:mga05p37_6330_c1 3300050507 Bacteria 13945
379 nmdc:mga05p37_675926_c1 3300050507 Bacteria 1152
380 nmdc:mga05p37_702_c1 3300050507 Bacteria 37071
381 nmdc:mga05p37_76942_c1 3300050507 Bacteria 4108
382 nmdc:mga05p37_784169_c1 3300050507 Bacteria 1045
383 nmdc:mga05p37_99180_c1 3300050507 Bacteria 3588
384 nmdc:mga09592_116194_c1 3300050508 Bacteria 2296
385 nmdc:mga09592_265_c1 3300050508 Bacteria 38165
386 nmdc:mga09592_354331_c1 3300050508 Bacteria 1270
387 nmdc:mga09592_38365_c1 3300050508 Bacteria 4021
388 nmdc:mga09592_4027_c1 3300050508 Bacteria 11858
389 nmdc:mga09592_5248_c1 3300050508 Bacteria 10523
390 nmdc:mga09592_92363_c1 3300050508 Bacteria 2587
391 nmdc:mga0qj67_101353_c1 3300050509 Bacteria 2321
392 nmdc:mga0qj67_2490_c1 3300050509 Bacteria 13137
393 nmdc:mga0qj67_359380_c1 3300050509 Bacteria 1177
394 nmdc:mga0qj67_6600_c1 3300050509 Bacteria 8527
395 nmdc:mga0qj67_75626_c1 3300050509 Bacteria 2692
396 nmdc:mga06r32_131828_c1 3300050510 Bacteria 2472
397 nmdc:mga06r32_150222_c1 3300050510 Bacteria 2308
398 nmdc:mga06r32_229817_c1 3300050510 Bacteria 1843
399 nmdc:mga06r32_26143_c1 3300050510 Bacteria 5439
400 nmdc:mga06r32_41002_c1 3300050510 Bacteria 4397
401 nmdc:mga06r32_61503_c1 3300050510 Bacteria 3615
402 nmdc:mga06r32_63311_c1 3300050510 Bacteria 3565
403 nmdc:mga08y16_132036_c1 3300050511 Bacteria 2597
404 nmdc:mga08y16_50919_c1 3300050511 Bacteria 4333
405 nmdc:mga0n895_10405_c1 3300050512 Bacteria 8214
406 nmdc:mga0n895_19453_c1 3300050512 Bacteria 6313
407 nmdc:mga0n895_349378_c1 3300050512 Bacteria 1498
408 nmdc:mga0n895_398588_c1 3300050512 Bacteria 1392
409 nmdc:mga0n895_42046_c1 3300050512 Bacteria 4445
410 nmdc:mga0n895_56078_c1 3300050512 Bacteria 3881
411 nmdc:mga0n895_617943_c1 3300050512 Bacteria 1085
412 nmdc:mga0n895_8297_c1 3300050512 Bacteria 8985
413 nmdc:mga0rr50_20349_c1 3300050513 Bacteria 4504
414 nmdc:mga0rr50_259458_c1 3300050513 Bacteria 1446
415 nmdc:mga0rr50_446_c1 3300050513 Bacteria 22057
416 nmdc:mga0rr50_49690_c1 3300050513 Bacteria 3106
417 nmdc:mga08x19_164826_c1 3300050514 Bacteria 1507
418 nmdc:mga08x19_362470_c1 3300050514 Bacteria 1013
419 nmdc:mga08x19_67846_c1 3300050514 Bacteria 2321
420 nmdc:mga08x19_79434_c1 3300050514 Bacteria 2151
421 nmdc:mga0a205_1371_c1 3300050515 Bacteria 20576
422 nmdc:mga0a205_174853_c1 3300050515 Bacteria 2043
423 nmdc:mga0a205_19594_c1 3300050515 Bacteria 6382
424 nmdc:mga0a205_228345_c1 3300050515 Bacteria 1745
425 nmdc:mga0a205_2289_c1 3300050515 Bacteria 16890
426 nmdc:mga0a205_26287_c1 3300050515 Bacteria 5548
427 nmdc:mga0a205_9750_c1 3300050515 Bacteria 8798
428 Ga0501084_0004293 3300054114 Bacteria 11606
429 Ga0501084_0005963 3300054114 Bacteria 10029
430 Ga0501084_0051159 3300054114 Bacteria 3457
431 Ga0501084_0064742 3300054114 Bacteria 3059
432 Ga0501084_0237544 3300054114 Bacteria 1538
433 Ga0501082_0000316 3300060353 Bacteria 43097
434 Ga0501082_0021829 3300060353 Bacteria 5518
435 Ga0501082_0024728 3300060353 Bacteria 5178
436 Ga0501082_0025238 3300060353 Bacteria 5121
437 Ga0501082_0088542 3300060353 Bacteria 2671
438 Ga0501082_0116077 3300060353 Bacteria 2319
439 Ga0501082_0241114 3300060353 Bacteria 1573
440 Ga0530510_0009494 3300061734 Bacteria 6821
441 Ga0530510_0013645 3300061734 Bacteria 5717
442 Ga0530510_0019795 3300061734 Bacteria 4783
443 Ga0530510_0021493 3300061734 Bacteria 4590
444 Ga0530510_0030783 3300061734 Bacteria 3856
445 Ga0530510_0032811 3300061734 Bacteria 3737
446 Ga0530510_0099754 3300061734 Bacteria 2123
447 Ga0530510_0213106 3300061734 Bacteria 1435
448 Ga0070705_100101075
449 JGI25406J46586_10006346
450 Ga0070676_10003364
451 Ga0070670_100000405
452 Ga0068869_100000097
453 Ga0068869_100192631
454 Ga0070680_100000471
455 Ga0070680_100112153
456 Ga0070682_100000307
457 Ga0068868_100025280
458 Ga0070660_100000902
459 Ga0070689_100024060
460 Ga0070691_10005988
461 Ga0070691_10027357
462 Ga0070687_100022799
463 Ga0070661_100006119
464 Ga0070692_10000056
465 Ga0070668_100565749
466 Ga0070669_100053850
467 Ga0070669_100212512
468 Ga0070659_100000270
469 Ga0070667_100158199
470 Ga0070703_10001078
471 Ga0070703_10009471
472 Ga0070703_10060662
473 Ga0070705_100000180
474 Ga0070700_100044089
475 Ga0070694_100000116
476 Ga0070694_100029173
477 Ga0070708_100037599
478 Ga0070708_100080618
479 Ga0070708_100127298
480 Ga0070708_100149779
481 Ga0070663_100002839
482 Ga0070662_100000635
483 Ga0070662_100032345
484 Ga0070681_10023378
485 Ga0068867_100078203
486 Ga0070706_100016134
487 Ga0070706_100033571
488 Ga0070706_100104029
489 Ga0070706_100111887
490 Ga0070706_100263793
491 Ga0070706_100302420
492 Ga0070707_100048016
493 Ga0070707_100068833
494 Ga0070707_100132361
495 Ga0070707_100136066
496 Ga0070707_100154176
497 Ga0070707_100188941
498 Ga0070698_100004229
499 Ga0070698_100006689
500 Ga0070698_100062598
501 Ga0070698_100117925
502 Ga0070698_100215053
503 Ga0070698_100274395
504 Ga0070699_100002198
505 Ga0070699_100010506
506 Ga0070679_100001552
507 Ga0070684_100052067
508 Ga0070697_100034755
509 Ga0070697_100036110
510 Ga0070697_100118051
511 Ga0068853_100000092
512 Ga0070695_100000460
513 Ga0070695_100001435
514 Ga0070695_100015255
515 Ga0070695_100103849
516 Ga0070696_100000132
517 Ga0070696_100071121
518 Ga0070696_100076759
519 Ga0070696_100162240
520 Ga0070696_100203562
521 Ga0070693_100000263
522 Ga0070693_100022435
523 Ga0070693_100172341
524 Ga0070704_100009671
525 Ga0070704_100084109
526 Ga0070704_100221521
527 Ga0068855_100000493
528 Ga0070664_100003829
529 Ga0068857_100014041
530 Ga0068857_100040021
531 Ga0068854_100003342
532 Ga0068856_100000198
533 Ga0068852_100064857
534 Ga0068859_100000460
535 Ga0068859_100249341
536 Ga0068859_100440630
537 Ga0068861_100005384
538 Ga0068861_100193506
539 Ga0068861_100622880
540 Ga0068870_10000316
541 Ga0068870_10021489
542 Ga0068863_100081240
543 Ga0068858_100007874
544 Ga0068860_100054302
545 Ga0068860_100078574
546 Ga0068860_100390071
547 Ga0068862_100000785
548 Ga0068862_100005520
549 Ga0068862_100016565
550 Ga0068862_100057528
551 Ga0081455_10003031
552 Ga0081539_10000020
553 Ga0070716_100020805
554 Ga0075428_100000409
555 Ga0075428_100001496
556 Ga0075428_100083200
557 Ga0075430_100000648
558 Ga0075430_100006658
559 Ga0075430_100020820
560 Ga0075431_100000115
561 Ga0075431_100000728
562 Ga0075431_100008175
563 Ga0075431_100009651
564 Ga0075431_100020981
565 Ga0075431_100026771
566 Ga0075431_100064976
567 Ga0075431_100072949
568 Ga0075431_100080627
569 Ga0075431_100168523
570 Ga0075433_10000669
571 Ga0075433_10000948
572 Ga0075433_10010206
573 Ga0075433_10029884
574 Ga0075433_10075422
575 Ga0075433_10115585
576 Ga0075434_100025842
577 Ga0075434_100030509
578 Ga0075434_100032295
579 Ga0075434_100566119
580 Ga0075429_100000116
581 Ga0075429_100002059
582 Ga0075429_100006697
583 Ga0075429_100021611
584 Ga0075429_100100746
585 Ga0075436_100156915
586 Ga0097620_100000460
587 Ga0097620_100249365
588 Ga0097620_100440650
589 Ga0075435_100024258
590 Ga0075435_100028605
591 Ga0075435_100062296
592 Ga0075435_100075622
593 Ga0099794_10047828
594 Ga0111539_10002338
595 Ga0111539_10072572
596 Ga0105245_10065485
597 Ga0114129_10000541
598 Ga0114129_10000579
599 Ga0114129_10006799
600 Ga0114129_10007717
601 Ga0114129_10008727
602 Ga0114129_10036794
603 Ga0114129_10053997
604 Ga0114129_10067235
605 Ga0114129_10073027
606 Ga0114129_10094868
607 Ga0114129_10150944
608 Ga0114129_10249773
609 Ga0114129_10349377
610 Ga0114129_10514347
611 Ga0114129_10612375
612 Ga0105243_10062680
613 Ga0105243_10116475
614 Ga0105243_10688081
615 Ga0105241_10000067
616 Ga0105241_10073289
617 Ga0105242_10048202
618 Ga0105242_10630629
619 Ga0105248_10309410
620 Ga0105237_10026655
621 Ga0105246_10037563
622 Ga0157373_10000417
623 Ga0157369_10051008
624 Ga0163162_10327457
625 Ga0157372_10000377
626 Ga0157372_10182905
627 Ga0157375_10042212
628 Ga0207653_10002930
629 Ga0207653_10104232
630 Ga0207645_10000478
631 Ga0207643_10000192
632 Ga0207643_10054450
633 Ga0207684_10000960
634 Ga0207684_10001301
635 Ga0207684_10008063
636 Ga0207684_10040611
637 Ga0207684_10084219
638 Ga0207684_10196037
639 Ga0207684_10263809
640 Ga0207654_10004153
641 Ga0207654_10046553
642 Ga0207707_10000124
643 Ga0207660_10000223
644 Ga0207660_10255581
645 Ga0207662_10009728
646 Ga0207657_10000049
647 Ga0207649_10007112
648 Ga0207652_10000551
649 Ga0207646_10001330
650 Ga0207646_10001461
651 Ga0207646_10002247
652 Ga0207646_10017455
653 Ga0207646_10162814
654 Ga0207646_10234428
655 Ga0207681_10030300
656 Ga0207690_10004705
657 Ga0207706_10001547
658 Ga0207706_10119083
659 Ga0207706_10141481
660 Ga0207709_10170543
661 Ga0207670_10022408
662 Ga0207665_10005462
663 Ga0207689_10000041
664 Ga0207679_10000244
665 Ga0207667_10006807
666 Ga0207712_10464434
667 Ga0207640_10007656
668 Ga0207639_10003147
669 Ga0207678_10010296
670 Ga0207708_10015970
671 Ga0207708_10268184
672 Ga0207702_10000908
673 Ga0207648_10112793
674 Ga0207648_10194948
675 Ga0207676_10009666
676 Ga0207674_10000492
677 Ga0207674_10015857
678 Ga0207675_100002438
679 Ga0207698_10102004
680 Ga0209968_1001696
681 Ga0209982_1002843
682 Ga0209983_1001578
683 Ga0209588_1019892
684 Ga0209971_1000086
685 Ga0209966_1000159
686 Ga0209998_10000025
687 Ga0209974_10002937
688 Ga0207428_10000063
689 Ga0207428_10293298
690 Ga0207428_10336539
691 Ga0268265_10019170
692 Ga0268265_10019270
693 Ga0268265_10042164
694 Ga0268264_10011296
695 Ga0307408_100078523
696 Ga0307408_100102873
697 Ga0307410_10034453
698 Ga0307406_10104191
699 Ga0307407_10151549
700 Ga0307412_10120360
701 Ga0307409_100351478
702 Ga0307416_100014036
703 Ga0307411_10024806
704 Ga0307415_100182225
705 Ga0373948_0020989
706 Ga0373929_0006229
707 Ga0373940_0007887
708 Ga0373949_0015999
709 Ga0373951_0025561
710 Ga0373941_0126473
711 Ga0395899_0092303
712 Ga0395898_0110168
713 Ga0395905_0362361
714 Ga0395901_0085204
715 Ga0439448_0000977
716 Ga0439450_001039
717 Ga0439455_0016282
718 Ga0439459_0000056
719 Ga0439459_0024622
720 Ga0451577_0010353
721 Ga0451577_0011707
722 Ga0451577_0024310
723 Ga0451577_0089646
724 Ga0453683_0003814
725 Ga0453683_0006417
726 Ga0453684_0022539
727 Ga0453684_0138253
728 Ga0453684_0537680
729 Ga0451576_0017873
730 Ga0451576_0100218
731 Ga0451576_0180088
732 Ga0451576_0276143
733 Ga0495584_0133104
734 Ga0495642_0080396
735 Ga0495669_0207288
736 Ga0496102_0054727
737 Ga0496102_0304628
738 Ga0496106_0037094
739 Ga0496107_0376580
740 Ga0496109_0340730
741 Ga0496110_0102094
742 Ga0496112_0008394
743 Ga0501031_0121433
744 Ga0501033_0361237
745 Ga0501036_0078571
746 Ga0501037_0065066
747 Ga0501038_0135161
748 Ga0501039_0009933
749 Ga0501039_0055507
750 Ga0501039_0321229
751 Ga0501040_0003789
752 Ga0501041_0002997
753 Ga0501041_0020256
754 Ga0501041_0113601
755 Ga0501042_0023379
756 Ga0501046_0001555
757 Ga0501046_0093811
758 Ga0501046_0158277
759 Ga0501047_0007515
760 Ga0501048_0000372
761 Ga0501048_0033551
762 Ga0501067_0038062
763 Ga0501068_0051897
764 Ga0501068_0071970
765 Ga0501070_0230850
766 Ga0501071_0004702
767 Ga0501071_0146204
768 Ga0501071_0148604
769 Ga0501071_0181679
770 Ga0501072_0001951
771 Ga0501072_0019392
772 Ga0501072_0025572
773 Ga0501072_0112438
774 Ga0501072_0119863
775 Ga0501072_0143087
776 Ga0501074_0001088
777 Ga0501074_0028977
778 Ga0501075_0006196
779 Ga0501075_0017683
780 Ga0501075_0024672
781 Ga0501075_0026301
782 Ga0501075_0092002
783 Ga0501075_0194347
784 Ga0501076_0006304
785 Ga0501076_0025727
786 Ga0501076_0060391
787 Ga0501076_0067287
788 Ga0501077_0030710
789 Ga0501077_0042455
790 Ga0501077_0049444
791 Ga0501077_0170608
792 Ga0501079_0001157
793 Ga0501079_0023904
794 Ga0501079_0025169
795 Ga0501079_0110927
796 Ga0501079_0118453
797 Ga0501079_0123218
798 Ga0501079_0212122
799 Ga0501080_0032694
800 Ga0501080_0177014
801 Ga0501080_0215192
802 Ga0501080_0227582
803 Ga0501080_0233227
804 Ga0501081_0000533
805 Ga0501081_0004539
806 Ga0501081_0017011
807 Ga0501081_0018792
808 Ga0501081_0099658
809 Ga0501081_0134775
810 Ga0501083_0009083
811 Ga0501035_0150913
812 Ga0501045_0000116
813 Ga0501045_0018570
814 Ga0501045_0075303
815 Ga0501045_0314501
816 nmdc:mga05p37_10296_c1
817 nmdc:mga05p37_10313_c1
818 nmdc:mga05p37_11625_c2
819 nmdc:mga05p37_142007_c1
820 nmdc:mga05p37_16691_c1
821 nmdc:mga05p37_4306_c1
822 nmdc:mga05p37_4708_c1
823 nmdc:mga05p37_55448_c1
824 nmdc:mga05p37_589815_c1
825 nmdc:mga05p37_6330_c1
826 nmdc:mga05p37_675926_c1
827 nmdc:mga05p37_702_c1
828 nmdc:mga05p37_76942_c1
829 nmdc:mga05p37_784169_c1
830 nmdc:mga05p37_99180_c1
831 nmdc:mga09592_116194_c1
832 nmdc:mga09592_265_c1
833 nmdc:mga09592_354331_c1
834 nmdc:mga09592_38365_c1
835 nmdc:mga09592_4027_c1
836 nmdc:mga09592_5248_c1
837 nmdc:mga09592_92363_c1
838 nmdc:mga0qj67_101353_c1
839 nmdc:mga0qj67_2490_c1
840 nmdc:mga0qj67_359380_c1
841 nmdc:mga0qj67_6600_c1
842 nmdc:mga0qj67_75626_c1
843 nmdc:mga06r32_131828_c1
844 nmdc:mga06r32_150222_c1
845 nmdc:mga06r32_229817_c1
846 nmdc:mga06r32_26143_c1
847 nmdc:mga06r32_41002_c1
848 nmdc:mga06r32_61503_c1
849 nmdc:mga06r32_63311_c1
850 nmdc:mga08y16_132036_c1
851 nmdc:mga08y16_50919_c1
852 nmdc:mga0n895_10405_c1
853 nmdc:mga0n895_19453_c1
854 nmdc:mga0n895_349378_c1
855 nmdc:mga0n895_398588_c1
856 nmdc:mga0n895_42046_c1
857 nmdc:mga0n895_56078_c1
858 nmdc:mga0n895_617943_c1
859 nmdc:mga0n895_8297_c1
860 nmdc:mga0rr50_20349_c1
861 nmdc:mga0rr50_259458_c1
862 nmdc:mga0rr50_446_c1
863 nmdc:mga0rr50_49690_c1
864 nmdc:mga08x19_164826_c1
865 nmdc:mga08x19_362470_c1
866 nmdc:mga08x19_67846_c1
867 nmdc:mga08x19_79434_c1
868 nmdc:mga0a205_1371_c1
869 nmdc:mga0a205_174853_c1
870 nmdc:mga0a205_19594_c1
871 nmdc:mga0a205_228345_c1
872 nmdc:mga0a205_2289_c1
873 nmdc:mga0a205_26287_c1
874 nmdc:mga0a205_9750_c1
875 Ga0501084_0004293
876 Ga0501084_0005963
877 Ga0501084_0051159
878 Ga0501084_0064742
879 Ga0501084_0237544
880 Ga0501082_0000316
881 Ga0501082_0021829
882 Ga0501082_0024728
883 Ga0501082_0025238
884 Ga0501082_0088542
885 Ga0501082_0116077
886 Ga0501082_0241114
887 Ga0530510_0009494
888 Ga0530510_0013645
889 Ga0530510_0019795
890 Ga0530510_0021493
891 Ga0530510_0030783
892 Ga0530510_0032811
893 Ga0530510_0099754
894 Ga0530510_0213106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

52

265

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4le6-assembly1.cif.gz_A-2 crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes 0.8684 2 286
7y7u-assembly1.cif.gz_B dimeric structure of a quorum-quenching metallo-hydrolase, lrsl 0.863 3 286
4le6-assembly3.cif.gz_E crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes 0.858 2 287
4o98-assembly1.cif.gz_A crystal structure of pseudomonas oleovorans pooph mutant h250i/i263w 0.8508 3 286
4le6-assembly2.cif.gz_C crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes 0.8477 3 287
ID Description Score Start End Superfamily
4le6E00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.858 2 287 3.60.15.10
6c2cA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8411 3 287 3.60.15.10
4xukA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.826 3 287 3.60.15.10
4zo2A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8157 2 287 3.60.15.10
4zo2A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8105 2 287 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A359GY81-F1-model_v4 MBL fold metallo-hydrolase 0.9796 105 284 GO:0016787
AF-A0A7V3XIS1-F1-model_v4 MBL fold metallo-hydrolase 0.9756 1 286 GO:0016787
AF-A0A521Y1K5-F1-model_v4 MBL fold metallo-hydrolase 0.9756 111 284 GO:0016787
AF-A0A359GY81-F1-model_v4 MBL fold metallo-hydrolase 0.969 105 284 GO:0016787
AF-A0A2N3E445-F1-model_v4 MBL fold metallo-hydrolase 0.9689 177 284 GO:0016787

Map