F445775
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 446 | 264 | 443 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300042439|Ga0439464_0301123|Ga0439464_0301123_39_467 |
| Length | 142 |
| Sequence | MRVMVLSKATEGMELGEPTPEALEAFAAMDRFTEELVKAGVFVAAAGLKNGAQSKRIVVTEGGSRTVIDGPFAETRELIVGFSIWEVKDMDEALAWAKRAPTLPGEMEIRPFYEAADLAAFVTPEELAAAPRDGERGKLGVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090001 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB | Metagenome | Rhizosphere |
| 2 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 3 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 4 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 170 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 172 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 173 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 180 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 181 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 188 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 192 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 193 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 194 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 195 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 196 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 197 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 198 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 199 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 200 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 201 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 202 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 228 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 229 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 230 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 231 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 234 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 239 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 241 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 242 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 243 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 244 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 245 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 246 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 254 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 255 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 256 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 257 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 258 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 259 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 260 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 261 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 262 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 263 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 264 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.33 |
| Metatranscriptomes | 0 |
| Isolates | 0.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.8 |
| Nodule | 0 |
| Rhizoplane | 4.04 |
| Rhizosphere | 78.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNB_F6ESG4R02JQ950 | 2088090001 | Bacteria | 531 |
| 2 | JGI24739J22299_10042547 | 3300001989 | Bacteria | 1506 |
| 3 | JGI24737J22298_10005942 | 3300001990 | Bacteria | 4195 |
| 4 | JGI24743J22301_10150980 | 3300001991 | Bacteria | 521 |
| 5 | JGI24735J21928_10020780 | 3300002067 | Bacteria | 2009 |
| 6 | JGI24738J21930_10016124 | 3300002075 | Bacteria | 1582 |
| 7 | JGI24744J21845_10001231 | 3300002077 | Bacteria | 5024 |
| 8 | Ga0055531_10009924 | 3300003794 | Bacteria | 4809 |
| 9 | Ga0065704_10126899 | 3300005289 | Bacteria | 1683 |
| 10 | Ga0065712_10002464 | 3300005290 | Bacteria | 5762 |
| 11 | Ga0065715_10424166 | 3300005293 | Bacteria | 847 |
| 12 | Ga0065715_10525224 | 3300005293 | Bacteria | 760 |
| 13 | Ga0065707_10111443 | 3300005295 | Bacteria | 2393 |
| 14 | Ga0070658_10803862 | 3300005327 | Bacteria | 817 |
| 15 | Ga0070676_10240031 | 3300005328 | Bacteria | 1205 |
| 16 | Ga0070676_10732128 | 3300005328 | Bacteria | 725 |
| 17 | Ga0070676_11540509 | 3300005328 | Bacteria | 513 |
| 18 | Ga0070690_100465903 | 3300005330 | Bacteria | 939 |
| 19 | Ga0070677_10169096 | 3300005333 | Bacteria | 1032 |
| 20 | Ga0068869_100473458 | 3300005334 | Bacteria | 1042 |
| 21 | Ga0070666_10487726 | 3300005335 | Bacteria | 893 |
| 22 | Ga0070666_10617726 | 3300005335 | Bacteria | 791 |
| 23 | Ga0070660_100085560 | 3300005339 | Bacteria | 2480 |
| 24 | Ga0070660_100125384 | 3300005339 | Bacteria | 2052 |
| 25 | Ga0070689_100228846 | 3300005340 | Bacteria | 1527 |
| 26 | Ga0070689_101746614 | 3300005340 | Bacteria | 567 |
| 27 | Ga0070691_10051722 | 3300005341 | Bacteria | 1963 |
| 28 | Ga0070687_100054518 | 3300005343 | Bacteria | 2083 |
| 29 | Ga0070661_100183898 | 3300005344 | Bacteria | 1591 |
| 30 | Ga0070692_11228545 | 3300005345 | Bacteria | 535 |
| 31 | Ga0070668_100154251 | 3300005347 | Bacteria | 1860 |
| 32 | Ga0070668_100391743 | 3300005347 | Bacteria | 1184 |
| 33 | Ga0070668_100788289 | 3300005347 | Bacteria | 843 |
| 34 | Ga0070669_100009424 | 3300005353 | Bacteria | 6952 |
| 35 | Ga0070669_100705022 | 3300005353 | Bacteria | 852 |
| 36 | Ga0070675_100001422 | 3300005354 | Bacteria | 17585 |
| 37 | Ga0070675_100105520 | 3300005354 | Bacteria | 2377 |
| 38 | Ga0070675_100286949 | 3300005354 | Bacteria | 1448 |
| 39 | Ga0070671_100025461 | 3300005355 | Bacteria | 4855 |
| 40 | Ga0070671_100211844 | 3300005355 | Bacteria | 1643 |
| 41 | Ga0070671_100309407 | 3300005355 | Bacteria | 1346 |
| 42 | Ga0070674_100370331 | 3300005356 | Bacteria | 1162 |
| 43 | Ga0070673_100004870 | 3300005364 | Bacteria | 8547 |
| 44 | Ga0070673_100634376 | 3300005364 | Bacteria | 977 |
| 45 | Ga0070688_100241229 | 3300005365 | Bacteria | 1283 |
| 46 | Ga0070659_100047492 | 3300005366 | Bacteria | 3368 |
| 47 | Ga0070659_100377836 | 3300005366 | Bacteria | 1193 |
| 48 | Ga0070659_100530678 | 3300005366 | Bacteria | 1006 |
| 49 | Ga0070667_100430521 | 3300005367 | Bacteria | 1204 |
| 50 | Ga0070701_10421329 | 3300005438 | Bacteria | 850 |
| 51 | Ga0070705_100587324 | 3300005440 | Bacteria | 860 |
| 52 | Ga0070700_100418700 | 3300005441 | Bacteria | 1012 |
| 53 | Ga0070700_100555329 | 3300005441 | Bacteria | 893 |
| 54 | Ga0070694_100869270 | 3300005444 | Bacteria | 743 |
| 55 | Ga0070694_101184903 | 3300005444 | Bacteria | 640 |
| 56 | Ga0070678_100021895 | 3300005456 | Bacteria | 4225 |
| 57 | Ga0070678_100346669 | 3300005456 | Bacteria | 1276 |
| 58 | Ga0070678_101626728 | 3300005456 | Bacteria | 607 |
| 59 | Ga0070662_100168657 | 3300005457 | Bacteria | 1717 |
| 60 | Ga0070662_101103083 | 3300005457 | Bacteria | 681 |
| 61 | Ga0070681_11158163 | 3300005458 | Bacteria | 695 |
| 62 | Ga0068867_100205535 | 3300005459 | Bacteria | 1578 |
| 63 | Ga0070685_10028427 | 3300005466 | Bacteria | 3097 |
| 64 | Ga0070698_101562545 | 3300005471 | Bacteria | 611 |
| 65 | Ga0068853_100192822 | 3300005539 | Bacteria | 1852 |
| 66 | Ga0070672_100034204 | 3300005543 | Bacteria | 3856 |
| 67 | Ga0070672_100117121 | 3300005543 | Bacteria | 2177 |
| 68 | Ga0070672_100131608 | 3300005543 | Bacteria | 2057 |
| 69 | Ga0070672_102128361 | 3300005543 | Bacteria | 506 |
| 70 | Ga0070686_100107552 | 3300005544 | Bacteria | 1894 |
| 71 | Ga0070695_100567520 | 3300005545 | Bacteria | 887 |
| 72 | Ga0070696_100181946 | 3300005546 | Bacteria | 1560 |
| 73 | Ga0070696_100614554 | 3300005546 | Bacteria | 878 |
| 74 | Ga0070693_100415026 | 3300005547 | Bacteria | 936 |
| 75 | Ga0070665_100000397 | 3300005548 | Bacteria | 64128 |
| 76 | Ga0070665_100020573 | 3300005548 | Bacteria | 6630 |
| 77 | Ga0070704_100073774 | 3300005549 | Bacteria | 2487 |
| 78 | Ga0070704_100485505 | 3300005549 | Bacteria | 1070 |
| 79 | Ga0068855_100000144 | 3300005563 | Bacteria | 91639 |
| 80 | Ga0068855_101203036 | 3300005563 | Bacteria | 788 |
| 81 | Ga0070664_100115309 | 3300005564 | Bacteria | 2348 |
| 82 | Ga0070664_100395348 | 3300005564 | Bacteria | 1263 |
| 83 | Ga0068857_100408144 | 3300005577 | Bacteria | 1265 |
| 84 | Ga0068857_101171215 | 3300005577 | Bacteria | 744 |
| 85 | Ga0068854_100099130 | 3300005578 | Bacteria | 2182 |
| 86 | Ga0070702_100036036 | 3300005615 | Bacteria | 2737 |
| 87 | Ga0068852_101150173 | 3300005616 | Bacteria | 797 |
| 88 | Ga0068852_101418482 | 3300005616 | Bacteria | 717 |
| 89 | Ga0068852_101848826 | 3300005616 | Bacteria | 626 |
| 90 | Ga0068852_102467574 | 3300005616 | Bacteria | 540 |
| 91 | Ga0068859_101696706 | 3300005617 | Bacteria | 698 |
| 92 | Ga0068864_100031721 | 3300005618 | Bacteria | 4485 |
| 93 | Ga0068864_100484445 | 3300005618 | Bacteria | 1188 |
| 94 | Ga0068864_101023828 | 3300005618 | Bacteria | 820 |
| 95 | Ga0068866_10162479 | 3300005718 | Bacteria | 1304 |
| 96 | Ga0068861_100043170 | 3300005719 | Bacteria | 3382 |
| 97 | Ga0068861_100047351 | 3300005719 | Bacteria | 3245 |
| 98 | Ga0068861_100445968 | 3300005719 | Bacteria | 1159 |
| 99 | Ga0068861_100546066 | 3300005719 | Bacteria | 1055 |
| 100 | Ga0068851_10228332 | 3300005834 | Bacteria | 1048 |
| 101 | Ga0068863_100029480 | 3300005841 | Bacteria | 5237 |
| 102 | Ga0068863_101160814 | 3300005841 | Bacteria | 778 |
| 103 | Ga0068858_100000355 | 3300005842 | Bacteria | 48299 |
| 104 | Ga0068858_100220141 | 3300005842 | Bacteria | 1797 |
| 105 | Ga0068858_101492289 | 3300005842 | Bacteria | 667 |
| 106 | Ga0068860_100227389 | 3300005843 | Bacteria | 1812 |
| 107 | Ga0068862_100018454 | 3300005844 | Bacteria | 5810 |
| 108 | Ga0068862_100019817 | 3300005844 | Bacteria | 5617 |
| 109 | Ga0068862_100066451 | 3300005844 | Bacteria | 3108 |
| 110 | Ga0068862_100354754 | 3300005844 | Bacteria | 1361 |
| 111 | Ga0068862_100823887 | 3300005844 | Bacteria | 908 |
| 112 | Ga0068862_101205290 | 3300005844 | Bacteria | 756 |
| 113 | Ga0075365_10004655 | 3300006038 | Bacteria | 7305 |
| 114 | Ga0075365_10048736 | 3300006038 | Bacteria | 2789 |
| 115 | Ga0075365_10050150 | 3300006038 | Bacteria | 2753 |
| 116 | Ga0075368_10207242 | 3300006042 | Bacteria | 830 |
| 117 | Ga0075368_10230868 | 3300006042 | Bacteria | 788 |
| 118 | Ga0075368_10399306 | 3300006042 | Bacteria | 604 |
| 119 | Ga0075363_100022596 | 3300006048 | Bacteria | 3181 |
| 120 | Ga0075363_100039864 | 3300006048 | Bacteria | 2474 |
| 121 | Ga0075364_10126339 | 3300006051 | Bacteria | 1715 |
| 122 | Ga0075364_10171125 | 3300006051 | Bacteria | 1468 |
| 123 | Ga0075432_10481430 | 3300006058 | Bacteria | 550 |
| 124 | Ga0075362_10000312 | 3300006177 | Bacteria | 13807 |
| 125 | Ga0075362_10045680 | 3300006177 | Bacteria | 1946 |
| 126 | Ga0075362_10087871 | 3300006177 | Bacteria | 1440 |
| 127 | Ga0075367_10012895 | 3300006178 | Bacteria | 4477 |
| 128 | Ga0075367_10028911 | 3300006178 | Bacteria | 3166 |
| 129 | Ga0075367_10058146 | 3300006178 | Bacteria | 2300 |
| 130 | Ga0075367_10062237 | 3300006178 | Bacteria | 2228 |
| 131 | Ga0075367_10074095 | 3300006178 | Bacteria | 2053 |
| 132 | Ga0075367_10105283 | 3300006178 | Bacteria | 1727 |
| 133 | Ga0075367_10194119 | 3300006178 | Bacteria | 1267 |
| 134 | Ga0075367_10332597 | 3300006178 | Bacteria | 958 |
| 135 | Ga0075367_11081472 | 3300006178 | Bacteria | 513 |
| 136 | Ga0075369_10000236 | 3300006186 | Bacteria | 16397 |
| 137 | Ga0075369_10001134 | 3300006186 | Bacteria | 8977 |
| 138 | Ga0075366_10031086 | 3300006195 | Bacteria | 3141 |
| 139 | Ga0075366_10110967 | 3300006195 | Bacteria | 1649 |
| 140 | Ga0097621_100289194 | 3300006237 | Bacteria | 1444 |
| 141 | Ga0075370_10019581 | 3300006353 | Bacteria | 3687 |
| 142 | Ga0075370_10067139 | 3300006353 | Bacteria | 2047 |
| 143 | Ga0075370_10417615 | 3300006353 | Bacteria | 806 |
| 144 | Ga0068871_101193039 | 3300006358 | Bacteria | 714 |
| 145 | Ga0075428_100013655 | 3300006844 | Bacteria | 9042 |
| 146 | Ga0075428_100121470 | 3300006844 | Bacteria | 2844 |
| 147 | Ga0075428_100561951 | 3300006844 | Bacteria | 1219 |
| 148 | Ga0075428_100943103 | 3300006844 | Bacteria | 915 |
| 149 | Ga0075430_101069501 | 3300006846 | Bacteria | 665 |
| 150 | Ga0075430_101235773 | 3300006846 | Bacteria | 615 |
| 151 | Ga0075431_100331592 | 3300006847 | Bacteria | 1532 |
| 152 | Ga0075431_100489747 | 3300006847 | Bacteria | 1222 |
| 153 | Ga0075433_10247370 | 3300006852 | Bacteria | 1582 |
| 154 | Ga0075433_10285195 | 3300006852 | Bacteria | 1463 |
| 155 | Ga0075434_100195692 | 3300006871 | Bacteria | 2041 |
| 156 | Ga0075429_100057689 | 3300006880 | Bacteria | 3380 |
| 157 | Ga0075429_100213402 | 3300006880 | Bacteria | 1691 |
| 158 | Ga0075429_100880865 | 3300006880 | Bacteria | 784 |
| 159 | Ga0097620_101696696 | 3300006931 | Bacteria | 698 |
| 160 | Ga0075435_100526736 | 3300007076 | Bacteria | 1022 |
| 161 | Ga0105240_10547335 | 3300009093 | Bacteria | 1281 |
| 162 | Ga0105240_10830642 | 3300009093 | Bacteria | 999 |
| 163 | Ga0105240_11050812 | 3300009093 | Bacteria | 869 |
| 164 | Ga0111539_10013494 | 3300009094 | Bacteria | 10209 |
| 165 | Ga0111539_10132359 | 3300009094 | Bacteria | 2920 |
| 166 | Ga0111539_10140212 | 3300009094 | Bacteria | 2831 |
| 167 | Ga0111539_10261278 | 3300009094 | Bacteria | 2015 |
| 168 | Ga0111539_13089120 | 3300009094 | Bacteria | 537 |
| 169 | Ga0105245_10141539 | 3300009098 | Bacteria | 2266 |
| 170 | Ga0105247_10015421 | 3300009101 | Bacteria | 4578 |
| 171 | Ga0114129_10042292 | 3300009147 | Bacteria | 6416 |
| 172 | Ga0114129_10380423 | 3300009147 | Bacteria | 1864 |
| 173 | Ga0114129_11292034 | 3300009147 | Bacteria | 905 |
| 174 | Ga0105243_10843324 | 3300009148 | Bacteria | 907 |
| 175 | Ga0105243_11331955 | 3300009148 | Bacteria | 736 |
| 176 | Ga0105241_10331413 | 3300009174 | Bacteria | 1316 |
| 177 | Ga0105242_10090488 | 3300009176 | Bacteria | 2574 |
| 178 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 179 | Ga0105248_10674873 | 3300009177 | Bacteria | 1166 |
| 180 | Ga0105238_10781140 | 3300009551 | Bacteria | 970 |
| 181 | Ga0105249_10007875 | 3300009553 | Bacteria | 9282 |
| 182 | Ga0105249_10048470 | 3300009553 | Bacteria | 3873 |
| 183 | Ga0105249_10177161 | 3300009553 | Bacteria | 2071 |
| 184 | Ga0105239_10036242 | 3300010375 | Bacteria | 5417 |
| 185 | Ga0105239_10172999 | 3300010375 | Bacteria | 2415 |
| 186 | Ga0105239_10992007 | 3300010375 | Bacteria | 965 |
| 187 | Ga0157326_1092420 | 3300012513 | Bacteria | 511 |
| 188 | Ga0157373_10126261 | 3300013100 | Bacteria | 1799 |
| 189 | Ga0157373_11286411 | 3300013100 | Bacteria | 553 |
| 190 | Ga0157369_10010907 | 3300013105 | Bacteria | 10348 |
| 191 | Ga0157374_11450189 | 3300013296 | Bacteria | 709 |
| 192 | Ga0157378_10153217 | 3300013297 | Bacteria | 2149 |
| 193 | Ga0157378_11494598 | 3300013297 | Bacteria | 720 |
| 194 | Ga0163162_11342470 | 3300013306 | Bacteria | 813 |
| 195 | Ga0163162_12469209 | 3300013306 | Bacteria | 598 |
| 196 | Ga0163163_10156309 | 3300014325 | Bacteria | 2325 |
| 197 | Ga0157380_10133128 | 3300014326 | Bacteria | 2124 |
| 198 | Ga0157380_10313023 | 3300014326 | Bacteria | 1452 |
| 199 | Ga0157380_10594512 | 3300014326 | Bacteria | 1094 |
| 200 | Ga0157380_12806435 | 3300014326 | Bacteria | 554 |
| 201 | Ga0157377_10130954 | 3300014745 | Bacteria | 1532 |
| 202 | Ga0163161_10041423 | 3300017792 | Bacteria | 3310 |
| 203 | Ga0163161_10142844 | 3300017792 | Bacteria | 1813 |
| 204 | Ga0209437_102111 | 3300025233 | Bacteria | 4017 |
| 205 | Ga0209233_1000065 | 3300025261 | Bacteria | 387195 |
| 206 | Ga0209257_1002058 | 3300025304 | Bacteria | 21303 |
| 207 | Ga0207656_10134755 | 3300025321 | Bacteria | 1160 |
| 208 | Ga0207642_10383772 | 3300025899 | Bacteria | 837 |
| 209 | Ga0207642_10397061 | 3300025899 | Bacteria | 824 |
| 210 | Ga0207688_10034265 | 3300025901 | Bacteria | 2811 |
| 211 | Ga0207688_10034928 | 3300025901 | Bacteria | 2785 |
| 212 | Ga0207688_10362492 | 3300025901 | Bacteria | 894 |
| 213 | Ga0207680_10255779 | 3300025903 | Bacteria | 1211 |
| 214 | Ga0207680_10796913 | 3300025903 | Bacteria | 677 |
| 215 | Ga0207647_10229340 | 3300025904 | Bacteria | 1069 |
| 216 | Ga0207645_10018571 | 3300025907 | Bacteria | 4571 |
| 217 | Ga0207705_10294459 | 3300025909 | Bacteria | 1244 |
| 218 | Ga0207654_10196241 | 3300025911 | Bacteria | 1326 |
| 219 | Ga0207707_10257247 | 3300025912 | Bacteria | 1516 |
| 220 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 221 | Ga0207695_10369802 | 3300025913 | Bacteria | 1320 |
| 222 | Ga0207660_11510042 | 3300025917 | Bacteria | 543 |
| 223 | Ga0207662_10017085 | 3300025918 | Bacteria | 4101 |
| 224 | Ga0207657_10012407 | 3300025919 | Bacteria | 8420 |
| 225 | Ga0207657_10043143 | 3300025919 | Bacteria | 3975 |
| 226 | Ga0207649_10106388 | 3300025920 | Bacteria | 1866 |
| 227 | Ga0207681_10032439 | 3300025923 | Bacteria | 3419 |
| 228 | Ga0207681_10331270 | 3300025923 | Bacteria | 1213 |
| 229 | Ga0207681_10948339 | 3300025923 | Bacteria | 721 |
| 230 | Ga0207694_10278397 | 3300025924 | Bacteria | 1374 |
| 231 | Ga0207694_10765132 | 3300025924 | Bacteria | 815 |
| 232 | Ga0207650_10033844 | 3300025925 | Bacteria | 3704 |
| 233 | Ga0207659_10003104 | 3300025926 | Bacteria | 9922 |
| 234 | Ga0207659_10063488 | 3300025926 | Bacteria | 2670 |
| 235 | Ga0207687_10761809 | 3300025927 | Bacteria | 824 |
| 236 | Ga0207687_11218794 | 3300025927 | Bacteria | 647 |
| 237 | Ga0207644_10163279 | 3300025931 | Bacteria | 1733 |
| 238 | Ga0207644_10503823 | 3300025931 | Bacteria | 999 |
| 239 | Ga0207644_10505679 | 3300025931 | Bacteria | 997 |
| 240 | Ga0207690_10034214 | 3300025932 | Bacteria | 3273 |
| 241 | Ga0207690_11270120 | 3300025932 | Bacteria | 615 |
| 242 | Ga0207706_10195650 | 3300025933 | Bacteria | 1774 |
| 243 | Ga0207706_10212375 | 3300025933 | Bacteria | 1696 |
| 244 | Ga0207686_10101128 | 3300025934 | Bacteria | 1925 |
| 245 | Ga0207686_10851420 | 3300025934 | Bacteria | 733 |
| 246 | Ga0207670_10448476 | 3300025936 | Bacteria | 1040 |
| 247 | Ga0207670_10455467 | 3300025936 | Bacteria | 1032 |
| 248 | Ga0207670_11931866 | 3300025936 | Bacteria | 502 |
| 249 | Ga0207669_10243508 | 3300025937 | Bacteria | 1334 |
| 250 | Ga0207691_10065496 | 3300025940 | Bacteria | 3288 |
| 251 | Ga0207691_10080147 | 3300025940 | Bacteria | 2937 |
| 252 | Ga0207691_10164498 | 3300025940 | Bacteria | 1945 |
| 253 | Ga0207691_10188020 | 3300025940 | Bacteria | 1802 |
| 254 | Ga0207691_10786993 | 3300025940 | Bacteria | 800 |
| 255 | Ga0207711_10000002 | 3300025941 | Bacteria | 1228676 |
| 256 | Ga0207711_10133522 | 3300025941 | Bacteria | 2227 |
| 257 | Ga0207711_10929134 | 3300025941 | Bacteria | 808 |
| 258 | Ga0207689_10442194 | 3300025942 | Bacteria | 1086 |
| 259 | Ga0207689_10510899 | 3300025942 | Bacteria | 1007 |
| 260 | Ga0207689_11418557 | 3300025942 | Bacteria | 582 |
| 261 | Ga0207679_10086865 | 3300025945 | Bacteria | 2407 |
| 262 | Ga0207667_10000026 | 3300025949 | Bacteria | 343713 |
| 263 | Ga0207667_11978808 | 3300025949 | Bacteria | 543 |
| 264 | Ga0207651_10020268 | 3300025960 | Bacteria | 4009 |
| 265 | Ga0207712_10192182 | 3300025961 | Bacteria | 1612 |
| 266 | Ga0207712_10927028 | 3300025961 | Bacteria | 771 |
| 267 | Ga0207712_12055447 | 3300025961 | Bacteria | 511 |
| 268 | Ga0207668_10133041 | 3300025972 | Bacteria | 1902 |
| 269 | Ga0207668_10195676 | 3300025972 | Bacteria | 1606 |
| 270 | Ga0207668_11070084 | 3300025972 | Bacteria | 722 |
| 271 | Ga0207668_11231088 | 3300025972 | Bacteria | 673 |
| 272 | Ga0207640_11573293 | 3300025981 | Bacteria | 592 |
| 273 | Ga0207677_10460895 | 3300026023 | Bacteria | 1091 |
| 274 | Ga0207703_10000873 | 3300026035 | Bacteria | 29570 |
| 275 | Ga0207703_10263333 | 3300026035 | Bacteria | 1559 |
| 276 | Ga0207639_10123123 | 3300026041 | Bacteria | 2134 |
| 277 | Ga0207678_10047177 | 3300026067 | Bacteria | 3726 |
| 278 | Ga0207678_10294361 | 3300026067 | Bacteria | 1394 |
| 279 | Ga0207708_10694064 | 3300026075 | Bacteria | 870 |
| 280 | Ga0207702_10063715 | 3300026078 | Bacteria | 3153 |
| 281 | Ga0207702_12317834 | 3300026078 | Bacteria | 525 |
| 282 | Ga0207641_10091006 | 3300026088 | Bacteria | 2669 |
| 283 | Ga0207641_10728829 | 3300026088 | Bacteria | 978 |
| 284 | Ga0207648_10194886 | 3300026089 | Bacteria | 1796 |
| 285 | Ga0207648_10287045 | 3300026089 | Bacteria | 1473 |
| 286 | Ga0207676_10313318 | 3300026095 | Bacteria | 1437 |
| 287 | Ga0207676_10641657 | 3300026095 | Bacteria | 1024 |
| 288 | Ga0207674_10141808 | 3300026116 | Bacteria | 2362 |
| 289 | Ga0207674_11424252 | 3300026116 | Bacteria | 662 |
| 290 | Ga0207675_100147433 | 3300026118 | Bacteria | 2238 |
| 291 | Ga0207675_100735165 | 3300026118 | Bacteria | 997 |
| 292 | Ga0207675_100971851 | 3300026118 | Bacteria | 867 |
| 293 | Ga0207675_101137381 | 3300026118 | Bacteria | 801 |
| 294 | Ga0207683_10005980 | 3300026121 | Bacteria | 10420 |
| 295 | Ga0207683_10371911 | 3300026121 | Bacteria | 1313 |
| 296 | Ga0207683_11923362 | 3300026121 | Bacteria | 540 |
| 297 | Ga0207683_11939863 | 3300026121 | Bacteria | 537 |
| 298 | Ga0207698_10000365 | 3300026142 | Bacteria | 26602 |
| 299 | Ga0207698_11186851 | 3300026142 | Bacteria | 777 |
| 300 | Ga0207698_11384315 | 3300026142 | Bacteria | 718 |
| 301 | Ga0207698_11582648 | 3300026142 | Bacteria | 671 |
| 302 | Ga0209966_1006348 | 3300027695 | Bacteria | 2051 |
| 303 | Ga0209998_10216412 | 3300027717 | Bacteria | 503 |
| 304 | Ga0209974_10053266 | 3300027876 | Bacteria | 1363 |
| 305 | Ga0207428_10134263 | 3300027907 | Bacteria | 1893 |
| 306 | Ga0207428_10178974 | 3300027907 | Bacteria | 1603 |
| 307 | Ga0268266_10000062 | 3300028379 | Bacteria | 253490 |
| 308 | Ga0268266_10052321 | 3300028379 | Bacteria | 3507 |
| 309 | Ga0268266_10734334 | 3300028379 | Bacteria | 952 |
| 310 | Ga0268265_10015065 | 3300028380 | Bacteria | 5281 |
| 311 | Ga0268265_10042911 | 3300028380 | Bacteria | 3358 |
| 312 | Ga0268265_10627116 | 3300028380 | Bacteria | 1031 |
| 313 | Ga0268265_10815589 | 3300028380 | Bacteria | 910 |
| 314 | Ga0268265_11375438 | 3300028380 | Bacteria | 707 |
| 315 | Ga0268264_12398660 | 3300028381 | Bacteria | 534 |
| 316 | Ga0307517_10174245 | 3300028786 | Bacteria | 1406 |
| 317 | Ga0307517_10316943 | 3300028786 | Bacteria | 865 |
| 318 | Ga0265328_10175828 | 3300031239 | Bacteria | 809 |
| 319 | Ga0307508_10006689 | 3300031616 | Bacteria | 10812 |
| 320 | Ga0307514_10544768 | 3300031649 | Bacteria | 537 |
| 321 | Ga0307405_10973583 | 3300031731 | Bacteria | 722 |
| 322 | Ga0307410_10424847 | 3300031852 | Bacteria | 1079 |
| 323 | Ga0307412_10291320 | 3300031911 | Bacteria | 1286 |
| 324 | Ga0307409_100387957 | 3300031995 | Bacteria | 1330 |
| 325 | Ga0307416_100226048 | 3300032002 | Bacteria | 1800 |
| 326 | Ga0307416_100568056 | 3300032002 | Bacteria | 1210 |
| 327 | Ga0307411_10215397 | 3300032005 | Bacteria | 1486 |
| 328 | Ga0307510_10336055 | 3300033180 | Bacteria | 964 |
| 329 | Ga0307510_10624503 | 3300033180 | Bacteria | 532 |
| 330 | Ga0373930_0149589 | 3300034816 | Bacteria | 585 |
| 331 | Ga0373959_0035848 | 3300034820 | Bacteria | 1022 |
| 332 | Ga0373936_0001350 | 3300035113 | Bacteria | 8915 |
| 333 | Ga0373943_0156799 | 3300035170 | Bacteria | 1237 |
| 334 | Ga0373931_0635454 | 3300035691 | Bacteria | 700 |
| 335 | Ga0373935_0200576 | 3300035692 | Bacteria | 1378 |
| 336 | Ga0373925_0008164 | 3300037068 | Bacteria | 7621 |
| 337 | Ga0439465_0031898 | 3300041413 | Bacteria | 1680 |
| 338 | Ga0451791_0798306 | 3300041451 | Bacteria | 775 |
| 339 | Ga0451798_0348374 | 3300041458 | Bacteria | 1047 |
| 340 | Ga0451807_1625728 | 3300041486 | Bacteria | 1500 |
| 341 | Ga0451849_0542985 | 3300041505 | Bacteria | 3337 |
| 342 | Ga0451843_0976675 | 3300041509 | Bacteria | 765 |
| 343 | Ga0439458_0025529 | 3300042157 | Bacteria | 1387 |
| 344 | Ga0439459_0109214 | 3300042438 | Bacteria | 686 |
| 345 | Ga0439464_0095345 | 3300042439 | Bacteria | 900 |
| 346 | Ga0439464_0301123 | 3300042439 | Bacteria | 524 |
| 347 | Ga0466972_0003498 | 3300044658 | Bacteria | 7798 |
| 348 | Ga0466966_0047292 | 3300044684 | Bacteria | 2744 |
| 349 | Ga0466961_0004729 | 3300044693 | Bacteria | 8566 |
| 350 | Ga0466964_0018601 | 3300044706 | Bacteria | 2667 |
| 351 | Ga0466971_0236666 | 3300044719 | Bacteria | 868 |
| 352 | Ga0466970_0019410 | 3300044765 | Bacteria | 3524 |
| 353 | Ga0466960_0046104 | 3300044901 | Bacteria | 2085 |
| 354 | Ga0466959_0006392 | 3300045049 | Bacteria | 8158 |
| 355 | Ga0495603_0157915 | 3300046455 | Bacteria | 1316 |
| 356 | Ga0495629_1013042 | 3300046459 | Bacteria | 540 |
| 357 | Ga0495638_0006082 | 3300046460 | Bacteria | 8833 |
| 358 | Ga0495638_0007622 | 3300046460 | Bacteria | 7737 |
| 359 | Ga0495662_0054569 | 3300046476 | Bacteria | 1931 |
| 360 | Ga0495584_0036115 | 3300046491 | Bacteria | 2496 |
| 361 | Ga0495607_0149086 | 3300046501 | Bacteria | 1199 |
| 362 | Ga0495606_0259124 | 3300046507 | Bacteria | 961 |
| 363 | Ga0495608_0263833 | 3300046511 | Bacteria | 1072 |
| 364 | Ga0495637_0169771 | 3300046520 | Bacteria | 814 |
| 365 | Ga0495643_0384155 | 3300046522 | Bacteria | 622 |
| 366 | Ga0495642_0013080 | 3300046528 | Bacteria | 3206 |
| 367 | Ga0495598_0141322 | 3300046537 | Bacteria | 833 |
| 368 | Ga0495621_0146750 | 3300046539 | Bacteria | 926 |
| 369 | Ga0495597_0176762 | 3300046542 | Bacteria | 864 |
| 370 | Ga0495658_0292819 | 3300046683 | Bacteria | 1029 |
| 371 | Ga0495670_0000028 | 3300046691 | Bacteria | 90085 |
| 372 | Ga0495589_0491189 | 3300046794 | Bacteria | 561 |
| 373 | Ga0495589_0538083 | 3300046794 | Bacteria | 533 |
| 374 | Ga0495677_0000757 | 3300047445 | Bacteria | 13022 |
| 375 | Ga0495684_0252909 | 3300047471 | Bacteria | 1281 |
| 376 | Ga0495686_0013186 | 3300047472 | Bacteria | 5748 |
| 377 | Ga0495614_0134031 | 3300048089 | Bacteria | 1098 |
| 378 | Ga0496100_1412596 | 3300048903 | Bacteria | 549 |
| 379 | Ga0496102_1209662 | 3300048905 | Bacteria | 675 |
| 380 | Ga0496102_1372184 | 3300048905 | Bacteria | 626 |
| 381 | Ga0496103_0122885 | 3300048906 | Bacteria | 1655 |
| 382 | Ga0496104_0026508 | 3300048907 | Bacteria | 5353 |
| 383 | Ga0496105_0148807 | 3300048908 | Bacteria | 1925 |
| 384 | Ga0496107_0537337 | 3300048910 | Bacteria | 866 |
| 385 | Ga0496108_0158326 | 3300048911 | Bacteria | 1956 |
| 386 | Ga0496109_0018865 | 3300048912 | Bacteria | 6070 |
| 387 | Ga0496110_0054090 | 3300048913 | Bacteria | 3531 |
| 388 | Ga0496111_0089078 | 3300048914 | Bacteria | 2260 |
| 389 | Ga0496112_0041065 | 3300048915 | Bacteria | 4525 |
| 390 | Ga0496113_0394831 | 3300048916 | Bacteria | 1110 |
| 391 | Ga0496113_0960445 | 3300048916 | Bacteria | 674 |
| 392 | Ga0496115_0011017 | 3300048918 | Bacteria | 6773 |
| 393 | Ga0496126_0056887 | 3300048929 | Bacteria | 3534 |
| 394 | Ga0501067_0101536 | 3300049583 | Bacteria | 1599 |
| 395 | nmdc:mga03683_42220_c1 | 3300050489 | Bacteria | 1876 |
| 396 | nmdc:mga03683_7152_c2 | 3300050489 | Bacteria | 3555 |
| 397 | nmdc:mga00v17_1067123_c1 | 3300050491 | Bacteria | 507 |
| 398 | nmdc:mga00v17_252500_c1 | 3300050491 | Bacteria | 1143 |
| 399 | nmdc:mga00v17_6036_c1 | 3300050491 | Bacteria | 6407 |
| 400 | nmdc:mga0yw44_297078_c1 | 3300050492 | Bacteria | 1082 |
| 401 | nmdc:mga0yw44_40164_c1 | 3300050492 | Bacteria | 2778 |
| 402 | nmdc:mga0yw44_478501_c1 | 3300050492 | Bacteria | 844 |
| 403 | nmdc:mga0yw44_807671_c1 | 3300050492 | Bacteria | 637 |
| 404 | nmdc:mga0k408_273497_c1 | 3300050493 | Bacteria | 1008 |
| 405 | nmdc:mga0k408_83960_c1 | 3300050493 | Bacteria | 1868 |
| 406 | nmdc:mga06z11_152486_c1 | 3300050494 | Bacteria | 1315 |
| 407 | nmdc:mga06z11_16465_c1 | 3300050494 | Bacteria | 3331 |
| 408 | nmdc:mga06z11_170332_c1 | 3300050494 | Bacteria | 1250 |
| 409 | nmdc:mga06z11_191568_c1 | 3300050494 | Bacteria | 1184 |
| 410 | nmdc:mga06z11_34575_c1 | 3300050494 | Bacteria | 2482 |
| 411 | nmdc:mga07m45_60543_c1 | 3300050496 | Bacteria | 2143 |
| 412 | nmdc:mga07m45_630261_c1 | 3300050496 | Bacteria | 618 |
| 413 | nmdc:mga07m45_76596_c1 | 3300050496 | Bacteria | 1907 |
| 414 | nmdc:mga07m45_805217_c1 | 3300050496 | Bacteria | 538 |
| 415 | nmdc:mga05p37_201259_c1 | 3300050507 | Bacteria | 2412 |
| 416 | nmdc:mga05p37_837896_c1 | 3300050507 | Bacteria | 1001 |
| 417 | nmdc:mga09592_231452_c1 | 3300050508 | Bacteria | 1601 |
| 418 | nmdc:mga09592_39779_c1 | 3300050508 | Bacteria | 3950 |
| 419 | nmdc:mga0qj67_350874_c1 | 3300050509 | Bacteria | 1193 |
| 420 | nmdc:mga0qj67_678735_c1 | 3300050509 | Bacteria | 821 |
| 421 | nmdc:mga06r32_1104_c1 | 3300050510 | Bacteria | 24200 |
| 422 | nmdc:mga06r32_344560_c1 | 3300050510 | Bacteria | 1475 |
| 423 | nmdc:mga06r32_398819_c1 | 3300050510 | Bacteria | 1358 |
| 424 | nmdc:mga08y16_304534_c1 | 3300050511 | Bacteria | 1642 |
| 425 | nmdc:mga08y16_67998_c1 | 3300050511 | Bacteria | 3716 |
| 426 | nmdc:mga08y16_75642_c1 | 3300050511 | Bacteria | 3510 |
| 427 | nmdc:mga0n895_99639_c1 | 3300050512 | Bacteria | 2914 |
| 428 | nmdc:mga0a205_171411_c2 | 3300050515 | Bacteria | 1245 |
| 429 | nmdc:mga0a205_678579_c1 | 3300050515 | Bacteria | 881 |
| 430 | nmdc:mga0sz30_129_c1 | 3300050516 | Bacteria | 27866 |
| 431 | Ga0500635_0232601 | 3300053080 | Bacteria | 721 |
| 432 | Ga0500618_006698 | 3300053125 | Bacteria | 3355 |
| 433 | Ga0500655_013248 | 3300053133 | Bacteria | 1504 |
| 434 | Ga0500655_085655 | 3300053133 | Bacteria | 651 |
| 435 | Ga0500559_0016984 | 3300053136 | Bacteria | 3074 |
| 436 | Ga0500568_0020378 | 3300053139 | Bacteria | 2869 |
| 437 | Ga0500604_0166333 | 3300053151 | Bacteria | 753 |
| 438 | Ga0500616_0110533 | 3300053153 | Bacteria | 1328 |
| 439 | Ga0500619_001138 | 3300053154 | Bacteria | 4620 |
| 440 | Ga0500622_0233780 | 3300053156 | Bacteria | 816 |
| 441 | Ga0500645_008567 | 3300053730 | Bacteria | 3485 |
| 442 | Ga0500645_017468 | 3300053730 | Bacteria | 2248 |
| 443 | Ga0466962_0049418 | 3300061719 | Bacteria | 2010 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050492 | nmdc:mga0yw44_807671_c1 | nmdc:mga0yw44_807671_c1_67_489 | 133 |
| 2 | 3300009094 | Ga0111539_10132359 | Ga0111539_101323593 | 134 |
| 3 | 3300041486 | Ga0451807_1625728 | Ga0451807_1625728_842_1255 | 134 |
| 4 | 3300046794 | Ga0495589_0538083 | Ga0495589_0538083_91_504 | 134 |
| 5 | 3300013296 | Ga0157374_11450189 | Ga0157374_114501892 | 135 |
| 6 | 3300048089 | Ga0495614_0134031 | Ga0495614_0134031_579_1010 | 135 |
| 7 | 3300026118 | Ga0207675_101137381 | Ga0207675_1011373812 | 136 |
| 8 | 3300053730 | Ga0500645_017468 | Ga0500645_017468_1513_1932 | 136 |
| 9 | 3300005842 | Ga0068858_101492289 | Ga0068858_1014922891 | 137 |
| 10 | 3300014326 | Ga0157380_10594512 | Ga0157380_105945121 | 137 |
| 11 | 3300031239 | Ga0265328_10175828 | Ga0265328_101758282 | 137 |
| 12 | 3300031616 | Ga0307508_10006689 | Ga0307508_100066895 | 137 |
| 13 | 3300042439 | Ga0439464_0301123 | Ga0439464_0301123_39_467 | 137 |
| 14 | 3300046455 | Ga0495603_0157915 | Ga0495603_0157915_523_942 | 137 |
| 15 | 3300046476 | Ga0495662_0054569 | Ga0495662_0054569_1046_1462 | 137 |
| 16 | 3300050494 | nmdc:mga06z11_152486_c1 | nmdc:mga06z11_152486_c1_277_690 | 137 |
| 17 | iso_pu_bacteria | 2643221545 | 2643748636 | 137 |
| 18 | iso_pu_bacteria | 2643221691 | 2644510309 | 137 |
| 19 | iso_pu_bacteria | 2818991461 | 2819683767 | 137 |
| 20 | 3300005289 | Ga0065704_10126899 | Ga0065704_101268991 | 138 |
| 21 | 3300005459 | Ga0068867_100205535 | Ga0068867_1002055352 | 138 |
| 22 | 3300009093 | Ga0105240_10830642 | Ga0105240_108306422 | 138 |
| 23 | 3300009093 | Ga0105240_11050812 | Ga0105240_110508121 | 138 |
| 24 | 3300009094 | Ga0111539_10013494 | Ga0111539_100134946 | 138 |
| 25 | 3300009094 | Ga0111539_13089120 | Ga0111539_130891201 | 138 |
| 26 | 3300009098 | Ga0105245_10141539 | Ga0105245_101415392 | 138 |
| 27 | 3300009147 | Ga0114129_10380423 | Ga0114129_103804232 | 138 |
| 28 | 3300009147 | Ga0114129_11292034 | Ga0114129_112920341 | 138 |
| 29 | 3300009148 | Ga0105243_10843324 | Ga0105243_108433241 | 138 |
| 30 | 3300009176 | Ga0105242_10090488 | Ga0105242_100904882 | 138 |
| 31 | 3300009177 | Ga0105248_10674873 | Ga0105248_106748732 | 138 |
| 32 | 3300009553 | Ga0105249_10007875 | Ga0105249_100078757 | 138 |
| 33 | 3300009553 | Ga0105249_10177161 | Ga0105249_101771613 | 138 |
| 34 | 3300013100 | Ga0157373_10126261 | Ga0157373_101262612 | 138 |
| 35 | 3300013297 | Ga0157378_11494598 | Ga0157378_114945981 | 138 |
| 36 | 3300013306 | Ga0163162_11342470 | Ga0163162_113424701 | 138 |
| 37 | 3300013306 | Ga0163162_12469209 | Ga0163162_124692091 | 138 |
| 38 | 3300014745 | Ga0157377_10130954 | Ga0157377_101309542 | 138 |
| 39 | 3300034816 | Ga0373930_0149589 | Ga0373930_0149589_24_440 | 138 |
| 40 | 3300035170 | Ga0373943_0156799 | Ga0373943_0156799_165_584 | 138 |
| 41 | 3300035691 | Ga0373931_0635454 | Ga0373931_0635454_90_506 | 138 |
| 42 | 3300035692 | Ga0373935_0200576 | Ga0373935_0200576_415_831 | 138 |
| 43 | 3300041413 | Ga0439465_0031898 | Ga0439465_0031898_157_573 | 138 |
| 44 | 3300041458 | Ga0451798_0348374 | Ga0451798_0348374_409_825 | 138 |
| 45 | 3300042157 | Ga0439458_0025529 | Ga0439458_0025529_649_1074 | 138 |
| 46 | 3300042438 | Ga0439459_0109214 | Ga0439459_0109214_133_558 | 138 |
| 47 | 3300042439 | Ga0439464_0095345 | Ga0439464_0095345_275_703 | 138 |
| 48 | 3300046459 | Ga0495629_1013042 | Ga0495629_1013042_114_530 | 138 |
| 49 | 3300046507 | Ga0495606_0259124 | Ga0495606_0259124_191_607 | 138 |
| 50 | 3300046511 | Ga0495608_0263833 | Ga0495608_0263833_192_608 | 138 |
| 51 | 3300046520 | Ga0495637_0169771 | Ga0495637_0169771_94_510 | 138 |
| 52 | 3300046537 | Ga0495598_0141322 | Ga0495598_0141322_192_608 | 138 |
| 53 | 3300046542 | Ga0495597_0176762 | Ga0495597_0176762_358_783 | 138 |
| 54 | 3300046683 | Ga0495658_0292819 | Ga0495658_0292819_331_747 | 138 |
| 55 | 3300046691 | Ga0495670_0000028 | Ga0495670_0000028_89206_89631 | 138 |
| 56 | 3300046794 | Ga0495589_0491189 | Ga0495589_0491189_19_435 | 138 |
| 57 | 3300048905 | Ga0496102_1372184 | Ga0496102_1372184_45_461 | 138 |
| 58 | 3300048910 | Ga0496107_0537337 | Ga0496107_0537337_310_726 | 138 |
| 59 | 3300048916 | Ga0496113_0960445 | Ga0496113_0960445_137_553 | 138 |
| 60 | 3300048929 | Ga0496126_0056887 | Ga0496126_0056887_2076_2501 | 138 |
| 61 | 3300049583 | Ga0501067_0101536 | Ga0501067_0101536_407_823 | 138 |
| 62 | 3300050491 | nmdc:mga00v17_1067123_c1 | nmdc:mga00v17_1067123_c1_69_485 | 138 |
| 63 | 3300050491 | nmdc:mga00v17_252500_c1 | nmdc:mga00v17_252500_c1_37_453 | 138 |
| 64 | 3300050492 | nmdc:mga0yw44_478501_c1 | nmdc:mga0yw44_478501_c1_152_568 | 138 |
| 65 | 3300050496 | nmdc:mga07m45_60543_c1 | nmdc:mga07m45_60543_c1_955_1371 | 138 |
| 66 | 3300050496 | nmdc:mga07m45_630261_c1 | nmdc:mga07m45_630261_c1_178_606 | 138 |
| 67 | 3300050507 | nmdc:mga05p37_201259_c1 | nmdc:mga05p37_201259_c1_1651_2076 | 138 |
| 68 | 3300050508 | nmdc:mga09592_231452_c1 | nmdc:mga09592_231452_c1_288_713 | 138 |
| 69 | 3300050509 | nmdc:mga0qj67_350874_c1 | nmdc:mga0qj67_350874_c1_665_1081 | 138 |
| 70 | 3300050510 | nmdc:mga06r32_344560_c1 | nmdc:mga06r32_344560_c1_771_1196 | 138 |
| 71 | 3300050510 | nmdc:mga06r32_398819_c1 | nmdc:mga06r32_398819_c1_236_652 | 138 |
| 72 | 3300050511 | nmdc:mga08y16_304534_c1 | nmdc:mga08y16_304534_c1_426_851 | 138 |
| 73 | 3300050511 | nmdc:mga08y16_67998_c1 | nmdc:mga08y16_67998_c1_96_521 | 138 |
| 74 | 3300050512 | nmdc:mga0n895_99639_c1 | nmdc:mga0n895_99639_c1_1023_1439 | 138 |
| 75 | 3300050515 | nmdc:mga0a205_171411_c2 | nmdc:mga0a205_171411_c2_628_1053 | 138 |
| 76 | 3300050515 | nmdc:mga0a205_678579_c1 | nmdc:mga0a205_678579_c1_390_806 | 138 |
| 77 | 3300053136 | Ga0500559_0016984 | Ga0500559_0016984_417_842 | 138 |
| 78 | 3300053139 | Ga0500568_0020378 | Ga0500568_0020378_382_798 | 138 |
| 79 | 3300053151 | Ga0500604_0166333 | Ga0500604_0166333_98_514 | 138 |
| 80 | 3300053730 | Ga0500645_008567 | Ga0500645_008567_2249_2674 | 138 |
| 81 | 3300005290 | Ga0065712_10002464 | Ga0065712_100024647 | 139 |
| 82 | 3300005340 | Ga0070689_101746614 | Ga0070689_1017466141 | 139 |
| 83 | 3300005344 | Ga0070661_100183898 | Ga0070661_1001838982 | 139 |
| 84 | 3300005347 | Ga0070668_100154251 | Ga0070668_1001542511 | 139 |
| 85 | 3300005354 | Ga0070675_100105520 | Ga0070675_1001055203 | 139 |
| 86 | 3300005355 | Ga0070671_100309407 | Ga0070671_1003094072 | 139 |
| 87 | 3300005367 | Ga0070667_100430521 | Ga0070667_1004305213 | 139 |
| 88 | 3300005456 | Ga0070678_100346669 | Ga0070678_1003466692 | 139 |
| 89 | 3300005466 | Ga0070685_10028427 | Ga0070685_100284274 | 139 |
| 90 | 3300005548 | Ga0070665_100020573 | Ga0070665_1000205737 | 139 |
| 91 | 3300005563 | Ga0068855_100000144 | Ga0068855_10000014442 | 139 |
| 92 | 3300005616 | Ga0068852_101418482 | Ga0068852_1014184821 | 139 |
| 93 | 3300005616 | Ga0068852_102467574 | Ga0068852_1024675741 | 139 |
| 94 | 3300005618 | Ga0068864_100031721 | Ga0068864_1000317215 | 139 |
| 95 | 3300005841 | Ga0068863_100029480 | Ga0068863_1000294806 | 139 |
| 96 | 3300005844 | Ga0068862_100354754 | Ga0068862_1003547542 | 139 |
| 97 | 3300006237 | Ga0097621_100289194 | Ga0097621_1002891942 | 139 |
| 98 | 3300009101 | Ga0105247_10015421 | Ga0105247_100154213 | 139 |
| 99 | 3300009174 | Ga0105241_10331413 | Ga0105241_103314133 | 139 |
| 100 | 3300009177 | Ga0105248_10000001 | Ga0105248_10000001244 | 139 |
| 101 | 3300010375 | Ga0105239_10036242 | Ga0105239_100362427 | 139 |
| 102 | 3300013105 | Ga0157369_10010907 | Ga0157369_100109075 | 139 |
| 103 | 3300013297 | Ga0157378_10153217 | Ga0157378_101532172 | 139 |
| 104 | 3300014325 | Ga0163163_10156309 | Ga0163163_101563092 | 139 |
| 105 | 3300025903 | Ga0207680_10796913 | Ga0207680_107969131 | 139 |
| 106 | 3300025913 | Ga0207695_10000012 | Ga0207695_1000001258 | 139 |
| 107 | 3300025920 | Ga0207649_10106388 | Ga0207649_101063882 | 139 |
| 108 | 3300025925 | Ga0207650_10033844 | Ga0207650_100338443 | 139 |
| 109 | 3300025926 | Ga0207659_10063488 | Ga0207659_100634882 | 139 |
| 110 | 3300025927 | Ga0207687_11218794 | Ga0207687_112187941 | 139 |
| 111 | 3300025931 | Ga0207644_10505679 | Ga0207644_105056791 | 139 |
| 112 | 3300025936 | Ga0207670_10448476 | Ga0207670_104484761 | 139 |
| 113 | 3300025941 | Ga0207711_10000002 | Ga0207711_10000002945 | 139 |
| 114 | 3300025941 | Ga0207711_10929134 | Ga0207711_109291341 | 139 |
| 115 | 3300025942 | Ga0207689_11418557 | Ga0207689_114185571 | 139 |
| 116 | 3300025949 | Ga0207667_10000026 | Ga0207667_10000026338 | 139 |
| 117 | 3300025961 | Ga0207712_10192182 | Ga0207712_101921821 | 139 |
| 118 | 3300025972 | Ga0207668_11231088 | Ga0207668_112310882 | 139 |
| 119 | 3300026078 | Ga0207702_12317834 | Ga0207702_123178341 | 139 |
| 120 | 3300026088 | Ga0207641_10091006 | Ga0207641_100910062 | 139 |
| 121 | 3300026095 | Ga0207676_10313318 | Ga0207676_103133182 | 139 |
| 122 | 3300026118 | Ga0207675_100971851 | Ga0207675_1009718511 | 139 |
| 123 | 3300026142 | Ga0207698_11384315 | Ga0207698_113843151 | 139 |
| 124 | 3300028379 | Ga0268266_10052321 | Ga0268266_100523213 | 139 |
| 125 | 3300028380 | Ga0268265_10815589 | Ga0268265_108155892 | 139 |
| 126 | 3300035113 | Ga0373936_0001350 | Ga0373936_0001350_7619_8053 | 139 |
| 127 | 3300048903 | Ga0496100_1412596 | Ga0496100_1412596_69_503 | 139 |
| 128 | 3300048905 | Ga0496102_1209662 | Ga0496102_1209662_226_660 | 139 |
| 129 | 3300048907 | Ga0496104_0026508 | Ga0496104_0026508_2879_3313 | 139 |
| 130 | 3300048908 | Ga0496105_0148807 | Ga0496105_0148807_457_891 | 139 |
| 131 | 3300048911 | Ga0496108_0158326 | Ga0496108_0158326_1242_1676 | 139 |
| 132 | 3300048912 | Ga0496109_0018865 | Ga0496109_0018865_1487_1921 | 139 |
| 133 | 3300048913 | Ga0496110_0054090 | Ga0496110_0054090_2276_2710 | 139 |
| 134 | 3300048914 | Ga0496111_0089078 | Ga0496111_0089078_442_876 | 139 |
| 135 | 3300048915 | Ga0496112_0041065 | Ga0496112_0041065_1487_1921 | 139 |
| 136 | 3300048916 | Ga0496113_0394831 | Ga0496113_0394831_54_488 | 139 |
| 137 | 3300053133 | Ga0500655_013248 | Ga0500655_013248_793_1224 | 139 |
| 138 | 3300053154 | Ga0500619_001138 | Ga0500619_001138_2244_2675 | 139 |
| 139 | 3300005328 | Ga0070676_11540509 | Ga0070676_115405091 | 140 |
| 140 | 3300005339 | Ga0070660_100085560 | Ga0070660_1000855604 | 140 |
| 141 | 3300005345 | Ga0070692_11228545 | Ga0070692_112285451 | 140 |
| 142 | 3300005471 | Ga0070698_101562545 | Ga0070698_1015625451 | 140 |
| 143 | 3300005548 | Ga0070665_100000397 | Ga0070665_10000039717 | 140 |
| 144 | 3300005549 | Ga0070704_100485505 | Ga0070704_1004855052 | 140 |
| 145 | 3300005577 | Ga0068857_101171215 | Ga0068857_1011712151 | 140 |
| 146 | 3300006178 | Ga0075367_10012895 | Ga0075367_100128953 | 140 |
| 147 | 3300006195 | Ga0075366_10110967 | Ga0075366_101109674 | 140 |
| 148 | 3300009093 | Ga0105240_10547335 | Ga0105240_105473352 | 140 |
| 149 | 3300010375 | Ga0105239_10172999 | Ga0105239_101729992 | 140 |
| 150 | 3300014326 | Ga0157380_10313023 | Ga0157380_103130231 | 140 |
| 151 | 3300025940 | Ga0207691_10786993 | Ga0207691_107869932 | 140 |
| 152 | 3300026089 | Ga0207648_10287045 | Ga0207648_102870451 | 140 |
| 153 | 3300028379 | Ga0268266_10000062 | Ga0268266_1000006290 | 140 |
| 154 | 3300048918 | Ga0496115_0011017 | Ga0496115_0011017_4200_4631 | 140 |
| 155 | 2088090001 | CNB_F6ESG4R02JQ950 | CNB_00057510 | 141 |
| 156 | 3300001989 | JGI24739J22299_10042547 | JGI24739J22299_100425472 | 141 |
| 157 | 3300001990 | JGI24737J22298_10005942 | JGI24737J22298_100059421 | 141 |
| 158 | 3300001991 | JGI24743J22301_10150980 | JGI24743J22301_101509801 | 141 |
| 159 | 3300002067 | JGI24735J21928_10020780 | JGI24735J21928_100207802 | 141 |
| 160 | 3300002075 | JGI24738J21930_10016124 | JGI24738J21930_100161243 | 141 |
| 161 | 3300002077 | JGI24744J21845_10001231 | JGI24744J21845_100012312 | 141 |
| 162 | 3300003794 | Ga0055531_10009924 | Ga0055531_100099242 | 141 |
| 163 | 3300005293 | Ga0065715_10424166 | Ga0065715_104241661 | 141 |
| 164 | 3300005293 | Ga0065715_10525224 | Ga0065715_105252241 | 141 |
| 165 | 3300005295 | Ga0065707_10111443 | Ga0065707_101114432 | 141 |
| 166 | 3300005327 | Ga0070658_10803862 | Ga0070658_108038622 | 141 |
| 167 | 3300005328 | Ga0070676_10240031 | Ga0070676_102400312 | 141 |
| 168 | 3300005328 | Ga0070676_10732128 | Ga0070676_107321281 | 141 |
| 169 | 3300005330 | Ga0070690_100465903 | Ga0070690_1004659032 | 141 |
| 170 | 3300005333 | Ga0070677_10169096 | Ga0070677_101690962 | 141 |
| 171 | 3300005334 | Ga0068869_100473458 | Ga0068869_1004734581 | 141 |
| 172 | 3300005335 | Ga0070666_10487726 | Ga0070666_104877261 | 141 |
| 173 | 3300005335 | Ga0070666_10617726 | Ga0070666_106177261 | 141 |
| 174 | 3300005339 | Ga0070660_100125384 | Ga0070660_1001253842 | 141 |
| 175 | 3300005340 | Ga0070689_100228846 | Ga0070689_1002288461 | 141 |
| 176 | 3300005341 | Ga0070691_10051722 | Ga0070691_100517223 | 141 |
| 177 | 3300005343 | Ga0070687_100054518 | Ga0070687_1000545183 | 141 |
| 178 | 3300005347 | Ga0070668_100391743 | Ga0070668_1003917431 | 141 |
| 179 | 3300005347 | Ga0070668_100788289 | Ga0070668_1007882891 | 141 |
| 180 | 3300005353 | Ga0070669_100009424 | Ga0070669_1000094242 | 141 |
| 181 | 3300005353 | Ga0070669_100705022 | Ga0070669_1007050221 | 141 |
| 182 | 3300005354 | Ga0070675_100001422 | Ga0070675_10000142214 | 141 |
| 183 | 3300005354 | Ga0070675_100286949 | Ga0070675_1002869492 | 141 |
| 184 | 3300005355 | Ga0070671_100025461 | Ga0070671_1000254612 | 141 |
| 185 | 3300005355 | Ga0070671_100211844 | Ga0070671_1002118441 | 141 |
| 186 | 3300005356 | Ga0070674_100370331 | Ga0070674_1003703312 | 141 |
| 187 | 3300005364 | Ga0070673_100004870 | Ga0070673_1000048708 | 141 |
| 188 | 3300005364 | Ga0070673_100634376 | Ga0070673_1006343761 | 141 |
| 189 | 3300005365 | Ga0070688_100241229 | Ga0070688_1002412292 | 141 |
| 190 | 3300005366 | Ga0070659_100047492 | Ga0070659_1000474923 | 141 |
| 191 | 3300005366 | Ga0070659_100377836 | Ga0070659_1003778361 | 141 |
| 192 | 3300005366 | Ga0070659_100530678 | Ga0070659_1005306782 | 141 |
| 193 | 3300005438 | Ga0070701_10421329 | Ga0070701_104213292 | 141 |
| 194 | 3300005440 | Ga0070705_100587324 | Ga0070705_1005873241 | 141 |
| 195 | 3300005441 | Ga0070700_100418700 | Ga0070700_1004187002 | 141 |
| 196 | 3300005441 | Ga0070700_100555329 | Ga0070700_1005553291 | 141 |
| 197 | 3300005444 | Ga0070694_100869270 | Ga0070694_1008692701 | 141 |
| 198 | 3300005444 | Ga0070694_101184903 | Ga0070694_1011849031 | 141 |
| 199 | 3300005456 | Ga0070678_100021895 | Ga0070678_1000218953 | 141 |
| 200 | 3300005456 | Ga0070678_101626728 | Ga0070678_1016267281 | 141 |
| 201 | 3300005457 | Ga0070662_100168657 | Ga0070662_1001686571 | 141 |
| 202 | 3300005457 | Ga0070662_101103083 | Ga0070662_1011030831 | 141 |
| 203 | 3300005458 | Ga0070681_11158163 | Ga0070681_111581631 | 141 |
| 204 | 3300005539 | Ga0068853_100192822 | Ga0068853_1001928222 | 141 |
| 205 | 3300005543 | Ga0070672_100034204 | Ga0070672_1000342044 | 141 |
| 206 | 3300005543 | Ga0070672_100117121 | Ga0070672_1001171212 | 141 |
| 207 | 3300005543 | Ga0070672_100131608 | Ga0070672_1001316082 | 141 |
| 208 | 3300005543 | Ga0070672_102128361 | Ga0070672_1021283611 | 141 |
| 209 | 3300005544 | Ga0070686_100107552 | Ga0070686_1001075522 | 141 |
| 210 | 3300005545 | Ga0070695_100567520 | Ga0070695_1005675202 | 141 |
| 211 | 3300005546 | Ga0070696_100181946 | Ga0070696_1001819462 | 141 |
| 212 | 3300005546 | Ga0070696_100614554 | Ga0070696_1006145541 | 141 |
| 213 | 3300005547 | Ga0070693_100415026 | Ga0070693_1004150262 | 141 |
| 214 | 3300005549 | Ga0070704_100073774 | Ga0070704_1000737743 | 141 |
| 215 | 3300005563 | Ga0068855_101203036 | Ga0068855_1012030362 | 141 |
| 216 | 3300005564 | Ga0070664_100115309 | Ga0070664_1001153092 | 141 |
| 217 | 3300005564 | Ga0070664_100395348 | Ga0070664_1003953481 | 141 |
| 218 | 3300005577 | Ga0068857_100408144 | Ga0068857_1004081442 | 141 |
| 219 | 3300005578 | Ga0068854_100099130 | Ga0068854_1000991303 | 141 |
| 220 | 3300005615 | Ga0070702_100036036 | Ga0070702_1000360363 | 141 |
| 221 | 3300005616 | Ga0068852_101150173 | Ga0068852_1011501731 | 141 |
| 222 | 3300005616 | Ga0068852_101848826 | Ga0068852_1018488261 | 141 |
| 223 | 3300005617 | Ga0068859_101696706 | Ga0068859_1016967061 | 141 |
| 224 | 3300005618 | Ga0068864_100484445 | Ga0068864_1004844451 | 141 |
| 225 | 3300005618 | Ga0068864_101023828 | Ga0068864_1010238282 | 141 |
| 226 | 3300005718 | Ga0068866_10162479 | Ga0068866_101624792 | 141 |
| 227 | 3300005719 | Ga0068861_100043170 | Ga0068861_1000431702 | 141 |
| 228 | 3300005719 | Ga0068861_100047351 | Ga0068861_1000473512 | 141 |
| 229 | 3300005719 | Ga0068861_100445968 | Ga0068861_1004459682 | 141 |
| 230 | 3300005719 | Ga0068861_100546066 | Ga0068861_1005460662 | 141 |
| 231 | 3300005834 | Ga0068851_10228332 | Ga0068851_102283321 | 141 |
| 232 | 3300005841 | Ga0068863_101160814 | Ga0068863_1011608141 | 141 |
| 233 | 3300005842 | Ga0068858_100000355 | Ga0068858_10000035538 | 141 |
| 234 | 3300005842 | Ga0068858_100220141 | Ga0068858_1002201413 | 141 |
| 235 | 3300005843 | Ga0068860_100227389 | Ga0068860_1002273892 | 141 |
| 236 | 3300005844 | Ga0068862_100018454 | Ga0068862_1000184544 | 141 |
| 237 | 3300005844 | Ga0068862_100019817 | Ga0068862_1000198176 | 141 |
| 238 | 3300005844 | Ga0068862_100066451 | Ga0068862_1000664512 | 141 |
| 239 | 3300005844 | Ga0068862_100823887 | Ga0068862_1008238872 | 141 |
| 240 | 3300005844 | Ga0068862_101205290 | Ga0068862_1012052901 | 141 |
| 241 | 3300006038 | Ga0075365_10004655 | Ga0075365_100046553 | 141 |
| 242 | 3300006038 | Ga0075365_10048736 | Ga0075365_100487364 | 141 |
| 243 | 3300006038 | Ga0075365_10050150 | Ga0075365_100501504 | 141 |
| 244 | 3300006042 | Ga0075368_10207242 | Ga0075368_102072421 | 141 |
| 245 | 3300006042 | Ga0075368_10230868 | Ga0075368_102308681 | 141 |
| 246 | 3300006042 | Ga0075368_10399306 | Ga0075368_103993061 | 141 |
| 247 | 3300006048 | Ga0075363_100022596 | Ga0075363_1000225964 | 141 |
| 248 | 3300006048 | Ga0075363_100039864 | Ga0075363_1000398645 | 141 |
| 249 | 3300006051 | Ga0075364_10126339 | Ga0075364_101263391 | 141 |
| 250 | 3300006051 | Ga0075364_10171125 | Ga0075364_101711252 | 141 |
| 251 | 3300006058 | Ga0075432_10481430 | Ga0075432_104814301 | 141 |
| 252 | 3300006177 | Ga0075362_10000312 | Ga0075362_1000031211 | 141 |
| 253 | 3300006177 | Ga0075362_10045680 | Ga0075362_100456802 | 141 |
| 254 | 3300006177 | Ga0075362_10087871 | Ga0075362_100878712 | 141 |
| 255 | 3300006178 | Ga0075367_10028911 | Ga0075367_100289112 | 141 |
| 256 | 3300006178 | Ga0075367_10058146 | Ga0075367_100581464 | 141 |
| 257 | 3300006178 | Ga0075367_10062237 | Ga0075367_100622372 | 141 |
| 258 | 3300006178 | Ga0075367_10074095 | Ga0075367_100740952 | 141 |
| 259 | 3300006178 | Ga0075367_10105283 | Ga0075367_101052832 | 141 |
| 260 | 3300006178 | Ga0075367_10194119 | Ga0075367_101941192 | 141 |
| 261 | 3300006178 | Ga0075367_10332597 | Ga0075367_103325971 | 141 |
| 262 | 3300006178 | Ga0075367_11081472 | Ga0075367_110814721 | 141 |
| 263 | 3300006186 | Ga0075369_10000236 | Ga0075369_1000023618 | 141 |
| 264 | 3300006186 | Ga0075369_10001134 | Ga0075369_1000113411 | 141 |
| 265 | 3300006195 | Ga0075366_10031086 | Ga0075366_100310864 | 141 |
| 266 | 3300006353 | Ga0075370_10019581 | Ga0075370_100195812 | 141 |
| 267 | 3300006353 | Ga0075370_10067139 | Ga0075370_100671392 | 141 |
| 268 | 3300006353 | Ga0075370_10417615 | Ga0075370_104176151 | 141 |
| 269 | 3300006358 | Ga0068871_101193039 | Ga0068871_1011930391 | 141 |
| 270 | 3300006844 | Ga0075428_100013655 | Ga0075428_1000136555 | 141 |
| 271 | 3300006844 | Ga0075428_100121470 | Ga0075428_1001214702 | 141 |
| 272 | 3300006844 | Ga0075428_100561951 | Ga0075428_1005619512 | 141 |
| 273 | 3300006844 | Ga0075428_100943103 | Ga0075428_1009431032 | 141 |
| 274 | 3300006846 | Ga0075430_101069501 | Ga0075430_1010695011 | 141 |
| 275 | 3300006846 | Ga0075430_101235773 | Ga0075430_1012357731 | 141 |
| 276 | 3300006847 | Ga0075431_100331592 | Ga0075431_1003315922 | 141 |
| 277 | 3300006847 | Ga0075431_100489747 | Ga0075431_1004897471 | 141 |
| 278 | 3300006852 | Ga0075433_10247370 | Ga0075433_102473703 | 141 |
| 279 | 3300006852 | Ga0075433_10285195 | Ga0075433_102851952 | 141 |
| 280 | 3300006871 | Ga0075434_100195692 | Ga0075434_1001956923 | 141 |
| 281 | 3300006880 | Ga0075429_100057689 | Ga0075429_1000576892 | 141 |
| 282 | 3300006880 | Ga0075429_100213402 | Ga0075429_1002134022 | 141 |
| 283 | 3300006880 | Ga0075429_100880865 | Ga0075429_1008808651 | 141 |
| 284 | 3300006931 | Ga0097620_101696696 | Ga0097620_1016966961 | 141 |
| 285 | 3300007076 | Ga0075435_100526736 | Ga0075435_1005267362 | 141 |
| 286 | 3300009094 | Ga0111539_10140212 | Ga0111539_101402123 | 141 |
| 287 | 3300009094 | Ga0111539_10261278 | Ga0111539_102612782 | 141 |
| 288 | 3300009147 | Ga0114129_10042292 | Ga0114129_100422928 | 141 |
| 289 | 3300009148 | Ga0105243_11331955 | Ga0105243_113319551 | 141 |
| 290 | 3300009551 | Ga0105238_10781140 | Ga0105238_107811401 | 141 |
| 291 | 3300009553 | Ga0105249_10048470 | Ga0105249_100484702 | 141 |
| 292 | 3300010375 | Ga0105239_10992007 | Ga0105239_109920071 | 141 |
| 293 | 3300012513 | Ga0157326_1092420 | Ga0157326_10924201 | 141 |
| 294 | 3300013100 | Ga0157373_11286411 | Ga0157373_112864111 | 141 |
| 295 | 3300014326 | Ga0157380_10133128 | Ga0157380_101331281 | 141 |
| 296 | 3300014326 | Ga0157380_12806435 | Ga0157380_128064351 | 141 |
| 297 | 3300017792 | Ga0163161_10041423 | Ga0163161_100414233 | 141 |
| 298 | 3300017792 | Ga0163161_10142844 | Ga0163161_101428444 | 141 |
| 299 | 3300025233 | Ga0209437_102111 | Ga0209437_1021112 | 141 |
| 300 | 3300025261 | Ga0209233_1000065 | Ga0209233_1000065305 | 141 |
| 301 | 3300025304 | Ga0209257_1002058 | Ga0209257_100205810 | 141 |
| 302 | 3300025321 | Ga0207656_10134755 | Ga0207656_101347552 | 141 |
| 303 | 3300025899 | Ga0207642_10383772 | Ga0207642_103837722 | 141 |
| 304 | 3300025899 | Ga0207642_10397061 | Ga0207642_103970611 | 141 |
| 305 | 3300025901 | Ga0207688_10034265 | Ga0207688_100342651 | 141 |
| 306 | 3300025901 | Ga0207688_10034928 | Ga0207688_100349282 | 141 |
| 307 | 3300025901 | Ga0207688_10362492 | Ga0207688_103624922 | 141 |
| 308 | 3300025903 | Ga0207680_10255779 | Ga0207680_102557792 | 141 |
| 309 | 3300025904 | Ga0207647_10229340 | Ga0207647_102293401 | 141 |
| 310 | 3300025907 | Ga0207645_10018571 | Ga0207645_100185714 | 141 |
| 311 | 3300025909 | Ga0207705_10294459 | Ga0207705_102944592 | 141 |
| 312 | 3300025911 | Ga0207654_10196241 | Ga0207654_101962412 | 141 |
| 313 | 3300025912 | Ga0207707_10257247 | Ga0207707_102572471 | 141 |
| 314 | 3300025913 | Ga0207695_10369802 | Ga0207695_103698022 | 141 |
| 315 | 3300025917 | Ga0207660_11510042 | Ga0207660_115100421 | 141 |
| 316 | 3300025918 | Ga0207662_10017085 | Ga0207662_100170853 | 141 |
| 317 | 3300025919 | Ga0207657_10012407 | Ga0207657_100124079 | 141 |
| 318 | 3300025919 | Ga0207657_10043143 | Ga0207657_100431434 | 141 |
| 319 | 3300025923 | Ga0207681_10032439 | Ga0207681_100324392 | 141 |
| 320 | 3300025923 | Ga0207681_10331270 | Ga0207681_103312702 | 141 |
| 321 | 3300025923 | Ga0207681_10948339 | Ga0207681_109483392 | 141 |
| 322 | 3300025924 | Ga0207694_10278397 | Ga0207694_102783971 | 141 |
| 323 | 3300025924 | Ga0207694_10765132 | Ga0207694_107651321 | 141 |
| 324 | 3300025926 | Ga0207659_10003104 | Ga0207659_100031044 | 141 |
| 325 | 3300025927 | Ga0207687_10761809 | Ga0207687_107618092 | 141 |
| 326 | 3300025931 | Ga0207644_10163279 | Ga0207644_101632792 | 141 |
| 327 | 3300025931 | Ga0207644_10503823 | Ga0207644_105038232 | 141 |
| 328 | 3300025932 | Ga0207690_10034214 | Ga0207690_100342142 | 141 |
| 329 | 3300025932 | Ga0207690_11270120 | Ga0207690_112701201 | 141 |
| 330 | 3300025933 | Ga0207706_10195650 | Ga0207706_101956502 | 141 |
| 331 | 3300025933 | Ga0207706_10212375 | Ga0207706_102123753 | 141 |
| 332 | 3300025934 | Ga0207686_10101128 | Ga0207686_101011282 | 141 |
| 333 | 3300025934 | Ga0207686_10851420 | Ga0207686_108514202 | 141 |
| 334 | 3300025936 | Ga0207670_10455467 | Ga0207670_104554672 | 141 |
| 335 | 3300025936 | Ga0207670_11931866 | Ga0207670_119318661 | 141 |
| 336 | 3300025937 | Ga0207669_10243508 | Ga0207669_102435082 | 141 |
| 337 | 3300025940 | Ga0207691_10065496 | Ga0207691_100654963 | 141 |
| 338 | 3300025940 | Ga0207691_10080147 | Ga0207691_100801474 | 141 |
| 339 | 3300025940 | Ga0207691_10164498 | Ga0207691_101644982 | 141 |
| 340 | 3300025940 | Ga0207691_10188020 | Ga0207691_101880202 | 141 |
| 341 | 3300025941 | Ga0207711_10133522 | Ga0207711_101335222 | 141 |
| 342 | 3300025942 | Ga0207689_10442194 | Ga0207689_104421942 | 141 |
| 343 | 3300025942 | Ga0207689_10510899 | Ga0207689_105108992 | 141 |
| 344 | 3300025945 | Ga0207679_10086865 | Ga0207679_100868652 | 141 |
| 345 | 3300025949 | Ga0207667_11978808 | Ga0207667_119788081 | 141 |
| 346 | 3300025960 | Ga0207651_10020268 | Ga0207651_100202684 | 141 |
| 347 | 3300025961 | Ga0207712_10927028 | Ga0207712_109270282 | 141 |
| 348 | 3300025961 | Ga0207712_12055447 | Ga0207712_120554471 | 141 |
| 349 | 3300025972 | Ga0207668_10133041 | Ga0207668_101330412 | 141 |
| 350 | 3300025972 | Ga0207668_10195676 | Ga0207668_101956762 | 141 |
| 351 | 3300025972 | Ga0207668_11070084 | Ga0207668_110700841 | 141 |
| 352 | 3300025981 | Ga0207640_11573293 | Ga0207640_115732931 | 141 |
| 353 | 3300026023 | Ga0207677_10460895 | Ga0207677_104608952 | 141 |
| 354 | 3300026035 | Ga0207703_10000873 | Ga0207703_1000087323 | 141 |
| 355 | 3300026035 | Ga0207703_10263333 | Ga0207703_102633332 | 141 |
| 356 | 3300026041 | Ga0207639_10123123 | Ga0207639_101231232 | 141 |
| 357 | 3300026067 | Ga0207678_10047177 | Ga0207678_100471771 | 141 |
| 358 | 3300026067 | Ga0207678_10294361 | Ga0207678_102943612 | 141 |
| 359 | 3300026075 | Ga0207708_10694064 | Ga0207708_106940642 | 141 |
| 360 | 3300026078 | Ga0207702_10063715 | Ga0207702_100637153 | 141 |
| 361 | 3300026088 | Ga0207641_10728829 | Ga0207641_107288292 | 141 |
| 362 | 3300026089 | Ga0207648_10194886 | Ga0207648_101948862 | 141 |
| 363 | 3300026095 | Ga0207676_10641657 | Ga0207676_106416572 | 141 |
| 364 | 3300026116 | Ga0207674_10141808 | Ga0207674_101418082 | 141 |
| 365 | 3300026116 | Ga0207674_11424252 | Ga0207674_114242521 | 141 |
| 366 | 3300026118 | Ga0207675_100147433 | Ga0207675_1001474333 | 141 |
| 367 | 3300026118 | Ga0207675_100735165 | Ga0207675_1007351651 | 141 |
| 368 | 3300026121 | Ga0207683_10005980 | Ga0207683_100059806 | 141 |
| 369 | 3300026121 | Ga0207683_10371911 | Ga0207683_103719111 | 141 |
| 370 | 3300026121 | Ga0207683_11923362 | Ga0207683_119233621 | 141 |
| 371 | 3300026121 | Ga0207683_11939863 | Ga0207683_119398631 | 141 |
| 372 | 3300026142 | Ga0207698_10000365 | Ga0207698_1000036511 | 141 |
| 373 | 3300026142 | Ga0207698_11186851 | Ga0207698_111868512 | 141 |
| 374 | 3300026142 | Ga0207698_11582648 | Ga0207698_115826481 | 141 |
| 375 | 3300027695 | Ga0209966_1006348 | Ga0209966_10063481 | 141 |
| 376 | 3300027717 | Ga0209998_10216412 | Ga0209998_102164121 | 141 |
| 377 | 3300027876 | Ga0209974_10053266 | Ga0209974_100532662 | 141 |
| 378 | 3300027907 | Ga0207428_10134263 | Ga0207428_101342632 | 141 |
| 379 | 3300027907 | Ga0207428_10178974 | Ga0207428_101789742 | 141 |
| 380 | 3300028379 | Ga0268266_10734334 | Ga0268266_107343342 | 141 |
| 381 | 3300028380 | Ga0268265_10015065 | Ga0268265_100150655 | 141 |
| 382 | 3300028380 | Ga0268265_10042911 | Ga0268265_100429113 | 141 |
| 383 | 3300028380 | Ga0268265_10627116 | Ga0268265_106271161 | 141 |
| 384 | 3300028380 | Ga0268265_11375438 | Ga0268265_113754381 | 141 |
| 385 | 3300028381 | Ga0268264_12398660 | Ga0268264_123986601 | 141 |
| 386 | 3300028786 | Ga0307517_10174245 | Ga0307517_101742452 | 141 |
| 387 | 3300028786 | Ga0307517_10316943 | Ga0307517_103169431 | 141 |
| 388 | 3300031649 | Ga0307514_10544768 | Ga0307514_105447681 | 141 |
| 389 | 3300031731 | Ga0307405_10973583 | Ga0307405_109735832 | 141 |
| 390 | 3300031852 | Ga0307410_10424847 | Ga0307410_104248471 | 141 |
| 391 | 3300031911 | Ga0307412_10291320 | Ga0307412_102913202 | 141 |
| 392 | 3300031995 | Ga0307409_100387957 | Ga0307409_1003879572 | 141 |
| 393 | 3300032002 | Ga0307416_100226048 | Ga0307416_1002260483 | 141 |
| 394 | 3300032002 | Ga0307416_100568056 | Ga0307416_1005680563 | 141 |
| 395 | 3300032005 | Ga0307411_10215397 | Ga0307411_102153971 | 141 |
| 396 | 3300033180 | Ga0307510_10336055 | Ga0307510_103360551 | 141 |
| 397 | 3300033180 | Ga0307510_10624503 | Ga0307510_106245031 | 141 |
| 398 | 3300034820 | Ga0373959_0035848 | Ga0373959_0035848_241_666 | 141 |
| 399 | 3300037068 | Ga0373925_0008164 | Ga0373925_0008164_2489_2914 | 141 |
| 400 | 3300041451 | Ga0451791_0798306 | Ga0451791_0798306_245_679 | 141 |
| 401 | 3300041505 | Ga0451849_0542985 | Ga0451849_0542985_653_1087 | 141 |
| 402 | 3300041509 | Ga0451843_0976675 | Ga0451843_0976675_161_595 | 141 |
| 403 | 3300044658 | Ga0466972_0003498 | Ga0466972_0003498_2586_3020 | 141 |
| 404 | 3300044684 | Ga0466966_0047292 | Ga0466966_0047292_2194_2628 | 141 |
| 405 | 3300044693 | Ga0466961_0004729 | Ga0466961_0004729_4819_5253 | 141 |
| 406 | 3300044706 | Ga0466964_0018601 | Ga0466964_0018601_848_1282 | 141 |
| 407 | 3300044719 | Ga0466971_0236666 | Ga0466971_0236666_411_851 | 141 |
| 408 | 3300044765 | Ga0466970_0019410 | Ga0466970_0019410_133_567 | 141 |
| 409 | 3300044901 | Ga0466960_0046104 | Ga0466960_0046104_683_1117 | 141 |
| 410 | 3300045049 | Ga0466959_0006392 | Ga0466959_0006392_4837_5271 | 141 |
| 411 | 3300046460 | Ga0495638_0006082 | Ga0495638_0006082_2981_3415 | 141 |
| 412 | 3300046460 | Ga0495638_0007622 | Ga0495638_0007622_465_890 | 141 |
| 413 | 3300046491 | Ga0495584_0036115 | Ga0495584_0036115_324_758 | 141 |
| 414 | 3300046501 | Ga0495607_0149086 | Ga0495607_0149086_377_802 | 141 |
| 415 | 3300046522 | Ga0495643_0384155 | Ga0495643_0384155_93_518 | 141 |
| 416 | 3300046528 | Ga0495642_0013080 | Ga0495642_0013080_276_710 | 141 |
| 417 | 3300046539 | Ga0495621_0146750 | Ga0495621_0146750_257_682 | 141 |
| 418 | 3300047445 | Ga0495677_0000757 | Ga0495677_0000757_12157_12591 | 141 |
| 419 | 3300047471 | Ga0495684_0252909 | Ga0495684_0252909_677_1102 | 141 |
| 420 | 3300047472 | Ga0495686_0013186 | Ga0495686_0013186_900_1334 | 141 |
| 421 | 3300048906 | Ga0496103_0122885 | Ga0496103_0122885_103_528 | 141 |
| 422 | 3300050489 | nmdc:mga03683_42220_c1 | nmdc:mga03683_42220_c1_1145_1579 | 141 |
| 423 | 3300050489 | nmdc:mga03683_7152_c2 | nmdc:mga03683_7152_c2_674_1099 | 141 |
| 424 | 3300050491 | nmdc:mga00v17_6036_c1 | nmdc:mga00v17_6036_c1_5236_5670 | 141 |
| 425 | 3300050492 | nmdc:mga0yw44_297078_c1 | nmdc:mga0yw44_297078_c1_296_721 | 141 |
| 426 | 3300050492 | nmdc:mga0yw44_40164_c1 | nmdc:mga0yw44_40164_c1_449_874 | 141 |
| 427 | 3300050493 | nmdc:mga0k408_273497_c1 | nmdc:mga0k408_273497_c1_113_547 | 141 |
| 428 | 3300050493 | nmdc:mga0k408_83960_c1 | nmdc:mga0k408_83960_c1_1204_1638 | 141 |
| 429 | 3300050494 | nmdc:mga06z11_16465_c1 | nmdc:mga06z11_16465_c1_2372_2806 | 141 |
| 430 | 3300050494 | nmdc:mga06z11_170332_c1 | nmdc:mga06z11_170332_c1_773_1198 | 141 |
| 431 | 3300050494 | nmdc:mga06z11_191568_c1 | nmdc:mga06z11_191568_c1_620_1045 | 141 |
| 432 | 3300050494 | nmdc:mga06z11_34575_c1 | nmdc:mga06z11_34575_c1_1040_1465 | 141 |
| 433 | 3300050496 | nmdc:mga07m45_76596_c1 | nmdc:mga07m45_76596_c1_865_1290 | 141 |
| 434 | 3300050496 | nmdc:mga07m45_805217_c1 | nmdc:mga07m45_805217_c1_99_524 | 141 |
| 435 | 3300050507 | nmdc:mga05p37_837896_c1 | nmdc:mga05p37_837896_c1_489_923 | 141 |
| 436 | 3300050508 | nmdc:mga09592_39779_c1 | nmdc:mga09592_39779_c1_1481_1915 | 141 |
| 437 | 3300050509 | nmdc:mga0qj67_678735_c1 | nmdc:mga0qj67_678735_c1_371_805 | 141 |
| 438 | 3300050510 | nmdc:mga06r32_1104_c1 | nmdc:mga06r32_1104_c1_11155_11589 | 141 |
| 439 | 3300050511 | nmdc:mga08y16_75642_c1 | nmdc:mga08y16_75642_c1_996_1430 | 141 |
| 440 | 3300050516 | nmdc:mga0sz30_129_c1 | nmdc:mga0sz30_129_c1_23361_23786 | 141 |
| 441 | 3300053080 | Ga0500635_0232601 | Ga0500635_0232601_71_496 | 141 |
| 442 | 3300053125 | Ga0500618_006698 | Ga0500618_006698_2508_2933 | 141 |
| 443 | 3300053133 | Ga0500655_085655 | Ga0500655_085655_181_606 | 141 |
| 444 | 3300053153 | Ga0500616_0110533 | Ga0500616_0110533_606_1040 | 141 |
| 445 | 3300053156 | Ga0500622_0233780 | Ga0500622_0233780_72_506 | 141 |
| 446 | 3300061719 | Ga0466962_0049418 | Ga0466962_0049418_155_589 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4liv-assembly1.cif.gz_A-2 | structure of ycfd, a ribosomal oxygenase from escherichia coli in complex with cobalt and succinic acid. | 0.3966 | 13 | 81 |
| 4zoh-assembly1.cif.gz_B-2 | crystal structure of glyceraldehyde oxidoreductase | 0.3819 | 50 | 110 |
| 4jjo-assembly1.cif.gz_A | crystal structure of apo-clavibacter michiganensis expansin | 0.3792 | 48 | 115 |
| 3qnw-assembly2.cif.gz_F | caspase-6 in complex with z-vad-fmk inhibitor | 0.3786 | 5 | 41 |
| 4fer-assembly1.cif.gz_A | crystal structure of bacillus subtilis expansin (exlx1) in complex with cellohexaose | 0.3785 | 42 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C0PDG6_22_115_2.60.200.20 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.5155 | 51 | 81 | 2.60.200.20 |
| af_Q7YWS4_25_106_3.30.740.10 | Alpha Beta;2-Layer Sandwich;Protein Inhibitor Of Neuronal Nitric Oxide Synthase;Protein Inhibitor Of Neuronal Nitric Oxide Synthase; | 0.4964 | 52 | 110 | 3.30.740.10 |
| af_M1ZMM0_290_417_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.4527 | 48 | 113 | 3.30.465.10 |
| af_F1RBF2_107_190_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.4479 | 46 | 81 | 2.60.40.10 |
| af_Q0DKN3_245_359_3.40.20.10 | Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin | 0.4464 | 51 | 81 | 3.40.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W0AZC0-F1-model_v4 | Dehydrogenase | 0.7813 | 46 | 124 |
|
| AF-A0A7K2QFP3-F1-model_v4 | Transcriptional regulator | 0.7293 | 44 | 111 |
|
| AF-A0A7K2QFP3-F1-model_v4 | Transcriptional regulator | 0.6578 | 44 | 111 |
|
| AF-A0A2W0AZC0-F1-model_v4 | Dehydrogenase | 0.6377 | 46 | 124 |
|
| AF-A0A848FE34-F1-model_v4 | YCII-related domain-containing protein | 0.6238 | 9 | 130 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar