F445808

General Info

Members Datasets Scaffolds Average Seq Length
446 228 892 645

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0116390|Ga0496109_0116390_35_2200
Length 721
Sequence VRRLIYRFKSFIIYVLYYSRPNRSCHFRGFLIMSTDNPFPVSEPEKKFKPFVPEDMEMREFTWRAILLGLVLTIVLGAANAYLGLRAGITIAATYPAAVIAMAAMRAWKGSLLEENIARTAGSIGEGIAAGAIFTIPAFLIAKAWPSFSPGDAYWKSTALIMVGSILGVLFISLVRRVMVEDPELPFPESVAASEIHKAGQRGAQAAKYLFWNIGVGGVVYMLGKFGLFAADQDFPFTVGNLGHSQVRLGTLESTKVVATGGTSVFSAPSVSPAYLGVGYIIGLRLASIQFAGSVLAWGLLVPMMIYFLGPSLQHYIPAGTPQDWADTADAVWRYIVRPIAVGGMLVGAAYTLFKMRKSLTSGFGKALSDMRQSADQRAKLGRTERYMSFKTVLGLIALMFVLMCALYVQISGLLWPAILAAVVMLVVGFFFATVSGNLVGFIGSSNNPVSGLTLSTLLIAALLMVSLGVSGGKGVAIVLGXXXXVCVSSSVAGELLQDFKVGYILGGTPRNIQIAELIAVVVASLVMYWPLMLLHQGSINSGGVGFGGPDLPAPQAGLMATLAQGIVGGDMPWALVGVGIVFGLAMIMMQVKSPMLVAVGMYLPFGTTFAIFVGGVFRSLGDWLADRRGYNAAQKARVENAGVLTASGLIAGEAVLGLVWAGLQFVPQWKAPNHPPQLFSHPSYLVGGLIVLAGLAALLIRLPITAAGDPSEPAPPTAIM

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
149 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
160 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
164 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.36
Rhizosphere 92.6
Stem 0
Stem Tuber 0
Unclassified 14.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0116390 3300048912 Unclassified 2488
2 LJNas_1001186 3300000546 Bacteria 3949
3 Ga0070683_100001813 3300005329 Bacteria 16645
4 Ga0070683_100013744 3300005329 Bacteria 7067
5 Ga0070683_100037266 3300005329 Bacteria 4451
6 Ga0070690_100010185 3300005330 Bacteria 5462
7 Ga0070677_10006410 3300005333 Unclassified 3909
8 Ga0068869_100000935 3300005334 Bacteria 16859
9 Ga0070660_100019546 3300005339 Unclassified 4965
10 Ga0070660_100029488 3300005339 Bacteria 4112
11 Ga0070689_100027198 3300005340 Bacteria 4312
12 Ga0070661_100031125 3300005344 Bacteria 3858
13 Ga0070669_100017769 3300005353 Bacteria 5075
14 Ga0070673_100018739 3300005364 Unclassified 4955
15 Ga0070688_100011613 3300005365 Unclassified 4899
16 Ga0070688_100052670 3300005365 Bacteria 2543
17 Ga0070659_100002666 3300005366 Bacteria 12691
18 Ga0070709_10024125 3300005434 Bacteria 3578
19 Ga0070714_100090134 3300005435 Unclassified 2685
20 Ga0070714_100102692 3300005435 Bacteria 2521
21 Ga0070713_100006287 3300005436 Bacteria 8223
22 Ga0070713_100016524 3300005436 Bacteria 5549
23 Ga0070713_100019074 3300005436 Bacteria 5226
24 Ga0070713_100021247 3300005436 Unclassified 4988
25 Ga0070710_10001549 3300005437 Bacteria 10861
26 Ga0070710_10020546 3300005437 Bacteria 3428
27 Ga0070711_100012621 3300005439 Bacteria 5283
28 Ga0070694_100000206 3300005444 Bacteria 31045
29 Ga0070708_100000459 3300005445 Bacteria 30632
30 Ga0070708_100001910 3300005445 Bacteria 16037
31 Ga0070708_100002946 3300005445 Bacteria 13232
32 Ga0070708_100003001 3300005445 Bacteria 13111
33 Ga0070708_100043094 3300005445 Bacteria 3965
34 Ga0070708_100101119 3300005445 Bacteria 2640
35 Ga0070663_100009274 3300005455 Bacteria 6088
36 Ga0070663_100017079 3300005455 Bacteria 4729
37 Ga0070681_10003238 3300005458 Bacteria 15179
38 Ga0070681_10006120 3300005458 Bacteria 11679
39 Ga0070681_10015620 3300005458 Bacteria 7562
40 Ga0070681_10027416 3300005458 Bacteria 5727
41 Ga0070706_100000278 3300005467 Bacteria 62365
42 Ga0070706_100000514 3300005467 Bacteria 45375
43 Ga0070706_100051391 3300005467 Unclassified 3804
44 Ga0070707_100000582 3300005468 Bacteria 36767
45 Ga0070707_100000662 3300005468 Bacteria 34318
46 Ga0070707_100008218 3300005468 Bacteria 9680
47 Ga0070698_100000133 3300005471 Bacteria 65381
48 Ga0070698_100002043 3300005471 Bacteria 22426
49 Ga0070699_100000005 3300005518 Bacteria 384287
50 Ga0070699_100000441 3300005518 Bacteria 39851
51 Ga0070699_100005822 3300005518 Bacteria 10779
52 Ga0070699_100020254 3300005518 Bacteria 5735
53 Ga0070699_100050903 3300005518 Unclassified 3586
54 Ga0070699_100055749 3300005518 Bacteria 3422
55 Ga0070699_100065478 3300005518 Unclassified 3154
56 Ga0070679_100012620 3300005530 Bacteria 8080
57 Ga0070679_100045711 3300005530 Bacteria 4363
58 Ga0070679_100068264 3300005530 Unclassified 3546
59 Ga0070679_100075571 3300005530 Bacteria 3358
60 Ga0070684_100001752 3300005535 Bacteria 15816
61 Ga0070684_100009298 3300005535 Bacteria 7736
62 Ga0070697_100000049 3300005536 Bacteria 90362
63 Ga0070697_100000158 3300005536 Bacteria 55228
64 Ga0070697_100001845 3300005536 Bacteria 16187
65 Ga0070697_100002751 3300005536 Bacteria 13543
66 Ga0068853_100006343 3300005539 Bacteria 9387
67 Ga0070695_100000797 3300005545 Bacteria 16949
68 Ga0070696_100008369 3300005546 Bacteria 6920
69 Ga0070696_100012476 3300005546 Bacteria 5702
70 Ga0070665_100013859 3300005548 Bacteria 8109
71 Ga0070665_100059261 3300005548 Bacteria 3838
72 Ga0070665_100109308 3300005548 Bacteria 2767
73 Ga0070704_100010501 3300005549 Bacteria 5636
74 Ga0068855_100008713 3300005563 Bacteria 12264
75 Ga0068855_100026254 3300005563 Bacteria 6969
76 Ga0068855_100083294 3300005563 Bacteria 3705
77 Ga0070664_100022774 3300005564 Bacteria 5168
78 Ga0068857_100003339 3300005577 Bacteria 13361
79 Ga0068857_100021579 3300005577 Bacteria 5666
80 Ga0068857_100042483 3300005577 Bacteria 4034
81 Ga0068856_100003024 3300005614 Bacteria 17232
82 Ga0068856_100005836 3300005614 Bacteria 12134
83 Ga0068856_100009211 3300005614 Bacteria 9597
84 Ga0068856_100027370 3300005614 Bacteria 5562
85 Ga0068852_100007669 3300005616 Bacteria 7895
86 Ga0068859_100007139 3300005617 Bacteria 11340
87 Ga0068859_100074603 3300005617 Unclassified 3431
88 Ga0068861_100065789 3300005719 Unclassified 2793
89 Ga0068863_100089989 3300005841 Unclassified 2910
90 Ga0068863_100102065 3300005841 Unclassified 2727
91 Ga0068858_100002610 3300005842 Bacteria 18162
92 Ga0068862_100018198 3300005844 Bacteria 5849
93 Ga0070717_10000796 3300006028 Bacteria 20732
94 Ga0070717_10001548 3300006028 Bacteria 15949
95 Ga0070717_10002364 3300006028 Bacteria 13291
96 Ga0070717_10007590 3300006028 Bacteria 8059
97 Ga0070717_10014887 3300006028 Bacteria 5988
98 Ga0070717_10015728 3300006028 Bacteria 5847
99 Ga0070717_10110950 3300006028 Bacteria 2340
100 Ga0070712_100035247 3300006175 Unclassified 3396
101 Ga0097621_100000838 3300006237 Bacteria 21638
102 Ga0097621_100002927 3300006237 Bacteria 11737
103 Ga0068871_100015350 3300006358 Bacteria 5728
104 Ga0068871_100018971 3300006358 Bacteria 5242
105 Ga0068871_100068355 3300006358 Bacteria 2917
106 Ga0075428_100008112 3300006844 Bacteria 11660
107 Ga0075428_100023082 3300006844 Bacteria 6884
108 Ga0075428_100061608 3300006844 Bacteria 4109
109 Ga0075431_100027837 3300006847 Bacteria 5801
110 Ga0075431_100111886 3300006847 Unclassified 2818
111 Ga0075433_10001098 3300006852 Bacteria 19537
112 Ga0075433_10032301 3300006852 Bacteria 4483
113 Ga0075433_10034984 3300006852 Unclassified 4318
114 Ga0075433_10126753 3300006852 Unclassified 2267
115 Ga0075434_100000195 3300006871 Bacteria 40479
116 Ga0075434_100083141 3300006871 Bacteria 3199
117 Ga0075429_100022330 3300006880 Bacteria 5487
118 Ga0075436_100003023 3300006914 Bacteria 11527
119 Ga0075436_100009930 3300006914 Bacteria 6509
120 Ga0097620_100007139 3300006931 Bacteria 11340
121 Ga0097620_100074601 3300006931 Unclassified 3431
122 Ga0075435_100000065 3300007076 Bacteria 54666
123 Ga0075435_100030080 3300007076 Bacteria 4268
124 Ga0075435_100102874 3300007076 Bacteria 2368
125 Ga0105240_10001610 3300009093 Bacteria 38284
126 Ga0105240_10001930 3300009093 Bacteria 34414
127 Ga0105240_10005237 3300009093 Bacteria 19384
128 Ga0105240_10008846 3300009093 Bacteria 14339
129 Ga0105240_10029292 3300009093 Bacteria 7176
130 Ga0105240_10073936 3300009093 Bacteria 4208
131 Ga0105240_10182795 3300009093 Unclassified 2473
132 Ga0111539_10017799 3300009094 Bacteria 8798
133 Ga0111539_10022933 3300009094 Bacteria 7664
134 Ga0105245_10000608 3300009098 Bacteria 32449
135 Ga0105245_10011140 3300009098 Bacteria 7826
136 Ga0105247_10006341 3300009101 Bacteria 7329
137 Ga0114129_10014435 3300009147 Bacteria 11257
138 Ga0105243_10027304 3300009148 Bacteria 4372
139 Ga0105241_10003799 3300009174 Bacteria 11196
140 Ga0105248_10021967 3300009177 Bacteria 7071
141 Ga0105248_10065169 3300009177 Bacteria 4090
142 Ga0105248_10136173 3300009177 Bacteria 2770
143 Ga0105237_10001240 3300009545 Bacteria 34022
144 Ga0105237_10007723 3300009545 Bacteria 11744
145 Ga0105237_10011705 3300009545 Bacteria 9278
146 Ga0105237_10021042 3300009545 Bacteria 6713
147 Ga0105238_10003660 3300009551 Bacteria 15316
148 Ga0105238_10013260 3300009551 Bacteria 8316
149 Ga0105238_10014582 3300009551 Bacteria 7945
150 Ga0105238_10030210 3300009551 Bacteria 5514
151 Ga0105238_10036145 3300009551 Bacteria 5021
152 Ga0105249_10024924 3300009553 Bacteria 5382
153 Ga0105239_10003038 3300010375 Bacteria 20873
154 Ga0105239_10014364 3300010375 Bacteria 8786
155 Ga0105239_10017417 3300010375 Bacteria 7945
156 Ga0105239_10085002 3300010375 Unclassified 3486
157 Ga0105246_10007122 3300011119 Bacteria 6846
158 Ga0105246_10011181 3300011119 Bacteria 5564
159 Ga0105246_10047937 3300011119 Bacteria 2920
160 Ga0157373_10010696 3300013100 Bacteria 6749
161 Ga0157370_10008436 3300013104 Bacteria 11113
162 Ga0157370_10033135 3300013104 Bacteria 5037
163 Ga0157369_10002053 3300013105 Bacteria 24293
164 Ga0157369_10013005 3300013105 Bacteria 9428
165 Ga0157369_10021280 3300013105 Bacteria 7253
166 Ga0157369_10036968 3300013105 Bacteria 5349
167 Ga0157369_10060054 3300013105 Bacteria 4100
168 Ga0157369_10064860 3300013105 Unclassified 3932
169 Ga0157369_10128354 3300013105 Bacteria 2687
170 Ga0157374_10005709 3300013296 Bacteria 10498
171 Ga0157374_10012766 3300013296 Bacteria 7319
172 Ga0157374_10014505 3300013296 Bacteria 6897
173 Ga0157378_10000162 3300013297 Bacteria 63795
174 Ga0157378_10024706 3300013297 Bacteria 5290
175 Ga0157378_10052298 3300013297 Bacteria 3635
176 Ga0163162_10002555 3300013306 Bacteria 17229
177 Ga0157372_10006920 3300013307 Bacteria 12067
178 Ga0157372_10007955 3300013307 Bacteria 11271
179 Ga0157372_10019456 3300013307 Bacteria 7318
180 Ga0157375_10032189 3300013308 Bacteria 4971
181 Ga0157375_10047271 3300013308 Unclassified 4202
182 Ga0157375_10092842 3300013308 Bacteria 3083
183 Ga0163163_10015294 3300014325 Bacteria 7091
184 Ga0163163_10027698 3300014325 Bacteria 5432
185 Ga0157379_10007009 3300014968 Bacteria 9742
186 Ga0157379_10057448 3300014968 Unclassified 3478
187 Ga0157379_10062392 3300014968 Bacteria 3333
188 Ga0157376_10048190 3300014969 Unclassified 3521
189 Ga0163161_10008769 3300017792 Bacteria 6990
190 Ga0213872_10000486 3300021361 Bacteria 31784
191 Ga0213876_10004905 3300021384 Bacteria 7419
192 Ga0213875_10000008 3300021388 Bacteria 533344
193 Ga0213875_10000359 3300021388 Bacteria 42473
194 Ga0213875_10023979 3300021388 Bacteria 2911
195 Ga0228598_1002346 3300024227 Bacteria 4137
196 Ga0207688_10007283 3300025901 Bacteria 6021
197 Ga0207680_10019827 3300025903 Unclassified 3605
198 Ga0207647_10002874 3300025904 Bacteria 12974
199 Ga0207647_10032472 3300025904 Unclassified 3352
200 Ga0207699_10039034 3300025906 Unclassified 2725
201 Ga0207645_10007489 3300025907 Bacteria 7704
202 Ga0207643_10000639 3300025908 Bacteria 21958
203 Ga0207684_10000614 3300025910 Bacteria 42486
204 Ga0207684_10001907 3300025910 Bacteria 21656
205 Ga0207684_10010520 3300025910 Bacteria 8138
206 Ga0207707_10005115 3300025912 Bacteria 11497
207 Ga0207707_10015373 3300025912 Bacteria 6665
208 Ga0207695_10005671 3300025913 Bacteria 16476
209 Ga0207695_10014308 3300025913 Bacteria 9408
210 Ga0207695_10014788 3300025913 Bacteria 9220
211 Ga0207695_10019875 3300025913 Bacteria 7717
212 Ga0207695_10022649 3300025913 Bacteria 7122
213 Ga0207695_10034701 3300025913 Bacteria 5482
214 Ga0207695_10041836 3300025913 Bacteria 4901
215 Ga0207695_10042313 3300025913 Bacteria 4867
216 Ga0207671_10019649 3300025914 Bacteria 5162
217 Ga0207671_10024264 3300025914 Bacteria 4563
218 Ga0207671_10025867 3300025914 Bacteria 4404
219 Ga0207693_10000402 3300025915 Bacteria 39488
220 Ga0207693_10051323 3300025915 Bacteria 3237
221 Ga0207660_10019093 3300025917 Bacteria 4578
222 Ga0207657_10001261 3300025919 Bacteria 27065
223 Ga0207657_10002326 3300025919 Bacteria 20596
224 Ga0207657_10006328 3300025919 Bacteria 12300
225 Ga0207657_10032900 3300025919 Unclassified 4678
226 Ga0207649_10001661 3300025920 Bacteria 12866
227 Ga0207649_10052830 3300025920 Bacteria 2522
228 Ga0207652_10017781 3300025921 Bacteria 5824
229 Ga0207646_10002238 3300025922 Bacteria 23047
230 Ga0207646_10003393 3300025922 Bacteria 17998
231 Ga0207646_10013181 3300025922 Bacteria 7914
232 Ga0207646_10028031 3300025922 Bacteria 5132
233 Ga0207694_10002979 3300025924 Bacteria 13589
234 Ga0207694_10007275 3300025924 Bacteria 8400
235 Ga0207694_10026422 3300025924 Unclassified 4416
236 Ga0207650_10000177 3300025925 Bacteria 75244
237 Ga0207687_10007210 3300025927 Bacteria 7331
238 Ga0207700_10016030 3300025928 Unclassified 4967
239 Ga0207700_10046015 3300025928 Unclassified 3224
240 Ga0207664_10070505 3300025929 Unclassified 2813
241 Ga0207690_10049218 3300025932 Bacteria 2808
242 Ga0207706_10000941 3300025933 Bacteria 29750
243 Ga0207706_10019421 3300025933 Bacteria 6115
244 Ga0207670_10003630 3300025936 Bacteria 8187
245 Ga0207670_10022488 3300025936 Bacteria 3909
246 Ga0207670_10029906 3300025936 Bacteria 3474
247 Ga0207704_10049968 3300025938 Bacteria 2520
248 Ga0207665_10000704 3300025939 Bacteria 22665
249 Ga0207665_10015427 3300025939 Bacteria 5015
250 Ga0207691_10001447 3300025940 Bacteria 23651
251 Ga0207711_10021821 3300025941 Bacteria 5348
252 Ga0207711_10022956 3300025941 Bacteria 5222
253 Ga0207689_10000542 3300025942 Bacteria 35861
254 Ga0207689_10002307 3300025942 Bacteria 17863
255 Ga0207689_10011534 3300025942 Bacteria 7570
256 Ga0207661_10002775 3300025944 Bacteria 12067
257 Ga0207679_10000143 3300025945 Bacteria 59141
258 Ga0207667_10002765 3300025949 Bacteria 21699
259 Ga0207667_10024560 3300025949 Bacteria 6613
260 Ga0207667_10105945 3300025949 Bacteria 2901
261 Ga0207712_10021844 3300025961 Unclassified 4206
262 Ga0207668_10017636 3300025972 Bacteria 4477
263 Ga0207658_10015504 3300025986 Bacteria 5228
264 Ga0207703_10005055 3300026035 Bacteria 10680
265 Ga0207703_10017812 3300026035 Bacteria 5547
266 Ga0207678_10006837 3300026067 Bacteria 10116
267 Ga0207678_10038012 3300026067 Bacteria 4185
268 Ga0207702_10020345 3300026078 Bacteria 5497
269 Ga0207702_10070431 3300026078 Bacteria 3008
270 Ga0207702_10071647 3300026078 Unclassified 2985
271 Ga0207702_10087472 3300026078 Unclassified 2720
272 Ga0207641_10003028 3300026088 Bacteria 15142
273 Ga0207641_10100545 3300026088 Bacteria 2547
274 Ga0207648_10003472 3300026089 Bacteria 16526
275 Ga0207648_10008810 3300026089 Bacteria 9719
276 Ga0207648_10013581 3300026089 Bacteria 7566
277 Ga0207676_10001159 3300026095 Bacteria 19817
278 Ga0207674_10000195 3300026116 Bacteria 75067
279 Ga0207674_10005255 3300026116 Bacteria 15411
280 Ga0207674_10012337 3300026116 Bacteria 9552
281 Ga0207674_10014217 3300026116 Bacteria 8795
282 Ga0207674_10027846 3300026116 Bacteria 5971
283 Ga0207698_10014650 3300026142 Bacteria 5221
284 Ga0207428_10006241 3300027907 Bacteria 11014
285 Ga0265356_1002196 3300028017 Bacteria 2659
286 Ga0268266_10048970 3300028379 Unclassified 3622
287 Ga0268266_10056784 3300028379 Unclassified 3368
288 Ga0268266_10112428 3300028379 Bacteria 2414
289 Ga0265338_10036760 3300028800 Bacteria 4678
290 Ga0265338_10087614 3300028800 Unclassified 2586
291 Ga0265762_1000047 3300030760 Bacteria 14791
292 Ga0265762_1000119 3300030760 Bacteria 11713
293 Ga0265760_10003665 3300031090 Bacteria 4452
294 Ga0265760_10004688 3300031090 Bacteria 3914
295 Ga0265320_10012613 3300031240 Bacteria 4908
296 Ga0265325_10008279 3300031241 Bacteria 6144
297 Ga0265329_10005122 3300031242 Bacteria 5341
298 Ga0265340_10018092 3300031247 Bacteria 3638
299 Ga0265340_10019502 3300031247 Bacteria 3492
300 Ga0265339_10012940 3300031249 Bacteria 5072
301 Ga0265331_10014033 3300031250 Bacteria 4281
302 Ga0265327_10005758 3300031251 Bacteria 10205
303 Ga0265316_10007976 3300031344 Bacteria 9896
304 Ga0265316_10012474 3300031344 Bacteria 7618
305 Ga0265316_10021181 3300031344 Bacteria 5514
306 Ga0265313_10029334 3300031595 Bacteria 2847
307 Ga0316575_10015797 3300031665 Bacteria 2849
308 Ga0265314_10001830 3300031711 Bacteria 22865
309 Ga0265342_10018550 3300031712 Unclassified 4504
310 Ga0316576_10016383 3300031727 Bacteria 5003
311 Ga0316576_10030732 3300031727 Bacteria 3806
312 Ga0316577_10037808 3300031733 Bacteria 2698
313 Ga0373926_0020707 3300035083 Bacteria 2272
314 Ga0373936_0003749 3300035113 Bacteria 5712
315 Ga0373936_0004184 3300035113 Bacteria 5439
316 Ga0373943_0015251 3300035170 Unclassified 3489
317 Ga0316574_0028881 3300035398 Bacteria 3347
318 Ga0373931_0050446 3300035691 Unclassified 2214
319 Ga0373935_0001112 3300035692 Bacteria 14666
320 Ga0373927_0001003 3300035695 Bacteria 21498
321 Ga0373927_0003563 3300035695 Bacteria 11117
322 Ga0373927_0037250 3300035695 Unclassified 3162
323 Ga0373927_0064070 3300035695 Unclassified 2378
324 Ga0373933_0019816 3300035724 Bacteria 3807
325 Ga0373947_0000654 3300035725 Bacteria 20536
326 Ga0373947_0060933 3300035725 Unclassified 2292
327 Ga0373937_0010244 3300036401 Bacteria 8181
328 Ga0316582_0017749 3300036647 Unclassified 4126
329 Ga0316584_0003563 3300036712 Bacteria 10166
330 Ga0373925_0001810 3300037068 Bacteria 17840
331 Ga0373925_0004495 3300037068 Bacteria 10536
332 Ga0373925_0005431 3300037068 Bacteria 9494
333 Ga0373925_0047378 3300037068 Unclassified 3199
334 Ga0436364_0129406 3300037853 Bacteria 129389
335 Ga0436364_0182678 3300037853 Bacteria 2397
336 Ga0436364_0364196 3300037853 Bacteria 9193
337 Ga0436364_0429914 3300037853 Bacteria 25106
338 Ga0436364_0694113 3300037853 Bacteria 6712
339 Ga0436364_0833529 3300037853 Bacteria 5918
340 Ga0436364_0950683 3300037853 Bacteria 12092
341 Ga0436364_1126569 3300037853 Bacteria 23832
342 Ga0436364_1415525 3300037853 Bacteria 425173
343 Ga0400490_50811 3300038726 Bacteria 28544
344 Ga0400491_19925 3300038727 Unclassified 3722
345 Ga0436365_0305600 3300039437 Bacteria 13729
346 Ga0436365_1141893 3300039437 Bacteria 3282
347 Ga0436365_1208206 3300039437 Unclassified 2186
348 Ga0436360_0199082 3300039438 Bacteria 17935
349 Ga0436361_0362536 3300039447 Bacteria 55339
350 Ga0453683_0052626 3300044673 Bacteria 2549
351 Ga0453684_0000285 3300044712 Bacteria 218061
352 Ga0453684_0108991 3300044712 Unclassified 3370
353 Ga0453684_0224366 3300044712 Unclassified 2174
354 Ga0466967_0071618 3300045976 Unclassified 3104
355 Ga0495629_0000001 3300046459 Bacteria 807972
356 Ga0495629_0000223 3300046459 Bacteria 50594
357 Ga0495580_0007898 3300046472 Bacteria 8510
358 Ga0495580_0014414 3300046472 Bacteria 5995
359 Ga0495580_0020340 3300046472 Bacteria 4913
360 Ga0495580_0020794 3300046472 Unclassified 4851
361 Ga0495580_0028323 3300046472 Unclassified 4073
362 Ga0495580_0049132 3300046472 Bacteria 2985
363 Ga0495582_0000304 3300046473 Bacteria 27144
364 Ga0495639_0000200 3300046475 Bacteria 31147
365 Ga0495639_0004425 3300046475 Bacteria 6021
366 Ga0495628_0001418 3300046516 Bacteria 22010
367 Ga0495666_0000444 3300046526 Bacteria 18428
368 Ga0495665_0006637 3300046531 Bacteria 6245
369 Ga0495586_0001339 3300046535 Bacteria 13684
370 Ga0495634_0049897 3300046642 Unclassified 2812
371 Ga0495635_0001739 3300046663 Bacteria 14653
372 Ga0495635_0001860 3300046663 Bacteria 14291
373 Ga0495658_0000050 3300046683 Bacteria 59328
374 Ga0495658_0003745 3300046683 Bacteria 7523
375 Ga0495613_0004840 3300046689 Bacteria 10101
376 Ga0495600_0015101 3300046809 Bacteria 4878
377 Ga0495581_0000533 3300047315 Bacteria 19573
378 Ga0495581_0004358 3300047315 Bacteria 8173
379 Ga0495581_0018527 3300047315 Bacteria 4043
380 Ga0495674_0009853 3300047319 Bacteria 9070
381 Ga0495676_0060082 3300047321 Bacteria 2981
382 Ga0495676_0081361 3300047321 Unclassified 2455
383 Ga0495680_0000855 3300047322 Bacteria 33862
384 Ga0495680_0014117 3300047322 Bacteria 6937
385 Ga0495684_0003138 3300047471 Bacteria 12957
386 Ga0495684_0008281 3300047471 Bacteria 8051
387 Ga0495593_0037396 3300047673 Unclassified 2626
388 Ga0495593_0042234 3300047673 Unclassified 2448
389 Ga0496101_0034595 3300048904 Bacteria 3569
390 Ga0496101_0088275 3300048904 Unclassified 2303
391 Ga0496102_0000786 3300048905 Bacteria 30824
392 Ga0496103_0010049 3300048906 Bacteria 5595
393 Ga0496104_0064043 3300048907 Bacteria 3488
394 Ga0496108_0000689 3300048911 Bacteria 26147
395 Ga0496109_0001300 3300048912 Bacteria 20670
396 Ga0496110_0008161 3300048913 Bacteria 8412
397 Ga0496112_0006571 3300048915 Bacteria 10232
398 Ga0496112_0042724 3300048915 Unclassified 4435
399 Ga0496113_0004283 3300048916 Bacteria 8742
400 Ga0496114_0056420 3300048917 Bacteria 3278
401 Ga0496115_0005311 3300048918 Bacteria 9368
402 Ga0496115_0058424 3300048918 Bacteria 3104
403 Ga0501031_0031112 3300049568 Unclassified 3482
404 Ga0501034_0005548 3300049571 Bacteria 13759
405 Ga0501036_0006546 3300049572 Bacteria 9463
406 Ga0501038_0002663 3300049574 Bacteria 16687
407 Ga0501043_0002656 3300049579 Bacteria 15035
408 Ga0501046_0008360 3300049580 Bacteria 9025
409 Ga0501047_0074264 3300049581 Bacteria 3274
410 Ga0501047_0093436 3300049581 Bacteria 2887
411 Ga0501067_0001084 3300049583 Bacteria 14678
412 Ga0501068_0001098 3300049584 Bacteria 14339
413 Ga0501069_0008677 3300049585 Bacteria 5352
414 Ga0501072_0002147 3300049588 Bacteria 14720
415 Ga0501073_0000693 3300049589 Bacteria 23675
416 Ga0501074_0016460 3300049590 Bacteria 5369
417 Ga0501077_0001675 3300049593 Bacteria 13335
418 Ga0501079_0013592 3300049741 Bacteria 6209
419 Ga0501080_0000425 3300049742 Bacteria 32493
420 Ga0501083_0024101 3300049744 Unclassified 4218
421 Ga0501035_0010386 3300049822 Bacteria 8635
422 Ga0501044_0004017 3300049823 Bacteria 16491
423 Ga0501044_0011035 3300049823 Bacteria 9803
424 Ga0501044_0025313 3300049823 Bacteria 6288
425 nmdc:mga05p37_55472_c1 3300050507 Bacteria 4876
426 nmdc:mga0qj67_63894_c1 3300050509 Bacteria 2927
427 nmdc:mga06r32_158831_c1 3300050510 Bacteria 2243
428 nmdc:mga06r32_66774_c1 3300050510 Bacteria 3471
429 nmdc:mga06r32_76683_c1 3300050510 Unclassified 3246
430 nmdc:mga08y16_15978_c1 3300050511 Bacteria 7890
431 nmdc:mga08y16_21766_c1 3300050511 Bacteria 6765
432 nmdc:mga08y16_65517_c1 3300050511 Bacteria 3792
433 nmdc:mga0n895_1564_c1 3300050512 Bacteria 17207
434 nmdc:mga0rr50_40678_c1 3300050513 Bacteria 3381
435 nmdc:mga0rr50_6304_c1 3300050513 Bacteria 7204
436 nmdc:mga0rr50_7316_c1 3300050513 Bacteria 6796
437 nmdc:mga08x19_13580_c1 3300050514 Bacteria 4926
438 nmdc:mga08x19_2888_c1 3300050514 Bacteria 10345
439 nmdc:mga0a205_1800_c1 3300050515 Bacteria 18534
440 nmdc:mga0a205_27020_c1 3300050515 Bacteria 5479
441 nmdc:mga0a205_31888_c1 3300050515 Bacteria 5051
442 nmdc:mga0a205_53316_c1 3300050515 Bacteria 3903
443 nmdc:mga0a205_77850_c2 3300050515 Unclassified 2221
444 nmdc:mga0a205_7943_c1 3300050515 Bacteria 9634
445 Ga0495619_0000904 3300053085 Bacteria 19429
446 Ga0501084_0000102 3300054114 Bacteria 63120
447 Ga0496109_0116390
448 LJNas_1001186
449 Ga0070683_100001813
450 Ga0070683_100013744
451 Ga0070683_100037266
452 Ga0070690_100010185
453 Ga0070677_10006410
454 Ga0068869_100000935
455 Ga0070660_100019546
456 Ga0070660_100029488
457 Ga0070689_100027198
458 Ga0070661_100031125
459 Ga0070669_100017769
460 Ga0070673_100018739
461 Ga0070688_100011613
462 Ga0070688_100052670
463 Ga0070659_100002666
464 Ga0070709_10024125
465 Ga0070714_100090134
466 Ga0070714_100102692
467 Ga0070713_100006287
468 Ga0070713_100016524
469 Ga0070713_100019074
470 Ga0070713_100021247
471 Ga0070710_10001549
472 Ga0070710_10020546
473 Ga0070711_100012621
474 Ga0070694_100000206
475 Ga0070708_100000459
476 Ga0070708_100001910
477 Ga0070708_100002946
478 Ga0070708_100003001
479 Ga0070708_100043094
480 Ga0070708_100101119
481 Ga0070663_100009274
482 Ga0070663_100017079
483 Ga0070681_10003238
484 Ga0070681_10006120
485 Ga0070681_10015620
486 Ga0070681_10027416
487 Ga0070706_100000278
488 Ga0070706_100000514
489 Ga0070706_100051391
490 Ga0070707_100000582
491 Ga0070707_100000662
492 Ga0070707_100008218
493 Ga0070698_100000133
494 Ga0070698_100002043
495 Ga0070699_100000005
496 Ga0070699_100000441
497 Ga0070699_100005822
498 Ga0070699_100020254
499 Ga0070699_100050903
500 Ga0070699_100055749
501 Ga0070699_100065478
502 Ga0070679_100012620
503 Ga0070679_100045711
504 Ga0070679_100068264
505 Ga0070679_100075571
506 Ga0070684_100001752
507 Ga0070684_100009298
508 Ga0070697_100000049
509 Ga0070697_100000158
510 Ga0070697_100001845
511 Ga0070697_100002751
512 Ga0068853_100006343
513 Ga0070695_100000797
514 Ga0070696_100008369
515 Ga0070696_100012476
516 Ga0070665_100013859
517 Ga0070665_100059261
518 Ga0070665_100109308
519 Ga0070704_100010501
520 Ga0068855_100008713
521 Ga0068855_100026254
522 Ga0068855_100083294
523 Ga0070664_100022774
524 Ga0068857_100003339
525 Ga0068857_100021579
526 Ga0068857_100042483
527 Ga0068856_100003024
528 Ga0068856_100005836
529 Ga0068856_100009211
530 Ga0068856_100027370
531 Ga0068852_100007669
532 Ga0068859_100007139
533 Ga0068859_100074603
534 Ga0068861_100065789
535 Ga0068863_100089989
536 Ga0068863_100102065
537 Ga0068858_100002610
538 Ga0068862_100018198
539 Ga0070717_10000796
540 Ga0070717_10001548
541 Ga0070717_10002364
542 Ga0070717_10007590
543 Ga0070717_10014887
544 Ga0070717_10015728
545 Ga0070717_10110950
546 Ga0070712_100035247
547 Ga0097621_100000838
548 Ga0097621_100002927
549 Ga0068871_100015350
550 Ga0068871_100018971
551 Ga0068871_100068355
552 Ga0075428_100008112
553 Ga0075428_100023082
554 Ga0075428_100061608
555 Ga0075431_100027837
556 Ga0075431_100111886
557 Ga0075433_10001098
558 Ga0075433_10032301
559 Ga0075433_10034984
560 Ga0075433_10126753
561 Ga0075434_100000195
562 Ga0075434_100083141
563 Ga0075429_100022330
564 Ga0075436_100003023
565 Ga0075436_100009930
566 Ga0097620_100007139
567 Ga0097620_100074601
568 Ga0075435_100000065
569 Ga0075435_100030080
570 Ga0075435_100102874
571 Ga0105240_10001610
572 Ga0105240_10001930
573 Ga0105240_10005237
574 Ga0105240_10008846
575 Ga0105240_10029292
576 Ga0105240_10073936
577 Ga0105240_10182795
578 Ga0111539_10017799
579 Ga0111539_10022933
580 Ga0105245_10000608
581 Ga0105245_10011140
582 Ga0105247_10006341
583 Ga0114129_10014435
584 Ga0105243_10027304
585 Ga0105241_10003799
586 Ga0105248_10021967
587 Ga0105248_10065169
588 Ga0105248_10136173
589 Ga0105237_10001240
590 Ga0105237_10007723
591 Ga0105237_10011705
592 Ga0105237_10021042
593 Ga0105238_10003660
594 Ga0105238_10013260
595 Ga0105238_10014582
596 Ga0105238_10030210
597 Ga0105238_10036145
598 Ga0105249_10024924
599 Ga0105239_10003038
600 Ga0105239_10014364
601 Ga0105239_10017417
602 Ga0105239_10085002
603 Ga0105246_10007122
604 Ga0105246_10011181
605 Ga0105246_10047937
606 Ga0157373_10010696
607 Ga0157370_10008436
608 Ga0157370_10033135
609 Ga0157369_10002053
610 Ga0157369_10013005
611 Ga0157369_10021280
612 Ga0157369_10036968
613 Ga0157369_10060054
614 Ga0157369_10064860
615 Ga0157369_10128354
616 Ga0157374_10005709
617 Ga0157374_10012766
618 Ga0157374_10014505
619 Ga0157378_10000162
620 Ga0157378_10024706
621 Ga0157378_10052298
622 Ga0163162_10002555
623 Ga0157372_10006920
624 Ga0157372_10007955
625 Ga0157372_10019456
626 Ga0157375_10032189
627 Ga0157375_10047271
628 Ga0157375_10092842
629 Ga0163163_10015294
630 Ga0163163_10027698
631 Ga0157379_10007009
632 Ga0157379_10057448
633 Ga0157379_10062392
634 Ga0157376_10048190
635 Ga0163161_10008769
636 Ga0213872_10000486
637 Ga0213876_10004905
638 Ga0213875_10000008
639 Ga0213875_10000359
640 Ga0213875_10023979
641 Ga0228598_1002346
642 Ga0207688_10007283
643 Ga0207680_10019827
644 Ga0207647_10002874
645 Ga0207647_10032472
646 Ga0207699_10039034
647 Ga0207645_10007489
648 Ga0207643_10000639
649 Ga0207684_10000614
650 Ga0207684_10001907
651 Ga0207684_10010520
652 Ga0207707_10005115
653 Ga0207707_10015373
654 Ga0207695_10005671
655 Ga0207695_10014308
656 Ga0207695_10014788
657 Ga0207695_10019875
658 Ga0207695_10022649
659 Ga0207695_10034701
660 Ga0207695_10041836
661 Ga0207695_10042313
662 Ga0207671_10019649
663 Ga0207671_10024264
664 Ga0207671_10025867
665 Ga0207693_10000402
666 Ga0207693_10051323
667 Ga0207660_10019093
668 Ga0207657_10001261
669 Ga0207657_10002326
670 Ga0207657_10006328
671 Ga0207657_10032900
672 Ga0207649_10001661
673 Ga0207649_10052830
674 Ga0207652_10017781
675 Ga0207646_10002238
676 Ga0207646_10003393
677 Ga0207646_10013181
678 Ga0207646_10028031
679 Ga0207694_10002979
680 Ga0207694_10007275
681 Ga0207694_10026422
682 Ga0207650_10000177
683 Ga0207687_10007210
684 Ga0207700_10016030
685 Ga0207700_10046015
686 Ga0207664_10070505
687 Ga0207690_10049218
688 Ga0207706_10000941
689 Ga0207706_10019421
690 Ga0207670_10003630
691 Ga0207670_10022488
692 Ga0207670_10029906
693 Ga0207704_10049968
694 Ga0207665_10000704
695 Ga0207665_10015427
696 Ga0207691_10001447
697 Ga0207711_10021821
698 Ga0207711_10022956
699 Ga0207689_10000542
700 Ga0207689_10002307
701 Ga0207689_10011534
702 Ga0207661_10002775
703 Ga0207679_10000143
704 Ga0207667_10002765
705 Ga0207667_10024560
706 Ga0207667_10105945
707 Ga0207712_10021844
708 Ga0207668_10017636
709 Ga0207658_10015504
710 Ga0207703_10005055
711 Ga0207703_10017812
712 Ga0207678_10006837
713 Ga0207678_10038012
714 Ga0207702_10020345
715 Ga0207702_10070431
716 Ga0207702_10071647
717 Ga0207702_10087472
718 Ga0207641_10003028
719 Ga0207641_10100545
720 Ga0207648_10003472
721 Ga0207648_10008810
722 Ga0207648_10013581
723 Ga0207676_10001159
724 Ga0207674_10000195
725 Ga0207674_10005255
726 Ga0207674_10012337
727 Ga0207674_10014217
728 Ga0207674_10027846
729 Ga0207698_10014650
730 Ga0207428_10006241
731 Ga0265356_1002196
732 Ga0268266_10048970
733 Ga0268266_10056784
734 Ga0268266_10112428
735 Ga0265338_10036760
736 Ga0265338_10087614
737 Ga0265762_1000047
738 Ga0265762_1000119
739 Ga0265760_10003665
740 Ga0265760_10004688
741 Ga0265320_10012613
742 Ga0265325_10008279
743 Ga0265329_10005122
744 Ga0265340_10018092
745 Ga0265340_10019502
746 Ga0265339_10012940
747 Ga0265331_10014033
748 Ga0265327_10005758
749 Ga0265316_10007976
750 Ga0265316_10012474
751 Ga0265316_10021181
752 Ga0265313_10029334
753 Ga0316575_10015797
754 Ga0265314_10001830
755 Ga0265342_10018550
756 Ga0316576_10016383
757 Ga0316576_10030732
758 Ga0316577_10037808
759 Ga0373926_0020707
760 Ga0373936_0003749
761 Ga0373936_0004184
762 Ga0373943_0015251
763 Ga0316574_0028881
764 Ga0373931_0050446
765 Ga0373935_0001112
766 Ga0373927_0001003
767 Ga0373927_0003563
768 Ga0373927_0037250
769 Ga0373927_0064070
770 Ga0373933_0019816
771 Ga0373947_0000654
772 Ga0373947_0060933
773 Ga0373937_0010244
774 Ga0316582_0017749
775 Ga0316584_0003563
776 Ga0373925_0001810
777 Ga0373925_0004495
778 Ga0373925_0005431
779 Ga0373925_0047378
780 Ga0436364_0129406
781 Ga0436364_0182678
782 Ga0436364_0364196
783 Ga0436364_0429914
784 Ga0436364_0694113
785 Ga0436364_0833529
786 Ga0436364_0950683
787 Ga0436364_1126569
788 Ga0436364_1415525
789 Ga0400490_50811
790 Ga0400491_19925
791 Ga0436365_0305600
792 Ga0436365_1141893
793 Ga0436365_1208206
794 Ga0436360_0199082
795 Ga0436361_0362536
796 Ga0453683_0052626
797 Ga0453684_0000285
798 Ga0453684_0108991
799 Ga0453684_0224366
800 Ga0466967_0071618
801 Ga0495629_0000001
802 Ga0495629_0000223
803 Ga0495580_0007898
804 Ga0495580_0014414
805 Ga0495580_0020340
806 Ga0495580_0020794
807 Ga0495580_0028323
808 Ga0495580_0049132
809 Ga0495582_0000304
810 Ga0495639_0000200
811 Ga0495639_0004425
812 Ga0495628_0001418
813 Ga0495666_0000444
814 Ga0495665_0006637
815 Ga0495586_0001339
816 Ga0495634_0049897
817 Ga0495635_0001739
818 Ga0495635_0001860
819 Ga0495658_0000050
820 Ga0495658_0003745
821 Ga0495613_0004840
822 Ga0495600_0015101
823 Ga0495581_0000533
824 Ga0495581_0004358
825 Ga0495581_0018527
826 Ga0495674_0009853
827 Ga0495676_0060082
828 Ga0495676_0081361
829 Ga0495680_0000855
830 Ga0495680_0014117
831 Ga0495684_0003138
832 Ga0495684_0008281
833 Ga0495593_0037396
834 Ga0495593_0042234
835 Ga0496101_0034595
836 Ga0496101_0088275
837 Ga0496102_0000786
838 Ga0496103_0010049
839 Ga0496104_0064043
840 Ga0496108_0000689
841 Ga0496109_0001300
842 Ga0496110_0008161
843 Ga0496112_0006571
844 Ga0496112_0042724
845 Ga0496113_0004283
846 Ga0496114_0056420
847 Ga0496115_0005311
848 Ga0496115_0058424
849 Ga0501031_0031112
850 Ga0501034_0005548
851 Ga0501036_0006546
852 Ga0501038_0002663
853 Ga0501043_0002656
854 Ga0501046_0008360
855 Ga0501047_0074264
856 Ga0501047_0093436
857 Ga0501067_0001084
858 Ga0501068_0001098
859 Ga0501069_0008677
860 Ga0501072_0002147
861 Ga0501073_0000693
862 Ga0501074_0016460
863 Ga0501077_0001675
864 Ga0501079_0013592
865 Ga0501080_0000425
866 Ga0501083_0024101
867 Ga0501035_0010386
868 Ga0501044_0004017
869 Ga0501044_0011035
870 Ga0501044_0025313
871 nmdc:mga05p37_55472_c1
872 nmdc:mga0qj67_63894_c1
873 nmdc:mga06r32_158831_c1
874 nmdc:mga06r32_66774_c1
875 nmdc:mga06r32_76683_c1
876 nmdc:mga08y16_15978_c1
877 nmdc:mga08y16_21766_c1
878 nmdc:mga08y16_65517_c1
879 nmdc:mga0n895_1564_c1
880 nmdc:mga0rr50_40678_c1
881 nmdc:mga0rr50_6304_c1
882 nmdc:mga0rr50_7316_c1
883 nmdc:mga08x19_13580_c1
884 nmdc:mga08x19_2888_c1
885 nmdc:mga0a205_1800_c1
886 nmdc:mga0a205_27020_c1
887 nmdc:mga0a205_31888_c1
888 nmdc:mga0a205_53316_c1
889 nmdc:mga0a205_77850_c2
890 nmdc:mga0a205_7943_c1
891 Ga0495619_0000904
892 Ga0501084_0000102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03169

OPT

OPT oligopeptide transporter protein

60

665

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wst-assembly1.cif.gz_A cryo-em structure of the barley yellow stripe 1 transporter in complex with fe(iii)-dma 0.5621 26 615
7wst-assembly1.cif.gz_A cryo-em structure of the barley yellow stripe 1 transporter in complex with fe(iii)-dma 0.553 26 615
6zog-assembly1.cif.gz_C minocycline binding to the deep binding pocket of acrb-i38f_i671t 0.2769 358 601
7ouk-assembly1.cif.gz_A bdm88855 inhibitor bound to the transmembrane domain of acrb 0.2603 354 586
7rr7-assembly1.cif.gz_A multidrug efflux pump subunit acrb 0.2381 354 520
ID Description Score Start End Superfamily
af_P71749_10_605_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7596 27 597 1.20.1740.10
af_P71749_10_605_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7297 27 597 1.20.1740.10
af_I1KNR1_88_323_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2751 299 565 1.20.1250.20
af_I1KNR1_88_323_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2459 299 565 1.20.1250.20
af_Q4DVR4_17_534_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2415 305 498 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A662JW73-F1-model_v4 Oligopeptide transporter, OPT family 0.9485 16 166 GO:0016020
GO:0035673
AF-A0A7V5W6F9-F1-model_v4 Oligopeptide transporter, OPT family 0.9359 13 190 GO:0016020
GO:0035673
AF-A0A7V5YT26-F1-model_v4 Oligopeptide transporter, OPT family 0.9329 1 375 GO:0016020
GO:0035673
AF-A0A7V5YT26-F1-model_v4 Oligopeptide transporter, OPT family 0.9305 1 375 GO:0016020
GO:0035673
AF-A0A2N1VAE9-F1-model_v4 Oligopeptide transporter, OPT family 0.9291 10 179 GO:0016020
GO:0035673

Map