F445799

General Info

Members Datasets Scaffolds Average Seq Length
446 225 892 219

Family's Representative Sequence

Representative Sequence 3300046559|Ga0495667_0109455|Ga0495667_0109455_467_1180
Length 237
Sequence VNRVEALWPLGRYTFGWLGALSARVRYYGSERIPRIGGVVLAINHFSWIDVPCFGVACPRNTYFVAKVEAHRVPGLGQFIRTFGAISVRRGESDRDAVRRMREVVREGNVLGLFVEGTRQRSGVPGPVQPGAAMVALQEGVPVVCGAIHGTQEYKVGNFAPATIAWGEPLHFTGLPRGAKGYRAASEEIQAEIHRLWLWAKDMHRSSSRAVDAGAGPAGPKGVAVPRCTALPLRQPP

Samples

Sample ID Description Type Environment
1 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
96 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
109 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
110 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
130 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.76
Rhizosphere 88.57
Stem 0
Stem Tuber 0
Unclassified 4.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495667_0109455 3300046559 Bacteria 1785
2 rootH1_10074658 3300003316 Bacteria 2740
3 Ga0070658_10124041 3300005327 Bacteria 2148
4 Ga0070683_100018967 3300005329 Bacteria 6103
5 Ga0070680_100099307 3300005336 Bacteria 2415
6 Ga0070682_100061653 3300005337 Bacteria 2374
7 Ga0070682_100302795 3300005337 Unclassified 1174
8 Ga0068868_100191070 3300005338 Bacteria 1703
9 Ga0070660_100113989 3300005339 Bacteria 2153
10 Ga0070691_10266562 3300005341 Unclassified 924
11 Ga0070661_100011588 3300005344 Bacteria 6146
12 Ga0070661_100098408 3300005344 Bacteria 2173
13 Ga0070661_100228109 3300005344 Bacteria 1431
14 Ga0070671_100911337 3300005355 Bacteria 768
15 Ga0070659_100108257 3300005366 Bacteria 2242
16 Ga0070659_100118868 3300005366 Bacteria 2138
17 Ga0070659_100124367 3300005366 Bacteria 2092
18 Ga0070714_100172805 3300005435 Bacteria 1962
19 Ga0070713_100217606 3300005436 Bacteria 1732
20 Ga0070710_10001863 3300005437 Bacteria 9938
21 Ga0070711_100123240 3300005439 Bacteria 1920
22 Ga0070681_10062706 3300005458 Bacteria 3691
23 Ga0070681_10076294 3300005458 Bacteria 3310
24 Ga0070681_10212729 3300005458 Bacteria 1849
25 Ga0070681_10226219 3300005458 Bacteria 1785
26 Ga0070681_10229351 3300005458 Bacteria 1771
27 Ga0070681_10395180 3300005458 Bacteria 1294
28 Ga0068867_100961859 3300005459 Bacteria 772
29 Ga0070707_100606613 3300005468 Bacteria 1057
30 Ga0070698_100141306 3300005471 Bacteria 2358
31 Ga0070698_100185846 3300005471 Bacteria 2016
32 Ga0070698_100187873 3300005471 Bacteria 2004
33 Ga0070699_100099895 3300005518 Bacteria 2543
34 Ga0070679_100231439 3300005530 Bacteria 1807
35 Ga0070679_100320798 3300005530 Bacteria 1498
36 Ga0070679_100385605 3300005530 Bacteria 1348
37 Ga0070679_100454809 3300005530 Bacteria 1225
38 Ga0070679_100489878 3300005530 Bacteria 1173
39 Ga0070684_100122501 3300005535 Bacteria 2340
40 Ga0070684_100132088 3300005535 Bacteria 2252
41 Ga0068853_100232824 3300005539 Bacteria 1686
42 Ga0070672_100779650 3300005543 Bacteria 840
43 Ga0070696_100596474 3300005546 Bacteria 890
44 Ga0070693_100053307 3300005547 Bacteria 2322
45 Ga0070665_100467239 3300005548 Bacteria 1272
46 Ga0068855_100120935 3300005563 Bacteria 2997
47 Ga0070664_100688397 3300005564 Bacteria 952
48 Ga0068857_100100559 3300005577 Bacteria 2594
49 Ga0068857_100198196 3300005577 Bacteria 1830
50 Ga0068856_100332671 3300005614 Bacteria 1536
51 Ga0068856_100633523 3300005614 Bacteria 1090
52 Ga0068852_100600724 3300005616 Bacteria 1104
53 Ga0068852_100668838 3300005616 Unclassified 1047
54 Ga0068863_100104554 3300005841 Bacteria 2694
55 Ga0081455_10012688 3300005937 Bacteria 8386
56 Ga0070717_10030636 3300006028 Bacteria 4322
57 Ga0070717_10195201 3300006028 Bacteria 1770
58 Ga0070716_100224794 3300006173 Bacteria 1263
59 Ga0070712_100395416 3300006175 Bacteria 1140
60 Ga0075433_10159385 3300006852 Bacteria 2008
61 Ga0075433_10640822 3300006852 Bacteria 932
62 Ga0075434_100001364 3300006871 Bacteria 20503
63 Ga0075434_100015520 3300006871 Bacteria 7308
64 Ga0075434_100357888 3300006871 Bacteria 1480
65 Ga0075436_100119271 3300006914 Bacteria 1845
66 Ga0075436_100279555 3300006914 Bacteria 1193
67 Ga0075435_100018754 3300007076 Bacteria 5270
68 Ga0075435_100064642 3300007076 Bacteria 2973
69 Ga0105240_10581119 3300009093 Bacteria 1236
70 Ga0111539_10019734 3300009094 Bacteria 8314
71 Ga0111539_10099231 3300009094 Bacteria 3420
72 Ga0111539_10127897 3300009094 Bacteria 2975
73 Ga0111539_10306654 3300009094 Bacteria 1847
74 Ga0111539_10883190 3300009094 Bacteria 1040
75 Ga0105245_10081136 3300009098 Bacteria 2964
76 Ga0105245_10159449 3300009098 Bacteria 2140
77 Ga0105245_10309332 3300009098 Bacteria 1553
78 Ga0105245_10777261 3300009098 Unclassified 995
79 Ga0114129_10069680 3300009147 Bacteria 4902
80 Ga0114129_10353410 3300009147 Bacteria 1946
81 Ga0114129_10407080 3300009147 Bacteria 1792
82 Ga0105242_10023724 3300009176 Bacteria 4837
83 Ga0105238_10333137 3300009551 Bacteria 1505
84 Ga0105238_10482771 3300009551 Bacteria 1239
85 Ga0105239_10156459 3300010375 Bacteria 2545
86 Ga0157371_10081813 3300013102 Bacteria 2286
87 Ga0157370_10606250 3300013104 Bacteria 1002
88 Ga0157369_10001471 3300013105 Bacteria 28864
89 Ga0157369_10009921 3300013105 Bacteria 10883
90 Ga0157369_10054574 3300013105 Bacteria 4315
91 Ga0157369_10097679 3300013105 Bacteria 3133
92 Ga0157369_10196606 3300013105 Bacteria 2117
93 Ga0157369_10350722 3300013105 Bacteria 1533
94 Ga0157369_10695102 3300013105 Bacteria 1047
95 Ga0157374_10307475 3300013296 Bacteria 1569
96 Ga0157374_10660985 3300013296 Unclassified 1057
97 Ga0163162_10897825 3300013306 Bacteria 999
98 Ga0157372_10520967 3300013307 Bacteria 1386
99 Ga0157372_10736965 3300013307 Bacteria 1146
100 Ga0157377_10118421 3300014745 Bacteria 1602
101 Ga0157379_10179134 3300014968 Bacteria 1915
102 Ga0157376_10055665 3300014969 Bacteria 3301
103 Ga0206353_11511822 3300020082 Bacteria 1307
104 Ga0207699_10438502 3300025906 Bacteria 935
105 Ga0207705_10207566 3300025909 Bacteria 1485
106 Ga0207684_10060139 3300025910 Unclassified 3227
107 Ga0207707_10017590 3300025912 Bacteria 6235
108 Ga0207707_10050968 3300025912 Bacteria 3604
109 Ga0207707_10142872 3300025912 Bacteria 2092
110 Ga0207707_10172511 3300025912 Bacteria 1890
111 Ga0207693_10000967 3300025915 Bacteria 25810
112 Ga0207663_10123196 3300025916 Bacteria 1779
113 Ga0207663_10161868 3300025916 Bacteria 1581
114 Ga0207663_10258141 3300025916 Bacteria 1286
115 Ga0207660_10100464 3300025917 Bacteria 2160
116 Ga0207660_10101033 3300025917 Bacteria 2154
117 Ga0207657_10002021 3300025919 Bacteria 21926
118 Ga0207657_10005856 3300025919 Bacteria 12803
119 Ga0207657_10014341 3300025919 Bacteria 7740
120 Ga0207649_10089413 3300025920 Bacteria 2013
121 Ga0207649_10093462 3300025920 Bacteria 1974
122 Ga0207649_10244947 3300025920 Bacteria 1288
123 Ga0207652_10098848 3300025921 Bacteria 2574
124 Ga0207652_10150806 3300025921 Bacteria 2081
125 Ga0207652_10322736 3300025921 Bacteria 1394
126 Ga0207652_10343806 3300025921 Bacteria 1347
127 Ga0207646_10197416 3300025922 Bacteria 1817
128 Ga0207687_10046283 3300025927 Bacteria 3011
129 Ga0207687_10060771 3300025927 Bacteria 2666
130 Ga0207700_10138556 3300025928 Bacteria 1996
131 Ga0207664_10114020 3300025929 Bacteria 2252
132 Ga0207664_10170787 3300025929 Bacteria 1861
133 Ga0207644_10568425 3300025931 Bacteria 940
134 Ga0207690_10025468 3300025932 Bacteria 3715
135 Ga0207690_10459581 3300025932 Bacteria 1024
136 Ga0207686_10074821 3300025934 Bacteria 2190
137 Ga0207669_10036377 3300025937 Bacteria 2813
138 Ga0207669_10312943 3300025937 Bacteria 1198
139 Ga0207665_10201543 3300025939 Bacteria 1450
140 Ga0207661_10004279 3300025944 Bacteria 9996
141 Ga0207661_10114815 3300025944 Bacteria 2284
142 Ga0207661_10281544 3300025944 Bacteria 1486
143 Ga0207667_10087547 3300025949 Bacteria 3222
144 Ga0207640_10401990 3300025981 Bacteria 1116
145 Ga0207702_10403568 3300026078 Bacteria 1319
146 Ga0207702_10498255 3300026078 Bacteria 1187
147 Ga0207648_10367099 3300026089 Bacteria 1299
148 Ga0207674_10054865 3300026116 Bacteria 4055
149 Ga0207698_10611855 3300026142 Unclassified 1075
150 Ga0207428_10011973 3300027907 Bacteria 7635
151 Ga0207428_10290801 3300027907 Bacteria 1211
152 Ga0268266_10254070 3300028379 Bacteria 1627
153 Ga0265334_10036122 3300028573 Bacteria 1952
154 Ga0265336_10001479 3300028666 Bacteria 10670
155 Ga0265338_10002198 3300028800 Bacteria 29876
156 Ga0265338_10129336 3300028800 Bacteria 1997
157 Ga0307408_100523543 3300031548 Bacteria 1042
158 Ga0265313_10013063 3300031595 Bacteria 5017
159 Ga0307405_10147966 3300031731 Bacteria 1648
160 Ga0307405_10436382 3300031731 Bacteria 1035
161 Ga0307416_100149062 3300032002 Bacteria 2142
162 Ga0307416_100422478 3300032002 Bacteria 1378
163 Ga0373939_0046065 3300035114 Unclassified 1334
164 Ga0373957_0218961 3300035120 Bacteria 797
165 Ga0373943_0088694 3300035170 Bacteria 1598
166 Ga0373935_0163182 3300035692 Bacteria 1520
167 Ga0373927_0025208 3300035695 Bacteria 3887
168 Ga0373947_0017709 3300035725 Bacteria 4098
169 Ga0373925_0011636 3300037068 Bacteria 6363
170 Ga0395899_0019676 3300037312 Bacteria 5125
171 Ga0395899_0353185 3300037312 Bacteria 983
172 Ga0395900_0425012 3300037418 Bacteria 1289
173 Ga0395900_0491372 3300037418 Bacteria 1179
174 Ga0395898_0297008 3300037466 Bacteria 1541
175 Ga0395905_0047429 3300037471 Bacteria 4026
176 Ga0395905_0138981 3300037471 Bacteria 2285
177 Ga0395901_0020684 3300038443 Bacteria 6736
178 Ga0395901_0027796 3300038443 Bacteria 5817
179 Ga0395901_0028908 3300038443 Bacteria 5703
180 Ga0395901_0686041 3300038443 Bacteria 1023
181 Ga0395901_1177159 3300038443 Unclassified 733
182 Ga0436363_0040361 3300039450 Bacteria 1432
183 Ga0451835_0752978 3300041492 Bacteria 893
184 Ga0450920_027387 3300042122 Bacteria 1115
185 Ga0450920_055318 3300042122 Bacteria 798
186 Ga0450907_014761 3300042146 Bacteria 1304
187 Ga0466969_0010645 3300044656 Bacteria 4874
188 Ga0466966_0005169 3300044684 Bacteria 8578
189 Ga0466966_0256500 3300044684 Unclassified 1053
190 Ga0466966_0584736 3300044684 Unclassified 672
191 Ga0466963_0000953 3300044694 Bacteria 14854
192 Ga0466963_0028799 3300044694 Bacteria 3570
193 Ga0466963_0081802 3300044694 Bacteria 2188
194 Ga0466971_0006009 3300044719 Bacteria 5283
195 Ga0466971_0067830 3300044719 Bacteria 1617
196 Ga0466971_0101037 3300044719 Bacteria 1325
197 Ga0466968_0042537 3300044735 Bacteria 1921
198 Ga0466957_0029080 3300044842 Bacteria 3293
199 Ga0466957_0074002 3300044842 Bacteria 2112
200 Ga0466957_0090822 3300044842 Bacteria 1913
201 Ga0466957_0108121 3300044842 Bacteria 1761
202 Ga0466957_0250178 3300044842 Bacteria 1178
203 Ga0466957_0387488 3300044842 Bacteria 954
204 Ga0466959_0000811 3300045049 Bacteria 18406
205 Ga0466959_0014304 3300045049 Bacteria 5759
206 Ga0466958_0097611 3300045836 Bacteria 1823
207 Ga0466958_0112431 3300045836 Bacteria 1700
208 Ga0466958_0125970 3300045836 Bacteria 1606
209 Ga0466958_0230913 3300045836 Bacteria 1181
210 Ga0466967_0002006 3300045976 Bacteria 12390
211 Ga0466967_0044344 3300045976 Bacteria 3857
212 Ga0466967_0172018 3300045976 Bacteria 2038
213 Ga0466967_0268460 3300045976 Bacteria 1634
214 Ga0466967_0279283 3300045976 Bacteria 1602
215 Ga0466967_0294896 3300045976 Bacteria 1559
216 Ga0466967_0344763 3300045976 Bacteria 1441
217 Ga0466967_0643633 3300045976 Bacteria 1048
218 Ga0466967_1193754 3300045976 Bacteria 758
219 Ga0466967_1432468 3300045976 Bacteria 688
220 Ga0495592_0026904 3300046454 Bacteria 4360
221 Ga0495603_0047546 3300046455 Bacteria 2555
222 Ga0495629_0049018 3300046459 Bacteria 2961
223 Ga0495641_0033485 3300046461 Bacteria 2438
224 Ga0495641_0156267 3300046461 Unclassified 1020
225 Ga0495651_0015464 3300046462 Bacteria 5903
226 Ga0495653_0018775 3300046463 Bacteria 5611
227 Ga0495653_0205320 3300046463 Bacteria 1334
228 Ga0495582_0028415 3300046473 Bacteria 3070
229 Ga0495662_0022813 3300046476 Bacteria 3022
230 Ga0495664_0004127 3300046477 Bacteria 7930
231 Ga0495584_0353730 3300046491 Bacteria 746
232 Ga0495585_0151503 3300046492 Bacteria 1209
233 Ga0495594_0251932 3300046499 Bacteria 1006
234 Ga0495596_0050037 3300046500 Bacteria 1638
235 Ga0495628_0024515 3300046516 Bacteria 4937
236 Ga0495628_0025406 3300046516 Bacteria 4839
237 Ga0495628_0356360 3300046516 Bacteria 1075
238 Ga0495630_0031776 3300046517 Bacteria 3932
239 Ga0495663_0231030 3300046525 Bacteria 652
240 Ga0495642_0279449 3300046528 Bacteria 731
241 Ga0495652_0058469 3300046529 Bacteria 3264
242 Ga0495652_0074722 3300046529 Bacteria 2817
243 Ga0495652_0081718 3300046529 Bacteria 2665
244 Ga0495652_0348101 3300046529 Bacteria 1062
245 Ga0495640_0034869 3300046533 Bacteria 3563
246 Ga0495640_0070000 3300046533 Bacteria 2359
247 Ga0495586_0035899 3300046535 Bacteria 2663
248 Ga0495621_0431956 3300046539 Bacteria 562
249 Ga0495645_0012854 3300046543 Bacteria 5909
250 Ga0495635_0048472 3300046663 Bacteria 2929
251 Ga0495635_0146092 3300046663 Bacteria 1610
252 Ga0495659_0046586 3300046664 Bacteria 1566
253 Ga0495588_0165959 3300046674 Bacteria 1168
254 Ga0495657_0013479 3300046675 Bacteria 6030
255 Ga0495657_0266405 3300046675 Bacteria 1028
256 Ga0495599_0004707 3300046678 Bacteria 8101
257 Ga0495623_0042197 3300046679 Bacteria 2907
258 Ga0495646_0085275 3300046680 Bacteria 1833
259 Ga0495647_0089416 3300046681 Bacteria 1260
260 Ga0495613_0088088 3300046689 Bacteria 2249
261 Ga0495624_0060794 3300046690 Bacteria 2368
262 Ga0495589_0316387 3300046794 Bacteria 722
263 Ga0495600_0038893 3300046809 Bacteria 3097
264 Ga0495604_0015755 3300047317 Bacteria 6034
265 Ga0495604_0129315 3300047317 Bacteria 1817
266 Ga0495636_0227038 3300047318 Bacteria 858
267 Ga0495674_0124307 3300047319 Bacteria 2178
268 Ga0495674_0132058 3300047319 Bacteria 2103
269 Ga0495674_0141455 3300047319 Bacteria 2022
270 Ga0495676_0132379 3300047321 Bacteria 1798
271 Ga0495676_0302071 3300047321 Bacteria 1079
272 Ga0495680_0157252 3300047322 Bacteria 1653
273 Ga0495680_0200096 3300047322 Bacteria 1433
274 Ga0495680_0443891 3300047322 Bacteria 889
275 Ga0495684_0097921 3300047471 Bacteria 2218
276 Ga0495684_0202515 3300047471 Bacteria 1463
277 Ga0495593_0119139 3300047673 Bacteria 1344
278 Ga0495602_0050345 3300048088 Bacteria 3722
279 Ga0495602_0221298 3300048088 Bacteria 1429
280 Ga0495614_0137874 3300048089 Bacteria 1083
281 Ga0496100_0212900 3300048903 Bacteria 1414
282 Ga0496100_0277963 3300048903 Bacteria 1247
283 Ga0496101_0022505 3300048904 Bacteria 4339
284 Ga0496101_0033778 3300048904 Bacteria 3610
285 Ga0496101_0161179 3300048904 Bacteria 1720
286 Ga0496101_0230378 3300048904 Bacteria 1440
287 Ga0496102_0032889 3300048905 Bacteria 4661
288 Ga0496104_0086390 3300048907 Bacteria 2994
289 Ga0496105_0075977 3300048908 Bacteria 2774
290 Ga0496105_0121098 3300048908 Bacteria 2158
291 Ga0496105_0163702 3300048908 Bacteria 1825
292 Ga0496106_0140217 3300048909 Bacteria 1901
293 Ga0496107_0185646 3300048910 Bacteria 1544
294 Ga0496108_0008173 3300048911 Bacteria 8488
295 Ga0496108_0072900 3300048911 Bacteria 2899
296 Ga0496108_0090534 3300048911 Bacteria 2600
297 Ga0496108_0155985 3300048911 Bacteria 1971
298 Ga0496108_0264859 3300048911 Bacteria 1496
299 Ga0496109_0007464 3300048912 Bacteria 9259
300 Ga0496109_0052826 3300048912 Bacteria 3705
301 Ga0496109_0189642 3300048912 Bacteria 1932
302 Ga0496109_0592887 3300048912 Bacteria 1044
303 Ga0496110_0003366 3300048913 Bacteria 12209
304 Ga0496110_0446064 3300048913 Bacteria 1179
305 Ga0496111_0016643 3300048914 Bacteria 5070
306 Ga0496111_0043406 3300048914 Bacteria 3232
307 Ga0496111_0267170 3300048914 Bacteria 1269
308 Ga0496112_0004653 3300048915 Bacteria 11666
309 Ga0496112_0008043 3300048915 Bacteria 9411
310 Ga0496112_0024167 3300048915 Bacteria 5816
311 Ga0496112_0047207 3300048915 Bacteria 4225
312 Ga0496112_0106735 3300048915 Bacteria 2770
313 Ga0496112_0134775 3300048915 Bacteria 2440
314 Ga0496112_0180828 3300048915 Bacteria 2073
315 Ga0496112_0211519 3300048915 Bacteria 1896
316 Ga0496112_0267894 3300048915 Bacteria 1657
317 Ga0496112_0865358 3300048915 Bacteria 827
318 Ga0496113_0164776 3300048916 Bacteria 1753
319 Ga0496113_0181719 3300048916 Bacteria 1667
320 Ga0496113_0206414 3300048916 Unclassified 1563
321 Ga0496113_0563517 3300048916 Bacteria 913
322 Ga0496113_0574841 3300048916 Bacteria 903
323 Ga0496114_0095567 3300048917 Bacteria 2529
324 Ga0496114_0104846 3300048917 Bacteria 2418
325 Ga0496114_0116432 3300048917 Bacteria 2294
326 Ga0496115_0003114 3300048918 Bacteria 11922
327 Ga0496115_0015864 3300048918 Bacteria 5723
328 Ga0496115_0130026 3300048918 Bacteria 2075
329 Ga0501031_0018758 3300049568 Bacteria 4503
330 Ga0501031_0024956 3300049568 Bacteria 3898
331 Ga0501032_0027197 3300049569 Bacteria 3932
332 Ga0501032_0079287 3300049569 Bacteria 2186
333 Ga0501033_0010290 3300049570 Bacteria 7177
334 Ga0501033_0133962 3300049570 Bacteria 1793
335 Ga0501034_0089929 3300049571 Bacteria 3068
336 Ga0501034_0157652 3300049571 Bacteria 2243
337 Ga0501034_0207333 3300049571 Bacteria 1916
338 Ga0501036_0003339 3300049572 Bacteria 12820
339 Ga0501036_0016680 3300049572 Bacteria 6133
340 Ga0501036_0594061 3300049572 Bacteria 918
341 Ga0501037_0011348 3300049573 Bacteria 6560
342 Ga0501037_0111025 3300049573 Bacteria 1975
343 Ga0501037_0316979 3300049573 Bacteria 1080
344 Ga0501038_0025374 3300049574 Bacteria 5284
345 Ga0501039_0014641 3300049575 Bacteria 6003
346 Ga0501039_0107753 3300049575 Bacteria 2177
347 Ga0501039_0278255 3300049575 Unclassified 1315
348 Ga0501039_0522798 3300049575 Bacteria 932
349 Ga0501040_0011175 3300049576 Bacteria 5871
350 Ga0501040_0063839 3300049576 Bacteria 2534
351 Ga0501040_0290304 3300049576 Bacteria 1169
352 Ga0501041_0004920 3300049577 Bacteria 7762
353 Ga0501041_0032007 3300049577 Bacteria 3178
354 Ga0501041_0090924 3300049577 Bacteria 1884
355 Ga0501042_0002287 3300049578 Bacteria 11703
356 Ga0501042_0155054 3300049578 Bacteria 1652
357 Ga0501042_0197796 3300049578 Bacteria 1449
358 Ga0501043_0095341 3300049579 Bacteria 2338
359 Ga0501043_0195317 3300049579 Bacteria 1572
360 Ga0501046_0051044 3300049580 Bacteria 3265
361 Ga0501046_0087263 3300049580 Bacteria 2404
362 Ga0501047_0106366 3300049581 Bacteria 2686
363 Ga0501047_0162786 3300049581 Bacteria 2102
364 Ga0501048_0008446 3300049582 Bacteria 7789
365 Ga0501067_0030934 3300049583 Bacteria 2970
366 Ga0501067_0050058 3300049583 Bacteria 2315
367 Ga0501067_0065689 3300049583 Bacteria 2008
368 Ga0501067_0233461 3300049583 Bacteria 1024
369 Ga0501068_0044685 3300049584 Bacteria 2667
370 Ga0501068_0095254 3300049584 Bacteria 1840
371 Ga0501069_0005523 3300049585 Bacteria 6583
372 Ga0501069_0011754 3300049585 Bacteria 4642
373 Ga0501069_0047080 3300049585 Bacteria 2393
374 Ga0501069_0115571 3300049585 Bacteria 1530
375 Ga0501069_0213691 3300049585 Bacteria 1120
376 Ga0501070_0017445 3300049586 Bacteria 6026
377 Ga0501070_0359033 3300049586 Bacteria 1182
378 Ga0501071_0002017 3300049587 Bacteria 12147
379 Ga0501071_0218361 3300049587 Bacteria 1434
380 Ga0501071_0386327 3300049587 Bacteria 1068
381 Ga0501072_0007738 3300049588 Bacteria 8157
382 Ga0501072_0096226 3300049588 Bacteria 2353
383 Ga0501072_0130300 3300049588 Bacteria 2004
384 Ga0501072_0210009 3300049588 Bacteria 1551
385 Ga0501072_0223292 3300049588 Bacteria 1501
386 Ga0501073_0008816 3300049589 Bacteria 7460
387 Ga0501073_0012825 3300049589 Bacteria 6108
388 Ga0501074_0002480 3300049590 Bacteria 12871
389 Ga0501074_0048260 3300049590 Bacteria 3076
390 Ga0501075_0007094 3300049591 Bacteria 7747
391 Ga0501076_0107142 3300049592 Bacteria 2256
392 Ga0501076_0445002 3300049592 Unclassified 1066
393 Ga0501077_0001814 3300049593 Bacteria 12904
394 Ga0501077_0157784 3300049593 Bacteria 1440
395 Ga0501079_0051517 3300049741 Bacteria 3178
396 Ga0501079_0118311 3300049741 Bacteria 2060
397 Ga0501079_0150925 3300049741 Bacteria 1811
398 Ga0501080_0018912 3300049742 Bacteria 6379
399 Ga0501080_0050025 3300049742 Bacteria 3890
400 Ga0501080_0306030 3300049742 Bacteria 1441
401 Ga0501080_0321761 3300049742 Bacteria 1400
402 Ga0501080_0797361 3300049742 Bacteria 828
403 Ga0501081_0005254 3300049743 Bacteria 8345
404 Ga0501081_0043551 3300049743 Bacteria 3079
405 Ga0501083_0007301 3300049744 Bacteria 7835
406 Ga0501083_0007303 3300049744 Bacteria 7833
407 Ga0501083_0179451 3300049744 Bacteria 1383
408 Ga0501083_0555338 3300049744 Bacteria 747
409 Ga0501035_0005944 3300049822 Bacteria 11490
410 Ga0501035_0015821 3300049822 Bacteria 6962
411 Ga0501035_0169963 3300049822 Bacteria 1884
412 Ga0501045_0049333 3300049824 Bacteria 3069
413 Ga0501045_0298526 3300049824 Bacteria 1199
414 nmdc:mga05p37_116986_c1 3300050507 Bacteria 3276
415 nmdc:mga05p37_144239_c2 3300050507 Unclassified 1216
416 nmdc:mga06r32_286233_c1 3300050510 Bacteria 1635
417 nmdc:mga06r32_443395_c1 3300050510 Bacteria 1278
418 nmdc:mga08y16_131796_c1 3300050511 Bacteria 2599
419 nmdc:mga08y16_509023_c1 3300050511 Unclassified 1222
420 nmdc:mga08y16_61491_c1 3300050511 Bacteria 3922
421 nmdc:mga08y16_737540_c1 3300050511 Unclassified 982
422 nmdc:mga0n895_51829_c1 3300050512 Bacteria 4027
423 nmdc:mga0rr50_160754_c1 3300050513 Bacteria 1823
424 nmdc:mga0a205_589369_c1 3300050515 Bacteria 965
425 Ga0495601_0046691 3300053077 Bacteria 2726
426 Ga0495601_0165882 3300053077 Bacteria 1443
427 Ga0495601_0208756 3300053077 Bacteria 1276
428 Ga0495612_0005684 3300053078 Bacteria 5151
429 Ga0495612_0078353 3300053078 Bacteria 1386
430 Ga0495655_0069245 3300053083 Bacteria 982
431 Ga0495595_0136456 3300053084 Bacteria 1201
432 Ga0495619_0039313 3300053085 Bacteria 3088
433 Ga0495619_0185273 3300053085 Bacteria 1440
434 Ga0501084_0001287 3300054114 Bacteria 19758
435 Ga0501084_0007954 3300054114 Bacteria 8730
436 Ga0501084_0119205 3300054114 Bacteria 2218
437 Ga0501084_0162090 3300054114 Bacteria 1887
438 Ga0590075_010500 3300059424 Bacteria 2231
439 Ga0501082_0009391 3300060353 Bacteria 8421
440 Ga0501082_0046139 3300060353 Bacteria 3757
441 Ga0501082_0233849 3300060353 Bacteria 1599
442 Ga0466962_0001646 3300061719 Bacteria 10476
443 Ga0466962_0004988 3300061719 Bacteria 6383
444 Ga0530510_0009291 3300061734 Bacteria 6898
445 Ga0530510_0054405 3300061734 Bacteria 2892
446 Ga0530510_0310785 3300061734 Bacteria 1180
447 Ga0495667_0109455
448 rootH1_10074658
449 Ga0070658_10124041
450 Ga0070683_100018967
451 Ga0070680_100099307
452 Ga0070682_100061653
453 Ga0070682_100302795
454 Ga0068868_100191070
455 Ga0070660_100113989
456 Ga0070691_10266562
457 Ga0070661_100011588
458 Ga0070661_100098408
459 Ga0070661_100228109
460 Ga0070671_100911337
461 Ga0070659_100108257
462 Ga0070659_100118868
463 Ga0070659_100124367
464 Ga0070714_100172805
465 Ga0070713_100217606
466 Ga0070710_10001863
467 Ga0070711_100123240
468 Ga0070681_10062706
469 Ga0070681_10076294
470 Ga0070681_10212729
471 Ga0070681_10226219
472 Ga0070681_10229351
473 Ga0070681_10395180
474 Ga0068867_100961859
475 Ga0070707_100606613
476 Ga0070698_100141306
477 Ga0070698_100185846
478 Ga0070698_100187873
479 Ga0070699_100099895
480 Ga0070679_100231439
481 Ga0070679_100320798
482 Ga0070679_100385605
483 Ga0070679_100454809
484 Ga0070679_100489878
485 Ga0070684_100122501
486 Ga0070684_100132088
487 Ga0068853_100232824
488 Ga0070672_100779650
489 Ga0070696_100596474
490 Ga0070693_100053307
491 Ga0070665_100467239
492 Ga0068855_100120935
493 Ga0070664_100688397
494 Ga0068857_100100559
495 Ga0068857_100198196
496 Ga0068856_100332671
497 Ga0068856_100633523
498 Ga0068852_100600724
499 Ga0068852_100668838
500 Ga0068863_100104554
501 Ga0081455_10012688
502 Ga0070717_10030636
503 Ga0070717_10195201
504 Ga0070716_100224794
505 Ga0070712_100395416
506 Ga0075433_10159385
507 Ga0075433_10640822
508 Ga0075434_100001364
509 Ga0075434_100015520
510 Ga0075434_100357888
511 Ga0075436_100119271
512 Ga0075436_100279555
513 Ga0075435_100018754
514 Ga0075435_100064642
515 Ga0105240_10581119
516 Ga0111539_10019734
517 Ga0111539_10099231
518 Ga0111539_10127897
519 Ga0111539_10306654
520 Ga0111539_10883190
521 Ga0105245_10081136
522 Ga0105245_10159449
523 Ga0105245_10309332
524 Ga0105245_10777261
525 Ga0114129_10069680
526 Ga0114129_10353410
527 Ga0114129_10407080
528 Ga0105242_10023724
529 Ga0105238_10333137
530 Ga0105238_10482771
531 Ga0105239_10156459
532 Ga0157371_10081813
533 Ga0157370_10606250
534 Ga0157369_10001471
535 Ga0157369_10009921
536 Ga0157369_10054574
537 Ga0157369_10097679
538 Ga0157369_10196606
539 Ga0157369_10350722
540 Ga0157369_10695102
541 Ga0157374_10307475
542 Ga0157374_10660985
543 Ga0163162_10897825
544 Ga0157372_10520967
545 Ga0157372_10736965
546 Ga0157377_10118421
547 Ga0157379_10179134
548 Ga0157376_10055665
549 Ga0206353_11511822
550 Ga0207699_10438502
551 Ga0207705_10207566
552 Ga0207684_10060139
553 Ga0207707_10017590
554 Ga0207707_10050968
555 Ga0207707_10142872
556 Ga0207707_10172511
557 Ga0207693_10000967
558 Ga0207663_10123196
559 Ga0207663_10161868
560 Ga0207663_10258141
561 Ga0207660_10100464
562 Ga0207660_10101033
563 Ga0207657_10002021
564 Ga0207657_10005856
565 Ga0207657_10014341
566 Ga0207649_10089413
567 Ga0207649_10093462
568 Ga0207649_10244947
569 Ga0207652_10098848
570 Ga0207652_10150806
571 Ga0207652_10322736
572 Ga0207652_10343806
573 Ga0207646_10197416
574 Ga0207687_10046283
575 Ga0207687_10060771
576 Ga0207700_10138556
577 Ga0207664_10114020
578 Ga0207664_10170787
579 Ga0207644_10568425
580 Ga0207690_10025468
581 Ga0207690_10459581
582 Ga0207686_10074821
583 Ga0207669_10036377
584 Ga0207669_10312943
585 Ga0207665_10201543
586 Ga0207661_10004279
587 Ga0207661_10114815
588 Ga0207661_10281544
589 Ga0207667_10087547
590 Ga0207640_10401990
591 Ga0207702_10403568
592 Ga0207702_10498255
593 Ga0207648_10367099
594 Ga0207674_10054865
595 Ga0207698_10611855
596 Ga0207428_10011973
597 Ga0207428_10290801
598 Ga0268266_10254070
599 Ga0265334_10036122
600 Ga0265336_10001479
601 Ga0265338_10002198
602 Ga0265338_10129336
603 Ga0307408_100523543
604 Ga0265313_10013063
605 Ga0307405_10147966
606 Ga0307405_10436382
607 Ga0307416_100149062
608 Ga0307416_100422478
609 Ga0373939_0046065
610 Ga0373957_0218961
611 Ga0373943_0088694
612 Ga0373935_0163182
613 Ga0373927_0025208
614 Ga0373947_0017709
615 Ga0373925_0011636
616 Ga0395899_0019676
617 Ga0395899_0353185
618 Ga0395900_0425012
619 Ga0395900_0491372
620 Ga0395898_0297008
621 Ga0395905_0047429
622 Ga0395905_0138981
623 Ga0395901_0020684
624 Ga0395901_0027796
625 Ga0395901_0028908
626 Ga0395901_0686041
627 Ga0395901_1177159
628 Ga0436363_0040361
629 Ga0451835_0752978
630 Ga0450920_027387
631 Ga0450920_055318
632 Ga0450907_014761
633 Ga0466969_0010645
634 Ga0466966_0005169
635 Ga0466966_0256500
636 Ga0466966_0584736
637 Ga0466963_0000953
638 Ga0466963_0028799
639 Ga0466963_0081802
640 Ga0466971_0006009
641 Ga0466971_0067830
642 Ga0466971_0101037
643 Ga0466968_0042537
644 Ga0466957_0029080
645 Ga0466957_0074002
646 Ga0466957_0090822
647 Ga0466957_0108121
648 Ga0466957_0250178
649 Ga0466957_0387488
650 Ga0466959_0000811
651 Ga0466959_0014304
652 Ga0466958_0097611
653 Ga0466958_0112431
654 Ga0466958_0125970
655 Ga0466958_0230913
656 Ga0466967_0002006
657 Ga0466967_0044344
658 Ga0466967_0172018
659 Ga0466967_0268460
660 Ga0466967_0279283
661 Ga0466967_0294896
662 Ga0466967_0344763
663 Ga0466967_0643633
664 Ga0466967_1193754
665 Ga0466967_1432468
666 Ga0495592_0026904
667 Ga0495603_0047546
668 Ga0495629_0049018
669 Ga0495641_0033485
670 Ga0495641_0156267
671 Ga0495651_0015464
672 Ga0495653_0018775
673 Ga0495653_0205320
674 Ga0495582_0028415
675 Ga0495662_0022813
676 Ga0495664_0004127
677 Ga0495584_0353730
678 Ga0495585_0151503
679 Ga0495594_0251932
680 Ga0495596_0050037
681 Ga0495628_0024515
682 Ga0495628_0025406
683 Ga0495628_0356360
684 Ga0495630_0031776
685 Ga0495663_0231030
686 Ga0495642_0279449
687 Ga0495652_0058469
688 Ga0495652_0074722
689 Ga0495652_0081718
690 Ga0495652_0348101
691 Ga0495640_0034869
692 Ga0495640_0070000
693 Ga0495586_0035899
694 Ga0495621_0431956
695 Ga0495645_0012854
696 Ga0495635_0048472
697 Ga0495635_0146092
698 Ga0495659_0046586
699 Ga0495588_0165959
700 Ga0495657_0013479
701 Ga0495657_0266405
702 Ga0495599_0004707
703 Ga0495623_0042197
704 Ga0495646_0085275
705 Ga0495647_0089416
706 Ga0495613_0088088
707 Ga0495624_0060794
708 Ga0495589_0316387
709 Ga0495600_0038893
710 Ga0495604_0015755
711 Ga0495604_0129315
712 Ga0495636_0227038
713 Ga0495674_0124307
714 Ga0495674_0132058
715 Ga0495674_0141455
716 Ga0495676_0132379
717 Ga0495676_0302071
718 Ga0495680_0157252
719 Ga0495680_0200096
720 Ga0495680_0443891
721 Ga0495684_0097921
722 Ga0495684_0202515
723 Ga0495593_0119139
724 Ga0495602_0050345
725 Ga0495602_0221298
726 Ga0495614_0137874
727 Ga0496100_0212900
728 Ga0496100_0277963
729 Ga0496101_0022505
730 Ga0496101_0033778
731 Ga0496101_0161179
732 Ga0496101_0230378
733 Ga0496102_0032889
734 Ga0496104_0086390
735 Ga0496105_0075977
736 Ga0496105_0121098
737 Ga0496105_0163702
738 Ga0496106_0140217
739 Ga0496107_0185646
740 Ga0496108_0008173
741 Ga0496108_0072900
742 Ga0496108_0090534
743 Ga0496108_0155985
744 Ga0496108_0264859
745 Ga0496109_0007464
746 Ga0496109_0052826
747 Ga0496109_0189642
748 Ga0496109_0592887
749 Ga0496110_0003366
750 Ga0496110_0446064
751 Ga0496111_0016643
752 Ga0496111_0043406
753 Ga0496111_0267170
754 Ga0496112_0004653
755 Ga0496112_0008043
756 Ga0496112_0024167
757 Ga0496112_0047207
758 Ga0496112_0106735
759 Ga0496112_0134775
760 Ga0496112_0180828
761 Ga0496112_0211519
762 Ga0496112_0267894
763 Ga0496112_0865358
764 Ga0496113_0164776
765 Ga0496113_0181719
766 Ga0496113_0206414
767 Ga0496113_0563517
768 Ga0496113_0574841
769 Ga0496114_0095567
770 Ga0496114_0104846
771 Ga0496114_0116432
772 Ga0496115_0003114
773 Ga0496115_0015864
774 Ga0496115_0130026
775 Ga0501031_0018758
776 Ga0501031_0024956
777 Ga0501032_0027197
778 Ga0501032_0079287
779 Ga0501033_0010290
780 Ga0501033_0133962
781 Ga0501034_0089929
782 Ga0501034_0157652
783 Ga0501034_0207333
784 Ga0501036_0003339
785 Ga0501036_0016680
786 Ga0501036_0594061
787 Ga0501037_0011348
788 Ga0501037_0111025
789 Ga0501037_0316979
790 Ga0501038_0025374
791 Ga0501039_0014641
792 Ga0501039_0107753
793 Ga0501039_0278255
794 Ga0501039_0522798
795 Ga0501040_0011175
796 Ga0501040_0063839
797 Ga0501040_0290304
798 Ga0501041_0004920
799 Ga0501041_0032007
800 Ga0501041_0090924
801 Ga0501042_0002287
802 Ga0501042_0155054
803 Ga0501042_0197796
804 Ga0501043_0095341
805 Ga0501043_0195317
806 Ga0501046_0051044
807 Ga0501046_0087263
808 Ga0501047_0106366
809 Ga0501047_0162786
810 Ga0501048_0008446
811 Ga0501067_0030934
812 Ga0501067_0050058
813 Ga0501067_0065689
814 Ga0501067_0233461
815 Ga0501068_0044685
816 Ga0501068_0095254
817 Ga0501069_0005523
818 Ga0501069_0011754
819 Ga0501069_0047080
820 Ga0501069_0115571
821 Ga0501069_0213691
822 Ga0501070_0017445
823 Ga0501070_0359033
824 Ga0501071_0002017
825 Ga0501071_0218361
826 Ga0501071_0386327
827 Ga0501072_0007738
828 Ga0501072_0096226
829 Ga0501072_0130300
830 Ga0501072_0210009
831 Ga0501072_0223292
832 Ga0501073_0008816
833 Ga0501073_0012825
834 Ga0501074_0002480
835 Ga0501074_0048260
836 Ga0501075_0007094
837 Ga0501076_0107142
838 Ga0501076_0445002
839 Ga0501077_0001814
840 Ga0501077_0157784
841 Ga0501079_0051517
842 Ga0501079_0118311
843 Ga0501079_0150925
844 Ga0501080_0018912
845 Ga0501080_0050025
846 Ga0501080_0306030
847 Ga0501080_0321761
848 Ga0501080_0797361
849 Ga0501081_0005254
850 Ga0501081_0043551
851 Ga0501083_0007301
852 Ga0501083_0007303
853 Ga0501083_0179451
854 Ga0501083_0555338
855 Ga0501035_0005944
856 Ga0501035_0015821
857 Ga0501035_0169963
858 Ga0501045_0049333
859 Ga0501045_0298526
860 nmdc:mga05p37_116986_c1
861 nmdc:mga05p37_144239_c2
862 nmdc:mga06r32_286233_c1
863 nmdc:mga06r32_443395_c1
864 nmdc:mga08y16_131796_c1
865 nmdc:mga08y16_509023_c1
866 nmdc:mga08y16_61491_c1
867 nmdc:mga08y16_737540_c1
868 nmdc:mga0n895_51829_c1
869 nmdc:mga0rr50_160754_c1
870 nmdc:mga0a205_589369_c1
871 Ga0495601_0046691
872 Ga0495601_0165882
873 Ga0495601_0208756
874 Ga0495612_0005684
875 Ga0495612_0078353
876 Ga0495655_0069245
877 Ga0495595_0136456
878 Ga0495619_0039313
879 Ga0495619_0185273
880 Ga0501084_0001287
881 Ga0501084_0007954
882 Ga0501084_0119205
883 Ga0501084_0162090
884 Ga0590075_010500
885 Ga0501082_0009391
886 Ga0501082_0046139
887 Ga0501082_0233849
888 Ga0466962_0001646
889 Ga0466962_0004988
890 Ga0530510_0009291
891 Ga0530510_0054405
892 Ga0530510_0310785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

24

149

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7971 15 201
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7516 15 196
1k30-assembly1.cif.gz_A crystal structure analysis of squash (cucurbita moschata) glycerol-3-phosphate (1)-acyltransferase 0.7191 1 208
3u7e-assembly1.cif.gz_B crystal structure of mpnkp catalytic fragment (d170a) 0.6856 33 145
1iuq-assembly1.cif.gz_A the 1.55 a crystal structure of glycerol-3-phosphate acyltransferase 0.6787 12 208
ID Description Score Start End Superfamily
af_O53516_20_152_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8809 26 147 3.40.50.2000
af_Q8I5S7_22_233_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8658 26 147 3.40.50.2000
af_Q4DRS8_153_366_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8624 29 147 3.40.50.2000
af_O07809_23_150_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8592 29 147 3.40.50.2000
af_I6YDI9_312_439_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8521 26 147 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7V9DJ86-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9441 1 215 GO:0003841
GO:0006654
AF-A0A537TUS9-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9391 2 209 GO:0003841
GO:0006654
AF-A0A7V9P417-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9377 8 227 GO:0003841
GO:0006654
AF-A0A7V9DJ86-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9357 1 215 GO:0003841
GO:0006654
AF-A0A538GA38-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9272 2 209 GO:0003841
GO:0006654

Map