F445832

General Info

Members Datasets Scaffolds Average Seq Length
446 207 892 247

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0289145|Ga0501084_0289145_116_853
Length 235
Sequence VRLKLTLEYDGTDFHGWARQPGRRTVEGEVRAALDRVFPRWDGLAVAGRTDAGVHATGQVVSVDVEGGPPPAHAAEALNTVLPADVAAVAASEALAGFHARFSATARSYRYVVLTRRERAPLERRRALWWPRPVDLPGGHDFRAFTPTETQHEVFRRDVRAAAWERRGDRLDFTITADSFLRHMVRTLVGTMLERGADGLAELLAGRPRADAGATAPPWGLYLERVDYDDPPADA

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
139 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
140 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
141 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
142 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
145 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
146 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
147 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
148 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.26
Rhizosphere 95.52
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0289145 3300054114 Bacteria 1384
2 JGI25406J46586_10013766 3300003203 Bacteria 3459
3 Ga0070658_10028535 3300005327 Bacteria 4481
4 Ga0070676_10043613 3300005328 Bacteria 2607
5 Ga0070683_100190409 3300005329 Bacteria 1948
6 Ga0070683_100745074 3300005329 Bacteria 939
7 Ga0070670_100127228 3300005331 Bacteria 2199
8 Ga0068869_100053477 3300005334 Bacteria 2936
9 Ga0070680_100341437 3300005336 Bacteria 1272
10 Ga0070682_100004123 3300005337 Bacteria 8062
11 Ga0068868_100004540 3300005338 Bacteria 9743
12 Ga0068868_100104794 3300005338 Bacteria 2292
13 Ga0068868_100643587 3300005338 Bacteria 943
14 Ga0070660_100162993 3300005339 Bacteria 1797
15 Ga0070691_10021687 3300005341 Bacteria 2973
16 Ga0070691_10066139 3300005341 Bacteria 1747
17 Ga0070687_100125334 3300005343 Bacteria 1475
18 Ga0070661_100170092 3300005344 Bacteria 1654
19 Ga0070692_10006211 3300005345 Bacteria 5170
20 Ga0070692_10066207 3300005345 Bacteria 1914
21 Ga0070675_100015656 3300005354 Bacteria 6001
22 Ga0070675_100049200 3300005354 Bacteria 3459
23 Ga0070675_100370294 3300005354 Bacteria 1273
24 Ga0070671_100392457 3300005355 Bacteria 1187
25 Ga0070674_100215224 3300005356 Bacteria 1492
26 Ga0070673_100020991 3300005364 Bacteria 4723
27 Ga0070688_100007487 3300005365 Bacteria 5889
28 Ga0070659_100060551 3300005366 Bacteria 2990
29 Ga0070659_100084731 3300005366 Bacteria 2534
30 Ga0070701_10005670 3300005438 Bacteria 5185
31 Ga0070700_100028382 3300005441 Bacteria 3328
32 Ga0070700_100061561 3300005441 Bacteria 2368
33 Ga0070663_100115903 3300005455 Bacteria 2019
34 Ga0070663_100159386 3300005455 Bacteria 1736
35 Ga0070678_100011091 3300005456 Bacteria 5541
36 Ga0070678_100285854 3300005456 Bacteria 1396
37 Ga0070662_100014361 3300005457 Bacteria 5288
38 Ga0070681_10081330 3300005458 Bacteria 3195
39 Ga0070681_10118274 3300005458 Bacteria 2587
40 Ga0068867_100035412 3300005459 Bacteria 3620
41 Ga0068867_100154582 3300005459 Bacteria 1804
42 Ga0070706_100281607 3300005467 Bacteria 1552
43 Ga0070679_100038792 3300005530 Bacteria 4736
44 Ga0070679_100138500 3300005530 Bacteria 2414
45 Ga0070684_100078445 3300005535 Bacteria 2918
46 Ga0070684_100108315 3300005535 Bacteria 2489
47 Ga0070684_100251749 3300005535 Bacteria 1614
48 Ga0070684_100552599 3300005535 Bacteria 1068
49 Ga0068853_100013587 3300005539 Bacteria 6652
50 Ga0068853_100019004 3300005539 Bacteria 5694
51 Ga0068853_100150498 3300005539 Bacteria 2095
52 Ga0068853_100186833 3300005539 Bacteria 1881
53 Ga0070686_100155014 3300005544 Bacteria 1607
54 Ga0070693_100020460 3300005547 Bacteria 3490
55 Ga0070693_100132733 3300005547 Bacteria 1559
56 Ga0070665_100046133 3300005548 Bacteria 4377
57 Ga0068855_100422458 3300005563 Bacteria 1458
58 Ga0070664_100025906 3300005564 Bacteria 4862
59 Ga0070664_100094304 3300005564 Bacteria 2595
60 Ga0070664_100237297 3300005564 Bacteria 1636
61 Ga0068854_100036173 3300005578 Bacteria 3460
62 Ga0068854_100047405 3300005578 Bacteria 3062
63 Ga0068854_100095354 3300005578 Bacteria 2221
64 Ga0068856_100401277 3300005614 Bacteria 1391
65 Ga0070702_100018234 3300005615 Bacteria 3637
66 Ga0070702_100039276 3300005615 Bacteria 2640
67 Ga0068852_100218797 3300005616 Bacteria 1810
68 Ga0068852_100632474 3300005616 Bacteria 1076
69 Ga0068859_100018516 3300005617 Bacteria 6998
70 Ga0068864_100435123 3300005618 Bacteria 1252
71 Ga0068866_10125229 3300005718 Bacteria 1453
72 Ga0068861_100121538 3300005719 Bacteria 2107
73 Ga0068861_100199504 3300005719 Bacteria 1678
74 Ga0068851_10044438 3300005834 Bacteria 2242
75 Ga0068851_10044694 3300005834 Bacteria 2237
76 Ga0068870_10180274 3300005840 Bacteria 1267
77 Ga0068860_100315985 3300005843 Bacteria 1532
78 Ga0081455_10006229 3300005937 Bacteria 12846
79 Ga0081455_10079176 3300005937 Bacteria 2699
80 Ga0081538_10002575 3300005981 Bacteria 17611
81 Ga0081539_10000433 3300005985 Bacteria 89118
82 Ga0075432_10122699 3300006058 Bacteria 977
83 Ga0075430_100541035 3300006846 Bacteria 960
84 Ga0075431_100738127 3300006847 Bacteria 960
85 Ga0075434_100252778 3300006871 Bacteria 1782
86 Ga0075429_100010350 3300006880 Bacteria 8069
87 Ga0075429_100744316 3300006880 Bacteria 859
88 Ga0068865_100021603 3300006881 Bacteria 4188
89 Ga0068865_100062334 3300006881 Bacteria 2617
90 Ga0097620_100018516 3300006931 Bacteria 6998
91 Ga0111539_10015472 3300009094 Bacteria 9488
92 Ga0111539_10110721 3300009094 Bacteria 3222
93 Ga0111539_10363515 3300009094 Bacteria 1684
94 Ga0105245_10032455 3300009098 Bacteria 4623
95 Ga0105245_10146994 3300009098 Bacteria 2224
96 Ga0105245_10327812 3300009098 Bacteria 1510
97 Ga0105247_10125607 3300009101 Bacteria 1667
98 Ga0114129_10135040 3300009147 Bacteria 3385
99 Ga0114129_10250763 3300009147 Bacteria 2376
100 Ga0114129_10266150 3300009147 Bacteria 2295
101 Ga0105243_10004391 3300009148 Bacteria 11156
102 Ga0105243_10071504 3300009148 Bacteria 2805
103 Ga0105248_10019956 3300009177 Bacteria 7420
104 Ga0105248_10789609 3300009177 Bacteria 1072
105 Ga0105238_10205120 3300009551 Bacteria 1947
106 Ga0105249_10436669 3300009553 Bacteria 1346
107 Ga0105239_10057328 3300010375 Bacteria 4273
108 Ga0105239_10084795 3300010375 Bacteria 3490
109 Ga0105239_10334837 3300010375 Bacteria 1708
110 Ga0105246_10184795 3300011119 Bacteria 1608
111 Ga0157371_10008889 3300013102 Bacteria 7955
112 Ga0157371_10198726 3300013102 Bacteria 1437
113 Ga0157370_10206600 3300013104 Bacteria 1821
114 Ga0157369_10040784 3300013105 Bacteria 5068
115 Ga0157369_10600249 3300013105 Bacteria 1136
116 Ga0163162_10062406 3300013306 Bacteria 3767
117 Ga0163162_10796192 3300013306 Bacteria 1063
118 Ga0157372_10145989 3300013307 Bacteria 2728
119 Ga0157372_10152313 3300013307 Bacteria 2670
120 Ga0157375_10024672 3300013308 Bacteria 5570
121 Ga0157375_10043421 3300013308 Bacteria 4360
122 Ga0163163_10149018 3300014325 Bacteria 2384
123 Ga0157380_10161919 3300014326 Bacteria 1946
124 Ga0157380_10406213 3300014326 Bacteria 1294
125 Ga0157377_10009062 3300014745 Bacteria 4876
126 Ga0157377_10021531 3300014745 Bacteria 3392
127 Ga0157379_10056156 3300014968 Bacteria 3518
128 Ga0157376_11034634 3300014969 Bacteria 845
129 Ga0163161_10083664 3300017792 Bacteria 2352
130 Ga0207656_10021163 3300025321 Bacteria 2595
131 Ga0207688_10007153 3300025901 Bacteria 6068
132 Ga0207688_10020781 3300025901 Bacteria 3584
133 Ga0207688_10029983 3300025901 Bacteria 2999
134 Ga0207645_10138056 3300025907 Bacteria 1588
135 Ga0207643_10011474 3300025908 Bacteria 4785
136 Ga0207705_10083621 3300025909 Bacteria 2329
137 Ga0207684_10034991 3300025910 Bacteria 4265
138 Ga0207707_10099422 3300025912 Bacteria 2542
139 Ga0207660_10441913 3300025917 Bacteria 1051
140 Ga0207660_10447692 3300025917 Bacteria 1044
141 Ga0207662_10014051 3300025918 Bacteria 4486
142 Ga0207662_10034625 3300025918 Bacteria 2947
143 Ga0207657_10025896 3300025919 Bacteria 5401
144 Ga0207657_10247409 3300025919 Bacteria 1422
145 Ga0207649_10162128 3300025920 Bacteria 1550
146 Ga0207652_10085237 3300025921 Bacteria 2769
147 Ga0207650_10093420 3300025925 Bacteria 2302
148 Ga0207659_10032960 3300025926 Bacteria 3560
149 Ga0207659_10066263 3300025926 Bacteria 2620
150 Ga0207687_10029072 3300025927 Bacteria 3716
151 Ga0207687_10036101 3300025927 Bacteria 3366
152 Ga0207687_10132391 3300025927 Bacteria 1881
153 Ga0207690_10260543 3300025932 Bacteria 1343
154 Ga0207706_10012543 3300025933 Bacteria 7718
155 Ga0207709_10040255 3300025935 Bacteria 2797
156 Ga0207669_10056668 3300025937 Bacteria 2381
157 Ga0207669_10293871 3300025937 Bacteria 1231
158 Ga0207691_10093014 3300025940 Bacteria 2700
159 Ga0207711_10138407 3300025941 Bacteria 2188
160 Ga0207689_10059437 3300025942 Bacteria 3144
161 Ga0207689_10214632 3300025942 Bacteria 1590
162 Ga0207661_10042523 3300025944 Bacteria 3582
163 Ga0207661_10085062 3300025944 Bacteria 2621
164 Ga0207661_10603074 3300025944 Unclassified 1008
165 Ga0207679_10179623 3300025945 Bacteria 1750
166 Ga0207679_10325913 3300025945 Bacteria 1331
167 Ga0207679_10337619 3300025945 Bacteria 1309
168 Ga0207667_10151087 3300025949 Bacteria 2390
169 Ga0207651_10010225 3300025960 Bacteria 5189
170 Ga0207651_10167386 3300025960 Bacteria 1730
171 Ga0207668_10139716 3300025972 Bacteria 1861
172 Ga0207640_10030956 3300025981 Bacteria 3301
173 Ga0207640_10207708 3300025981 Bacteria 1489
174 Ga0207677_10099781 3300026023 Bacteria 2133
175 Ga0207639_10295750 3300026041 Bacteria 1429
176 Ga0207678_10020336 3300026067 Bacteria 5824
177 Ga0207678_10150608 3300026067 Bacteria 1986
178 Ga0207708_10071160 3300026075 Bacteria 2664
179 Ga0207708_10076481 3300026075 Bacteria 2568
180 Ga0207641_10135559 3300026088 Bacteria 2216
181 Ga0207648_10032673 3300026089 Bacteria 4592
182 Ga0207676_10397717 3300026095 Bacteria 1287
183 Ga0207675_100222653 3300026118 Bacteria 1818
184 Ga0207683_10096536 3300026121 Bacteria 2635
185 Ga0207683_10121194 3300026121 Bacteria 2348
186 Ga0207683_10423653 3300026121 Unclassified 1226
187 Ga0207698_10020583 3300026142 Bacteria 4544
188 Ga0207428_10016819 3300027907 Bacteria 6286
189 Ga0268266_10216416 3300028379 Bacteria 1759
190 Ga0268266_10756293 3300028379 Bacteria 938
191 Ga0268265_10116436 3300028380 Bacteria 2193
192 Ga0307413_10017550 3300031824 Bacteria 3730
193 Ga0307410_10100363 3300031852 Bacteria 2073
194 Ga0307406_10029642 3300031901 Bacteria 3315
195 Ga0307407_10000360 3300031903 Bacteria 13725
196 Ga0307412_10007862 3300031911 Bacteria 6073
197 Ga0307409_100001158 3300031995 Bacteria 12562
198 Ga0307414_10142770 3300032004 Bacteria 1877
199 Ga0307415_100450916 3300032126 Bacteria 1112
200 Ga0373949_0068710 3300035090 Bacteria 924
201 Ga0373939_0042021 3300035114 Bacteria 1380
202 Ga0373941_0034241 3300035115 Bacteria 1531
203 Ga0373960_0003752 3300035121 Bacteria 3453
204 Ga0395900_0062927 3300037418 Bacteria 3814
205 Ga0395900_0229647 3300037418 Bacteria 1867
206 Ga0395898_0011441 3300037466 Bacteria 9216
207 Ga0395905_0015709 3300037471 Bacteria 7193
208 Ga0395905_0331758 3300037471 Bacteria 1412
209 Ga0395901_0029827 3300038443 Bacteria 5618
210 Ga0395901_0095635 3300038443 Bacteria 3113
211 Ga0439438_019283 3300041405 Bacteria 1929
212 Ga0439461_0001872 3300041410 Bacteria 3312
213 Ga0439461_0003568 3300041410 Bacteria 2565
214 Ga0451835_0085662 3300041492 Bacteria 949
215 Ga0439431_0002154 3300041997 Bacteria 4344
216 Ga0439433_0001634 3300041999 Bacteria 4664
217 Ga0439448_0007247 3300042005 Bacteria 3209
218 Ga0439451_019289 3300042009 Bacteria 1375
219 Ga0450906_004085 3300042145 Bacteria 3089
220 Ga0450906_004640 3300042145 Bacteria 2866
221 Ga0450910_018898 3300042147 Bacteria 1032
222 Ga0439446_0000101 3300042156 Bacteria 14531
223 Ga0439434_0003666 3300042435 Bacteria 4490
224 Ga0439434_0006906 3300042435 Bacteria 3317
225 Ga0439460_0135995 3300042461 Bacteria 813
226 Ga0466963_0165708 3300044694 Bacteria 1539
227 Ga0466968_0118352 3300044735 Bacteria 1197
228 Ga0495629_0409753 3300046459 Bacteria 921
229 Ga0495630_0736586 3300046517 Bacteria 754
230 Ga0495676_0153392 3300047321 Bacteria 1637
231 Ga0496101_0159744 3300048904 Bacteria 1728
232 Ga0496102_0339555 3300048905 Bacteria 1415
233 Ga0496102_0449458 3300048905 Bacteria 1209
234 Ga0496104_0070586 3300048907 Bacteria 3321
235 Ga0496104_0619677 3300048907 Bacteria 992
236 Ga0496106_0029842 3300048909 Bacteria 4065
237 Ga0496107_0068474 3300048910 Bacteria 2576
238 Ga0496107_0393962 3300048910 Bacteria 1030
239 Ga0496108_0107487 3300048911 Bacteria 2382
240 Ga0496109_0000445 3300048912 Bacteria 35570
241 Ga0496109_0104625 3300048912 Bacteria 2628
242 Ga0496109_0249833 3300048912 Bacteria 1670
243 Ga0496110_0095733 3300048913 Bacteria 2659
244 Ga0496111_0008356 3300048914 Bacteria 6845
245 Ga0496111_0275794 3300048914 Bacteria 1247
246 Ga0496113_0068717 3300048916 Bacteria 2689
247 Ga0496114_0047357 3300048917 Bacteria 3577
248 Ga0496114_0109773 3300048917 Bacteria 2362
249 Ga0496114_0178190 3300048917 Bacteria 1855
250 Ga0501031_0000427 3300049568 Bacteria 24239
251 Ga0501031_0026073 3300049568 Bacteria 3812
252 Ga0501031_0179881 3300049568 Bacteria 1381
253 Ga0501032_0004186 3300049569 Bacteria 10923
254 Ga0501032_0012273 3300049569 Bacteria 6130
255 Ga0501032_0132589 3300049569 Bacteria 1643
256 Ga0501032_0143869 3300049569 Bacteria 1570
257 Ga0501032_0155404 3300049569 Bacteria 1503
258 Ga0501032_0375198 3300049569 Bacteria 915
259 Ga0501033_0000745 3300049570 Bacteria 29952
260 Ga0501033_0022236 3300049570 Bacteria 4784
261 Ga0501033_0048956 3300049570 Bacteria 3138
262 Ga0501033_0065529 3300049570 Bacteria 2672
263 Ga0501034_0290450 3300049571 Bacteria 1573
264 Ga0501036_0000190 3300049572 Bacteria 40819
265 Ga0501036_0008698 3300049572 Bacteria 8329
266 Ga0501036_0058354 3300049572 Bacteria 3269
267 Ga0501036_0163463 3300049572 Bacteria 1876
268 Ga0501036_0176437 3300049572 Bacteria 1799
269 Ga0501036_0222055 3300049572 Bacteria 1586
270 Ga0501036_0326560 3300049572 Bacteria 1282
271 Ga0501037_0005752 3300049573 Bacteria 9054
272 Ga0501037_0007129 3300049573 Bacteria 8169
273 Ga0501037_0022271 3300049573 Bacteria 4688
274 Ga0501037_0022691 3300049573 Bacteria 4639
275 Ga0501037_0056686 3300049573 Bacteria 2861
276 Ga0501038_0014176 3300049574 Bacteria 7261
277 Ga0501038_0032273 3300049574 Bacteria 4621
278 Ga0501038_0032503 3300049574 Bacteria 4603
279 Ga0501038_0130684 3300049574 Bacteria 2062
280 Ga0501039_0000158 3300049575 Bacteria 46898
281 Ga0501039_0005711 3300049575 Bacteria 9425
282 Ga0501039_0016682 3300049575 Bacteria 5626
283 Ga0501039_0017214 3300049575 Bacteria 5544
284 Ga0501039_0225049 3300049575 Bacteria 1474
285 Ga0501040_0000275 3300049576 Bacteria 29980
286 Ga0501040_0000912 3300049576 Bacteria 18528
287 Ga0501040_0010237 3300049576 Bacteria 6134
288 Ga0501040_0023701 3300049576 Bacteria 4116
289 Ga0501040_0038290 3300049576 Bacteria 3260
290 Ga0501040_0075885 3300049576 Bacteria 2323
291 Ga0501040_0123657 3300049576 Bacteria 1816
292 Ga0501040_0319478 3300049576 Bacteria 1110
293 Ga0501040_0554042 3300049576 Bacteria 830
294 Ga0501041_0000051 3300049577 Bacteria 41855
295 Ga0501041_0014720 3300049577 Bacteria 4645
296 Ga0501041_0015250 3300049577 Bacteria 4563
297 Ga0501041_0043895 3300049577 Bacteria 2717
298 Ga0501041_0047639 3300049577 Bacteria 2609
299 Ga0501042_0000218 3300049578 Bacteria 27249
300 Ga0501042_0001077 3300049578 Bacteria 15653
301 Ga0501042_0001905 3300049578 Bacteria 12527
302 Ga0501042_0009891 3300049578 Bacteria 6370
303 Ga0501042_0034655 3300049578 Bacteria 3580
304 Ga0501042_0075232 3300049578 Bacteria 2416
305 Ga0501042_0288852 3300049578 Bacteria 1184
306 Ga0501042_0358419 3300049578 Bacteria 1055
307 Ga0501043_0000246 3300049579 Bacteria 49066
308 Ga0501043_0348725 3300049579 Bacteria 1125
309 Ga0501046_0000552 3300049580 Bacteria 37233
310 Ga0501046_0011089 3300049580 Bacteria 7716
311 Ga0501046_0018977 3300049580 Bacteria 5708
312 Ga0501046_0028370 3300049580 Bacteria 4558
313 Ga0501046_0113556 3300049580 Bacteria 2067
314 Ga0501046_0224870 3300049580 Bacteria 1388
315 Ga0501047_0021103 3300049581 Bacteria 6253
316 Ga0501047_0398908 3300049581 Bacteria 1208
317 Ga0501048_0000153 3300049582 Bacteria 42484
318 Ga0501048_0061795 3300049582 Bacteria 2651
319 Ga0501048_0075018 3300049582 Bacteria 2386
320 Ga0501048_0113857 3300049582 Bacteria 1911
321 Ga0501048_0183725 3300049582 Bacteria 1482
322 Ga0501048_0393285 3300049582 Bacteria 990
323 Ga0501067_0040061 3300049583 Bacteria 2602
324 Ga0501067_0069709 3300049583 Bacteria 1947
325 Ga0501068_0000065 3300049584 Bacteria 41452
326 Ga0501068_0121067 3300049584 Bacteria 1631
327 Ga0501068_0529926 3300049584 Bacteria 765
328 Ga0501069_0001652 3300049585 Bacteria 11081
329 Ga0501069_0002906 3300049585 Bacteria 8799
330 Ga0501069_0004269 3300049585 Bacteria 7386
331 Ga0501069_0021416 3300049585 Bacteria 3508
332 Ga0501069_0023875 3300049585 Bacteria 3333
333 Ga0501070_0028889 3300049586 Bacteria 4649
334 Ga0501070_0045740 3300049586 Bacteria 3639
335 Ga0501071_0002953 3300049587 Bacteria 10504
336 Ga0501071_0006692 3300049587 Bacteria 7490
337 Ga0501071_0008662 3300049587 Bacteria 6728
338 Ga0501071_0015046 3300049587 Bacteria 5304
339 Ga0501071_0066145 3300049587 Bacteria 2626
340 Ga0501071_0096357 3300049587 Bacteria 2177
341 Ga0501071_0363919 3300049587 Unclassified 1102
342 Ga0501071_0438293 3300049587 Bacteria 999
343 Ga0501072_0021166 3300049588 Bacteria 5044
344 Ga0501072_0028155 3300049588 Bacteria 4386
345 Ga0501072_0030436 3300049588 Bacteria 4221
346 Ga0501072_0040259 3300049588 Bacteria 3669
347 Ga0501072_0051380 3300049588 Bacteria 3245
348 Ga0501072_0055877 3300049588 Bacteria 3111
349 Ga0501072_0130296 3300049588 Bacteria 2004
350 Ga0501072_0199043 3300049588 Bacteria 1597
351 Ga0501072_0649441 3300049588 Bacteria 830
352 Ga0501073_0001011 3300049589 Bacteria 20308
353 Ga0501073_0003267 3300049589 Bacteria 12167
354 Ga0501073_0056563 3300049589 Bacteria 2743
355 Ga0501073_0165144 3300049589 Bacteria 1533
356 Ga0501074_0000298 3300049590 Bacteria 28558
357 Ga0501074_0004608 3300049590 Bacteria 9871
358 Ga0501074_0022617 3300049590 Bacteria 4570
359 Ga0501074_0058833 3300049590 Bacteria 2769
360 Ga0501074_0223533 3300049590 Bacteria 1340
361 Ga0501075_0000227 3300049591 Bacteria 30114
362 Ga0501075_0004840 3300049591 Bacteria 9167
363 Ga0501075_0006394 3300049591 Bacteria 8111
364 Ga0501075_0023714 3300049591 Bacteria 4493
365 Ga0501075_0024891 3300049591 Bacteria 4394
366 Ga0501075_0046077 3300049591 Bacteria 3275
367 Ga0501075_0054305 3300049591 Bacteria 3013
368 Ga0501076_0000097 3300049592 Bacteria 47389
369 Ga0501076_0001626 3300049592 Bacteria 15152
370 Ga0501076_0052094 3300049592 Bacteria 3241
371 Ga0501076_0055003 3300049592 Bacteria 3155
372 Ga0501076_0070112 3300049592 Bacteria 2802
373 Ga0501076_0170150 3300049592 Bacteria 1776
374 Ga0501076_0220744 3300049592 Bacteria 1549
375 Ga0501076_0274680 3300049592 Bacteria 1380
376 Ga0501076_0436200 3300049592 Bacteria 1078
377 Ga0501077_0000120 3300049593 Bacteria 42154
378 Ga0501077_0001430 3300049593 Bacteria 14336
379 Ga0501077_0018671 3300049593 Bacteria 4385
380 Ga0501077_0031567 3300049593 Bacteria 3371
381 Ga0501077_0072387 3300049593 Unclassified 2184
382 Ga0501077_0086390 3300049593 Bacteria 1988
383 Ga0501077_0139831 3300049593 Bacteria 1535
384 Ga0501077_0368289 3300049593 Bacteria 917
385 Ga0501079_0000076 3300049741 Bacteria 46459
386 Ga0501079_0004010 3300049741 Bacteria 10890
387 Ga0501079_0014354 3300049741 Bacteria 6039
388 Ga0501079_0019514 3300049741 Bacteria 5178
389 Ga0501079_0080791 3300049741 Bacteria 2513
390 Ga0501079_0087224 3300049741 Bacteria 2416
391 Ga0501079_0419020 3300049741 Bacteria 1051
392 Ga0501080_0035545 3300049742 Bacteria 4649
393 Ga0501080_0394566 3300049742 Bacteria 1245
394 Ga0501080_0451192 3300049742 Bacteria 1153
395 Ga0501081_0000124 3300049743 Bacteria 33643
396 Ga0501081_0001814 3300049743 Bacteria 13240
397 Ga0501081_0009665 3300049743 Bacteria 6285
398 Ga0501081_0026190 3300049743 Bacteria 3930
399 Ga0501081_0042455 3300049743 Bacteria 3116
400 Ga0501081_0056512 3300049743 Bacteria 2712
401 Ga0501081_0084880 3300049743 Bacteria 2221
402 Ga0501081_0149694 3300049743 Bacteria 1676
403 Ga0501081_0216450 3300049743 Bacteria 1392
404 Ga0501083_0006417 3300049744 Bacteria 8340
405 Ga0501083_0020174 3300049744 Bacteria 4637
406 Ga0501083_0048949 3300049744 Bacteria 2851
407 Ga0501083_0092355 3300049744 Bacteria 1998
408 Ga0501035_0000722 3300049822 Bacteria 35741
409 Ga0501035_0003302 3300049822 Bacteria 15457
410 Ga0501035_0058126 3300049822 Bacteria 3447
411 Ga0501035_0153796 3300049822 Bacteria 1994
412 Ga0501035_0418023 3300049822 Bacteria 1113
413 Ga0501044_0006082 3300049823 Bacteria 13321
414 Ga0501044_0043772 3300049823 Bacteria 4649
415 Ga0501044_0071813 3300049823 Bacteria 3519
416 Ga0501045_0000077 3300049824 Bacteria 46550
417 Ga0501045_0006328 3300049824 Bacteria 8189
418 Ga0501045_0030166 3300049824 Bacteria 3923
419 Ga0501045_0087941 3300049824 Bacteria 2295
420 nmdc:mga05p37_12627_c1 3300050507 Bacteria 10088
421 nmdc:mga05p37_244171_c1 3300050507 Bacteria 2157
422 nmdc:mga09592_2005_c1 3300050508 Bacteria 16421
423 nmdc:mga0qj67_55131_c1 3300050509 Bacteria 3149
424 nmdc:mga06r32_222914_c1 3300050510 Bacteria 1874
425 nmdc:mga08y16_203758_c1 3300050511 Bacteria 2050
426 nmdc:mga08y16_290172_c1 3300050511 Bacteria 1687
427 nmdc:mga08y16_42671_c1 3300050511 Bacteria 4750
428 nmdc:mga0n895_214720_c1 3300050512 Bacteria 1953
429 Ga0501084_0000125 3300054114 Bacteria 57691
430 Ga0501084_0002502 3300054114 Bacteria 14791
431 Ga0501084_0150659 3300054114 Bacteria 1960
432 Ga0501084_0206744 3300054114 Bacteria 1656
433 Ga0590071_019081 3300059421 Bacteria 1614
434 Ga0501082_0000768 3300060353 Bacteria 28107
435 Ga0501082_0014003 3300060353 Bacteria 6897
436 Ga0501082_0040935 3300060353 Bacteria 3995
437 Ga0501082_0044667 3300060353 Bacteria 3821
438 Ga0501082_0283080 3300060353 Bacteria 1443
439 Ga0501082_0297443 3300060353 Bacteria 1405
440 Ga0501082_0413031 3300060353 Bacteria 1178
441 Ga0530510_0000211 3300061734 Bacteria 35976
442 Ga0530510_0030317 3300061734 Bacteria 3885
443 Ga0530510_0079264 3300061734 Bacteria 2388
444 Ga0530510_0091528 3300061734 Bacteria 2219
445 Ga0530510_0373034 3300061734 Bacteria 1073
446 Ga0530510_0448897 3300061734 Bacteria 975
447 Ga0501084_0289145
448 JGI25406J46586_10013766
449 Ga0070658_10028535
450 Ga0070676_10043613
451 Ga0070683_100190409
452 Ga0070683_100745074
453 Ga0070670_100127228
454 Ga0068869_100053477
455 Ga0070680_100341437
456 Ga0070682_100004123
457 Ga0068868_100004540
458 Ga0068868_100104794
459 Ga0068868_100643587
460 Ga0070660_100162993
461 Ga0070691_10021687
462 Ga0070691_10066139
463 Ga0070687_100125334
464 Ga0070661_100170092
465 Ga0070692_10006211
466 Ga0070692_10066207
467 Ga0070675_100015656
468 Ga0070675_100049200
469 Ga0070675_100370294
470 Ga0070671_100392457
471 Ga0070674_100215224
472 Ga0070673_100020991
473 Ga0070688_100007487
474 Ga0070659_100060551
475 Ga0070659_100084731
476 Ga0070701_10005670
477 Ga0070700_100028382
478 Ga0070700_100061561
479 Ga0070663_100115903
480 Ga0070663_100159386
481 Ga0070678_100011091
482 Ga0070678_100285854
483 Ga0070662_100014361
484 Ga0070681_10081330
485 Ga0070681_10118274
486 Ga0068867_100035412
487 Ga0068867_100154582
488 Ga0070706_100281607
489 Ga0070679_100038792
490 Ga0070679_100138500
491 Ga0070684_100078445
492 Ga0070684_100108315
493 Ga0070684_100251749
494 Ga0070684_100552599
495 Ga0068853_100013587
496 Ga0068853_100019004
497 Ga0068853_100150498
498 Ga0068853_100186833
499 Ga0070686_100155014
500 Ga0070693_100020460
501 Ga0070693_100132733
502 Ga0070665_100046133
503 Ga0068855_100422458
504 Ga0070664_100025906
505 Ga0070664_100094304
506 Ga0070664_100237297
507 Ga0068854_100036173
508 Ga0068854_100047405
509 Ga0068854_100095354
510 Ga0068856_100401277
511 Ga0070702_100018234
512 Ga0070702_100039276
513 Ga0068852_100218797
514 Ga0068852_100632474
515 Ga0068859_100018516
516 Ga0068864_100435123
517 Ga0068866_10125229
518 Ga0068861_100121538
519 Ga0068861_100199504
520 Ga0068851_10044438
521 Ga0068851_10044694
522 Ga0068870_10180274
523 Ga0068860_100315985
524 Ga0081455_10006229
525 Ga0081455_10079176
526 Ga0081538_10002575
527 Ga0081539_10000433
528 Ga0075432_10122699
529 Ga0075430_100541035
530 Ga0075431_100738127
531 Ga0075434_100252778
532 Ga0075429_100010350
533 Ga0075429_100744316
534 Ga0068865_100021603
535 Ga0068865_100062334
536 Ga0097620_100018516
537 Ga0111539_10015472
538 Ga0111539_10110721
539 Ga0111539_10363515
540 Ga0105245_10032455
541 Ga0105245_10146994
542 Ga0105245_10327812
543 Ga0105247_10125607
544 Ga0114129_10135040
545 Ga0114129_10250763
546 Ga0114129_10266150
547 Ga0105243_10004391
548 Ga0105243_10071504
549 Ga0105248_10019956
550 Ga0105248_10789609
551 Ga0105238_10205120
552 Ga0105249_10436669
553 Ga0105239_10057328
554 Ga0105239_10084795
555 Ga0105239_10334837
556 Ga0105246_10184795
557 Ga0157371_10008889
558 Ga0157371_10198726
559 Ga0157370_10206600
560 Ga0157369_10040784
561 Ga0157369_10600249
562 Ga0163162_10062406
563 Ga0163162_10796192
564 Ga0157372_10145989
565 Ga0157372_10152313
566 Ga0157375_10024672
567 Ga0157375_10043421
568 Ga0163163_10149018
569 Ga0157380_10161919
570 Ga0157380_10406213
571 Ga0157377_10009062
572 Ga0157377_10021531
573 Ga0157379_10056156
574 Ga0157376_11034634
575 Ga0163161_10083664
576 Ga0207656_10021163
577 Ga0207688_10007153
578 Ga0207688_10020781
579 Ga0207688_10029983
580 Ga0207645_10138056
581 Ga0207643_10011474
582 Ga0207705_10083621
583 Ga0207684_10034991
584 Ga0207707_10099422
585 Ga0207660_10441913
586 Ga0207660_10447692
587 Ga0207662_10014051
588 Ga0207662_10034625
589 Ga0207657_10025896
590 Ga0207657_10247409
591 Ga0207649_10162128
592 Ga0207652_10085237
593 Ga0207650_10093420
594 Ga0207659_10032960
595 Ga0207659_10066263
596 Ga0207687_10029072
597 Ga0207687_10036101
598 Ga0207687_10132391
599 Ga0207690_10260543
600 Ga0207706_10012543
601 Ga0207709_10040255
602 Ga0207669_10056668
603 Ga0207669_10293871
604 Ga0207691_10093014
605 Ga0207711_10138407
606 Ga0207689_10059437
607 Ga0207689_10214632
608 Ga0207661_10042523
609 Ga0207661_10085062
610 Ga0207661_10603074
611 Ga0207679_10179623
612 Ga0207679_10325913
613 Ga0207679_10337619
614 Ga0207667_10151087
615 Ga0207651_10010225
616 Ga0207651_10167386
617 Ga0207668_10139716
618 Ga0207640_10030956
619 Ga0207640_10207708
620 Ga0207677_10099781
621 Ga0207639_10295750
622 Ga0207678_10020336
623 Ga0207678_10150608
624 Ga0207708_10071160
625 Ga0207708_10076481
626 Ga0207641_10135559
627 Ga0207648_10032673
628 Ga0207676_10397717
629 Ga0207675_100222653
630 Ga0207683_10096536
631 Ga0207683_10121194
632 Ga0207683_10423653
633 Ga0207698_10020583
634 Ga0207428_10016819
635 Ga0268266_10216416
636 Ga0268266_10756293
637 Ga0268265_10116436
638 Ga0307413_10017550
639 Ga0307410_10100363
640 Ga0307406_10029642
641 Ga0307407_10000360
642 Ga0307412_10007862
643 Ga0307409_100001158
644 Ga0307414_10142770
645 Ga0307415_100450916
646 Ga0373949_0068710
647 Ga0373939_0042021
648 Ga0373941_0034241
649 Ga0373960_0003752
650 Ga0395900_0062927
651 Ga0395900_0229647
652 Ga0395898_0011441
653 Ga0395905_0015709
654 Ga0395905_0331758
655 Ga0395901_0029827
656 Ga0395901_0095635
657 Ga0439438_019283
658 Ga0439461_0001872
659 Ga0439461_0003568
660 Ga0451835_0085662
661 Ga0439431_0002154
662 Ga0439433_0001634
663 Ga0439448_0007247
664 Ga0439451_019289
665 Ga0450906_004085
666 Ga0450906_004640
667 Ga0450910_018898
668 Ga0439446_0000101
669 Ga0439434_0003666
670 Ga0439434_0006906
671 Ga0439460_0135995
672 Ga0466963_0165708
673 Ga0466968_0118352
674 Ga0495629_0409753
675 Ga0495630_0736586
676 Ga0495676_0153392
677 Ga0496101_0159744
678 Ga0496102_0339555
679 Ga0496102_0449458
680 Ga0496104_0070586
681 Ga0496104_0619677
682 Ga0496106_0029842
683 Ga0496107_0068474
684 Ga0496107_0393962
685 Ga0496108_0107487
686 Ga0496109_0000445
687 Ga0496109_0104625
688 Ga0496109_0249833
689 Ga0496110_0095733
690 Ga0496111_0008356
691 Ga0496111_0275794
692 Ga0496113_0068717
693 Ga0496114_0047357
694 Ga0496114_0109773
695 Ga0496114_0178190
696 Ga0501031_0000427
697 Ga0501031_0026073
698 Ga0501031_0179881
699 Ga0501032_0004186
700 Ga0501032_0012273
701 Ga0501032_0132589
702 Ga0501032_0143869
703 Ga0501032_0155404
704 Ga0501032_0375198
705 Ga0501033_0000745
706 Ga0501033_0022236
707 Ga0501033_0048956
708 Ga0501033_0065529
709 Ga0501034_0290450
710 Ga0501036_0000190
711 Ga0501036_0008698
712 Ga0501036_0058354
713 Ga0501036_0163463
714 Ga0501036_0176437
715 Ga0501036_0222055
716 Ga0501036_0326560
717 Ga0501037_0005752
718 Ga0501037_0007129
719 Ga0501037_0022271
720 Ga0501037_0022691
721 Ga0501037_0056686
722 Ga0501038_0014176
723 Ga0501038_0032273
724 Ga0501038_0032503
725 Ga0501038_0130684
726 Ga0501039_0000158
727 Ga0501039_0005711
728 Ga0501039_0016682
729 Ga0501039_0017214
730 Ga0501039_0225049
731 Ga0501040_0000275
732 Ga0501040_0000912
733 Ga0501040_0010237
734 Ga0501040_0023701
735 Ga0501040_0038290
736 Ga0501040_0075885
737 Ga0501040_0123657
738 Ga0501040_0319478
739 Ga0501040_0554042
740 Ga0501041_0000051
741 Ga0501041_0014720
742 Ga0501041_0015250
743 Ga0501041_0043895
744 Ga0501041_0047639
745 Ga0501042_0000218
746 Ga0501042_0001077
747 Ga0501042_0001905
748 Ga0501042_0009891
749 Ga0501042_0034655
750 Ga0501042_0075232
751 Ga0501042_0288852
752 Ga0501042_0358419
753 Ga0501043_0000246
754 Ga0501043_0348725
755 Ga0501046_0000552
756 Ga0501046_0011089
757 Ga0501046_0018977
758 Ga0501046_0028370
759 Ga0501046_0113556
760 Ga0501046_0224870
761 Ga0501047_0021103
762 Ga0501047_0398908
763 Ga0501048_0000153
764 Ga0501048_0061795
765 Ga0501048_0075018
766 Ga0501048_0113857
767 Ga0501048_0183725
768 Ga0501048_0393285
769 Ga0501067_0040061
770 Ga0501067_0069709
771 Ga0501068_0000065
772 Ga0501068_0121067
773 Ga0501068_0529926
774 Ga0501069_0001652
775 Ga0501069_0002906
776 Ga0501069_0004269
777 Ga0501069_0021416
778 Ga0501069_0023875
779 Ga0501070_0028889
780 Ga0501070_0045740
781 Ga0501071_0002953
782 Ga0501071_0006692
783 Ga0501071_0008662
784 Ga0501071_0015046
785 Ga0501071_0066145
786 Ga0501071_0096357
787 Ga0501071_0363919
788 Ga0501071_0438293
789 Ga0501072_0021166
790 Ga0501072_0028155
791 Ga0501072_0030436
792 Ga0501072_0040259
793 Ga0501072_0051380
794 Ga0501072_0055877
795 Ga0501072_0130296
796 Ga0501072_0199043
797 Ga0501072_0649441
798 Ga0501073_0001011
799 Ga0501073_0003267
800 Ga0501073_0056563
801 Ga0501073_0165144
802 Ga0501074_0000298
803 Ga0501074_0004608
804 Ga0501074_0022617
805 Ga0501074_0058833
806 Ga0501074_0223533
807 Ga0501075_0000227
808 Ga0501075_0004840
809 Ga0501075_0006394
810 Ga0501075_0023714
811 Ga0501075_0024891
812 Ga0501075_0046077
813 Ga0501075_0054305
814 Ga0501076_0000097
815 Ga0501076_0001626
816 Ga0501076_0052094
817 Ga0501076_0055003
818 Ga0501076_0070112
819 Ga0501076_0170150
820 Ga0501076_0220744
821 Ga0501076_0274680
822 Ga0501076_0436200
823 Ga0501077_0000120
824 Ga0501077_0001430
825 Ga0501077_0018671
826 Ga0501077_0031567
827 Ga0501077_0072387
828 Ga0501077_0086390
829 Ga0501077_0139831
830 Ga0501077_0368289
831 Ga0501079_0000076
832 Ga0501079_0004010
833 Ga0501079_0014354
834 Ga0501079_0019514
835 Ga0501079_0080791
836 Ga0501079_0087224
837 Ga0501079_0419020
838 Ga0501080_0035545
839 Ga0501080_0394566
840 Ga0501080_0451192
841 Ga0501081_0000124
842 Ga0501081_0001814
843 Ga0501081_0009665
844 Ga0501081_0026190
845 Ga0501081_0042455
846 Ga0501081_0056512
847 Ga0501081_0084880
848 Ga0501081_0149694
849 Ga0501081_0216450
850 Ga0501083_0006417
851 Ga0501083_0020174
852 Ga0501083_0048949
853 Ga0501083_0092355
854 Ga0501035_0000722
855 Ga0501035_0003302
856 Ga0501035_0058126
857 Ga0501035_0153796
858 Ga0501035_0418023
859 Ga0501044_0006082
860 Ga0501044_0043772
861 Ga0501044_0071813
862 Ga0501045_0000077
863 Ga0501045_0006328
864 Ga0501045_0030166
865 Ga0501045_0087941
866 nmdc:mga05p37_12627_c1
867 nmdc:mga05p37_244171_c1
868 nmdc:mga09592_2005_c1
869 nmdc:mga0qj67_55131_c1
870 nmdc:mga06r32_222914_c1
871 nmdc:mga08y16_203758_c1
872 nmdc:mga08y16_290172_c1
873 nmdc:mga08y16_42671_c1
874 nmdc:mga0n895_214720_c1
875 Ga0501084_0000125
876 Ga0501084_0002502
877 Ga0501084_0150659
878 Ga0501084_0206744
879 Ga0590071_019081
880 Ga0501082_0000768
881 Ga0501082_0014003
882 Ga0501082_0040935
883 Ga0501082_0044667
884 Ga0501082_0283080
885 Ga0501082_0297443
886 Ga0501082_0413031
887 Ga0530510_0000211
888 Ga0530510_0030317
889 Ga0530510_0079264
890 Ga0530510_0091528
891 Ga0530510_0373034
892 Ga0530510_0448897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

134

229

0.94

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

6

103

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.8125 2 239
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.8065 2 239
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.7996 2 239
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.7937 2 239
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.791 2 239
ID Description Score Start End Superfamily
af_Q2FW37_106_241_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.9333 106 236 3.30.70.660
2nqpB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9001 2 102 3.30.70.580
af_A0A1D6HBJ9_162_299_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.8978 105 231 3.30.70.660
1vs3B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.8966 106 239 3.30.70.660
af_Q2FW37_106_241_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.8944 106 236 3.30.70.660
ID Description Score Start End GO Terms
AF-A0A291TBP0-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.8417 2 239 GO:0003723
GO:0031119
GO:0160147
AF-A0A291TBP0-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.8355 2 239 GO:0003723
GO:0031119
GO:0160147
AF-A0A2N1SE51-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.8351 2 239 GO:0003723
GO:0031119
GO:0160147
AF-A0A316LTM6-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.8332 2 238 GO:0003723
GO:0031119
GO:0160147
AF-A0A350PYB1-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.8319 2 239 GO:0003723
GO:0031119
GO:0160147

Map