F445775

General Info

Members Datasets Scaffolds Average Seq Length
446 264 443 142

Family's Representative Sequence

Representative Sequence 3300042439|Ga0439464_0301123|Ga0439464_0301123_39_467
Length 142
Sequence MRVMVLSKATEGMELGEPTPEALEAFAAMDRFTEELVKAGVFVAAAGLKNGAQSKRIVVTEGGSRTVIDGPFAETRELIVGFSIWEVKDMDEALAWAKRAPTLPGEMEIRPFYEAADLAAFVTPEELAAAPRDGERGKLGVA

Samples

Sample ID Description Type Environment
1 2088090001 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB Metagenome Rhizosphere
2 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
3 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
4 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
188 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
189 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
192 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
193 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
194 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
195 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
255 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
256 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
257 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
262 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
263 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.8
Nodule 0
Rhizoplane 4.04
Rhizosphere 78.48
Stem 0
Stem Tuber 0
Unclassified 2.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNB_F6ESG4R02JQ950 2088090001 Bacteria 531
2 JGI24739J22299_10042547 3300001989 Bacteria 1506
3 JGI24737J22298_10005942 3300001990 Bacteria 4195
4 JGI24743J22301_10150980 3300001991 Bacteria 521
5 JGI24735J21928_10020780 3300002067 Bacteria 2009
6 JGI24738J21930_10016124 3300002075 Bacteria 1582
7 JGI24744J21845_10001231 3300002077 Bacteria 5024
8 Ga0055531_10009924 3300003794 Bacteria 4809
9 Ga0065704_10126899 3300005289 Bacteria 1683
10 Ga0065712_10002464 3300005290 Bacteria 5762
11 Ga0065715_10424166 3300005293 Bacteria 847
12 Ga0065715_10525224 3300005293 Bacteria 760
13 Ga0065707_10111443 3300005295 Bacteria 2393
14 Ga0070658_10803862 3300005327 Bacteria 817
15 Ga0070676_10240031 3300005328 Bacteria 1205
16 Ga0070676_10732128 3300005328 Bacteria 725
17 Ga0070676_11540509 3300005328 Bacteria 513
18 Ga0070690_100465903 3300005330 Bacteria 939
19 Ga0070677_10169096 3300005333 Bacteria 1032
20 Ga0068869_100473458 3300005334 Bacteria 1042
21 Ga0070666_10487726 3300005335 Bacteria 893
22 Ga0070666_10617726 3300005335 Bacteria 791
23 Ga0070660_100085560 3300005339 Bacteria 2480
24 Ga0070660_100125384 3300005339 Bacteria 2052
25 Ga0070689_100228846 3300005340 Bacteria 1527
26 Ga0070689_101746614 3300005340 Bacteria 567
27 Ga0070691_10051722 3300005341 Bacteria 1963
28 Ga0070687_100054518 3300005343 Bacteria 2083
29 Ga0070661_100183898 3300005344 Bacteria 1591
30 Ga0070692_11228545 3300005345 Bacteria 535
31 Ga0070668_100154251 3300005347 Bacteria 1860
32 Ga0070668_100391743 3300005347 Bacteria 1184
33 Ga0070668_100788289 3300005347 Bacteria 843
34 Ga0070669_100009424 3300005353 Bacteria 6952
35 Ga0070669_100705022 3300005353 Bacteria 852
36 Ga0070675_100001422 3300005354 Bacteria 17585
37 Ga0070675_100105520 3300005354 Bacteria 2377
38 Ga0070675_100286949 3300005354 Bacteria 1448
39 Ga0070671_100025461 3300005355 Bacteria 4855
40 Ga0070671_100211844 3300005355 Bacteria 1643
41 Ga0070671_100309407 3300005355 Bacteria 1346
42 Ga0070674_100370331 3300005356 Bacteria 1162
43 Ga0070673_100004870 3300005364 Bacteria 8547
44 Ga0070673_100634376 3300005364 Bacteria 977
45 Ga0070688_100241229 3300005365 Bacteria 1283
46 Ga0070659_100047492 3300005366 Bacteria 3368
47 Ga0070659_100377836 3300005366 Bacteria 1193
48 Ga0070659_100530678 3300005366 Bacteria 1006
49 Ga0070667_100430521 3300005367 Bacteria 1204
50 Ga0070701_10421329 3300005438 Bacteria 850
51 Ga0070705_100587324 3300005440 Bacteria 860
52 Ga0070700_100418700 3300005441 Bacteria 1012
53 Ga0070700_100555329 3300005441 Bacteria 893
54 Ga0070694_100869270 3300005444 Bacteria 743
55 Ga0070694_101184903 3300005444 Bacteria 640
56 Ga0070678_100021895 3300005456 Bacteria 4225
57 Ga0070678_100346669 3300005456 Bacteria 1276
58 Ga0070678_101626728 3300005456 Bacteria 607
59 Ga0070662_100168657 3300005457 Bacteria 1717
60 Ga0070662_101103083 3300005457 Bacteria 681
61 Ga0070681_11158163 3300005458 Bacteria 695
62 Ga0068867_100205535 3300005459 Bacteria 1578
63 Ga0070685_10028427 3300005466 Bacteria 3097
64 Ga0070698_101562545 3300005471 Bacteria 611
65 Ga0068853_100192822 3300005539 Bacteria 1852
66 Ga0070672_100034204 3300005543 Bacteria 3856
67 Ga0070672_100117121 3300005543 Bacteria 2177
68 Ga0070672_100131608 3300005543 Bacteria 2057
69 Ga0070672_102128361 3300005543 Bacteria 506
70 Ga0070686_100107552 3300005544 Bacteria 1894
71 Ga0070695_100567520 3300005545 Bacteria 887
72 Ga0070696_100181946 3300005546 Bacteria 1560
73 Ga0070696_100614554 3300005546 Bacteria 878
74 Ga0070693_100415026 3300005547 Bacteria 936
75 Ga0070665_100000397 3300005548 Bacteria 64128
76 Ga0070665_100020573 3300005548 Bacteria 6630
77 Ga0070704_100073774 3300005549 Bacteria 2487
78 Ga0070704_100485505 3300005549 Bacteria 1070
79 Ga0068855_100000144 3300005563 Bacteria 91639
80 Ga0068855_101203036 3300005563 Bacteria 788
81 Ga0070664_100115309 3300005564 Bacteria 2348
82 Ga0070664_100395348 3300005564 Bacteria 1263
83 Ga0068857_100408144 3300005577 Bacteria 1265
84 Ga0068857_101171215 3300005577 Bacteria 744
85 Ga0068854_100099130 3300005578 Bacteria 2182
86 Ga0070702_100036036 3300005615 Bacteria 2737
87 Ga0068852_101150173 3300005616 Bacteria 797
88 Ga0068852_101418482 3300005616 Bacteria 717
89 Ga0068852_101848826 3300005616 Bacteria 626
90 Ga0068852_102467574 3300005616 Bacteria 540
91 Ga0068859_101696706 3300005617 Bacteria 698
92 Ga0068864_100031721 3300005618 Bacteria 4485
93 Ga0068864_100484445 3300005618 Bacteria 1188
94 Ga0068864_101023828 3300005618 Bacteria 820
95 Ga0068866_10162479 3300005718 Bacteria 1304
96 Ga0068861_100043170 3300005719 Bacteria 3382
97 Ga0068861_100047351 3300005719 Bacteria 3245
98 Ga0068861_100445968 3300005719 Bacteria 1159
99 Ga0068861_100546066 3300005719 Bacteria 1055
100 Ga0068851_10228332 3300005834 Bacteria 1048
101 Ga0068863_100029480 3300005841 Bacteria 5237
102 Ga0068863_101160814 3300005841 Bacteria 778
103 Ga0068858_100000355 3300005842 Bacteria 48299
104 Ga0068858_100220141 3300005842 Bacteria 1797
105 Ga0068858_101492289 3300005842 Bacteria 667
106 Ga0068860_100227389 3300005843 Bacteria 1812
107 Ga0068862_100018454 3300005844 Bacteria 5810
108 Ga0068862_100019817 3300005844 Bacteria 5617
109 Ga0068862_100066451 3300005844 Bacteria 3108
110 Ga0068862_100354754 3300005844 Bacteria 1361
111 Ga0068862_100823887 3300005844 Bacteria 908
112 Ga0068862_101205290 3300005844 Bacteria 756
113 Ga0075365_10004655 3300006038 Bacteria 7305
114 Ga0075365_10048736 3300006038 Bacteria 2789
115 Ga0075365_10050150 3300006038 Bacteria 2753
116 Ga0075368_10207242 3300006042 Bacteria 830
117 Ga0075368_10230868 3300006042 Bacteria 788
118 Ga0075368_10399306 3300006042 Bacteria 604
119 Ga0075363_100022596 3300006048 Bacteria 3181
120 Ga0075363_100039864 3300006048 Bacteria 2474
121 Ga0075364_10126339 3300006051 Bacteria 1715
122 Ga0075364_10171125 3300006051 Bacteria 1468
123 Ga0075432_10481430 3300006058 Bacteria 550
124 Ga0075362_10000312 3300006177 Bacteria 13807
125 Ga0075362_10045680 3300006177 Bacteria 1946
126 Ga0075362_10087871 3300006177 Bacteria 1440
127 Ga0075367_10012895 3300006178 Bacteria 4477
128 Ga0075367_10028911 3300006178 Bacteria 3166
129 Ga0075367_10058146 3300006178 Bacteria 2300
130 Ga0075367_10062237 3300006178 Bacteria 2228
131 Ga0075367_10074095 3300006178 Bacteria 2053
132 Ga0075367_10105283 3300006178 Bacteria 1727
133 Ga0075367_10194119 3300006178 Bacteria 1267
134 Ga0075367_10332597 3300006178 Bacteria 958
135 Ga0075367_11081472 3300006178 Bacteria 513
136 Ga0075369_10000236 3300006186 Bacteria 16397
137 Ga0075369_10001134 3300006186 Bacteria 8977
138 Ga0075366_10031086 3300006195 Bacteria 3141
139 Ga0075366_10110967 3300006195 Bacteria 1649
140 Ga0097621_100289194 3300006237 Bacteria 1444
141 Ga0075370_10019581 3300006353 Bacteria 3687
142 Ga0075370_10067139 3300006353 Bacteria 2047
143 Ga0075370_10417615 3300006353 Bacteria 806
144 Ga0068871_101193039 3300006358 Bacteria 714
145 Ga0075428_100013655 3300006844 Bacteria 9042
146 Ga0075428_100121470 3300006844 Bacteria 2844
147 Ga0075428_100561951 3300006844 Bacteria 1219
148 Ga0075428_100943103 3300006844 Bacteria 915
149 Ga0075430_101069501 3300006846 Bacteria 665
150 Ga0075430_101235773 3300006846 Bacteria 615
151 Ga0075431_100331592 3300006847 Bacteria 1532
152 Ga0075431_100489747 3300006847 Bacteria 1222
153 Ga0075433_10247370 3300006852 Bacteria 1582
154 Ga0075433_10285195 3300006852 Bacteria 1463
155 Ga0075434_100195692 3300006871 Bacteria 2041
156 Ga0075429_100057689 3300006880 Bacteria 3380
157 Ga0075429_100213402 3300006880 Bacteria 1691
158 Ga0075429_100880865 3300006880 Bacteria 784
159 Ga0097620_101696696 3300006931 Bacteria 698
160 Ga0075435_100526736 3300007076 Bacteria 1022
161 Ga0105240_10547335 3300009093 Bacteria 1281
162 Ga0105240_10830642 3300009093 Bacteria 999
163 Ga0105240_11050812 3300009093 Bacteria 869
164 Ga0111539_10013494 3300009094 Bacteria 10209
165 Ga0111539_10132359 3300009094 Bacteria 2920
166 Ga0111539_10140212 3300009094 Bacteria 2831
167 Ga0111539_10261278 3300009094 Bacteria 2015
168 Ga0111539_13089120 3300009094 Bacteria 537
169 Ga0105245_10141539 3300009098 Bacteria 2266
170 Ga0105247_10015421 3300009101 Bacteria 4578
171 Ga0114129_10042292 3300009147 Bacteria 6416
172 Ga0114129_10380423 3300009147 Bacteria 1864
173 Ga0114129_11292034 3300009147 Bacteria 905
174 Ga0105243_10843324 3300009148 Bacteria 907
175 Ga0105243_11331955 3300009148 Bacteria 736
176 Ga0105241_10331413 3300009174 Bacteria 1316
177 Ga0105242_10090488 3300009176 Bacteria 2574
178 Ga0105248_10000001 3300009177 Bacteria 1881304
179 Ga0105248_10674873 3300009177 Bacteria 1166
180 Ga0105238_10781140 3300009551 Bacteria 970
181 Ga0105249_10007875 3300009553 Bacteria 9282
182 Ga0105249_10048470 3300009553 Bacteria 3873
183 Ga0105249_10177161 3300009553 Bacteria 2071
184 Ga0105239_10036242 3300010375 Bacteria 5417
185 Ga0105239_10172999 3300010375 Bacteria 2415
186 Ga0105239_10992007 3300010375 Bacteria 965
187 Ga0157326_1092420 3300012513 Bacteria 511
188 Ga0157373_10126261 3300013100 Bacteria 1799
189 Ga0157373_11286411 3300013100 Bacteria 553
190 Ga0157369_10010907 3300013105 Bacteria 10348
191 Ga0157374_11450189 3300013296 Bacteria 709
192 Ga0157378_10153217 3300013297 Bacteria 2149
193 Ga0157378_11494598 3300013297 Bacteria 720
194 Ga0163162_11342470 3300013306 Bacteria 813
195 Ga0163162_12469209 3300013306 Bacteria 598
196 Ga0163163_10156309 3300014325 Bacteria 2325
197 Ga0157380_10133128 3300014326 Bacteria 2124
198 Ga0157380_10313023 3300014326 Bacteria 1452
199 Ga0157380_10594512 3300014326 Bacteria 1094
200 Ga0157380_12806435 3300014326 Bacteria 554
201 Ga0157377_10130954 3300014745 Bacteria 1532
202 Ga0163161_10041423 3300017792 Bacteria 3310
203 Ga0163161_10142844 3300017792 Bacteria 1813
204 Ga0209437_102111 3300025233 Bacteria 4017
205 Ga0209233_1000065 3300025261 Bacteria 387195
206 Ga0209257_1002058 3300025304 Bacteria 21303
207 Ga0207656_10134755 3300025321 Bacteria 1160
208 Ga0207642_10383772 3300025899 Bacteria 837
209 Ga0207642_10397061 3300025899 Bacteria 824
210 Ga0207688_10034265 3300025901 Bacteria 2811
211 Ga0207688_10034928 3300025901 Bacteria 2785
212 Ga0207688_10362492 3300025901 Bacteria 894
213 Ga0207680_10255779 3300025903 Bacteria 1211
214 Ga0207680_10796913 3300025903 Bacteria 677
215 Ga0207647_10229340 3300025904 Bacteria 1069
216 Ga0207645_10018571 3300025907 Bacteria 4571
217 Ga0207705_10294459 3300025909 Bacteria 1244
218 Ga0207654_10196241 3300025911 Bacteria 1326
219 Ga0207707_10257247 3300025912 Bacteria 1516
220 Ga0207695_10000012 3300025913 Bacteria 840961
221 Ga0207695_10369802 3300025913 Bacteria 1320
222 Ga0207660_11510042 3300025917 Bacteria 543
223 Ga0207662_10017085 3300025918 Bacteria 4101
224 Ga0207657_10012407 3300025919 Bacteria 8420
225 Ga0207657_10043143 3300025919 Bacteria 3975
226 Ga0207649_10106388 3300025920 Bacteria 1866
227 Ga0207681_10032439 3300025923 Bacteria 3419
228 Ga0207681_10331270 3300025923 Bacteria 1213
229 Ga0207681_10948339 3300025923 Bacteria 721
230 Ga0207694_10278397 3300025924 Bacteria 1374
231 Ga0207694_10765132 3300025924 Bacteria 815
232 Ga0207650_10033844 3300025925 Bacteria 3704
233 Ga0207659_10003104 3300025926 Bacteria 9922
234 Ga0207659_10063488 3300025926 Bacteria 2670
235 Ga0207687_10761809 3300025927 Bacteria 824
236 Ga0207687_11218794 3300025927 Bacteria 647
237 Ga0207644_10163279 3300025931 Bacteria 1733
238 Ga0207644_10503823 3300025931 Bacteria 999
239 Ga0207644_10505679 3300025931 Bacteria 997
240 Ga0207690_10034214 3300025932 Bacteria 3273
241 Ga0207690_11270120 3300025932 Bacteria 615
242 Ga0207706_10195650 3300025933 Bacteria 1774
243 Ga0207706_10212375 3300025933 Bacteria 1696
244 Ga0207686_10101128 3300025934 Bacteria 1925
245 Ga0207686_10851420 3300025934 Bacteria 733
246 Ga0207670_10448476 3300025936 Bacteria 1040
247 Ga0207670_10455467 3300025936 Bacteria 1032
248 Ga0207670_11931866 3300025936 Bacteria 502
249 Ga0207669_10243508 3300025937 Bacteria 1334
250 Ga0207691_10065496 3300025940 Bacteria 3288
251 Ga0207691_10080147 3300025940 Bacteria 2937
252 Ga0207691_10164498 3300025940 Bacteria 1945
253 Ga0207691_10188020 3300025940 Bacteria 1802
254 Ga0207691_10786993 3300025940 Bacteria 800
255 Ga0207711_10000002 3300025941 Bacteria 1228676
256 Ga0207711_10133522 3300025941 Bacteria 2227
257 Ga0207711_10929134 3300025941 Bacteria 808
258 Ga0207689_10442194 3300025942 Bacteria 1086
259 Ga0207689_10510899 3300025942 Bacteria 1007
260 Ga0207689_11418557 3300025942 Bacteria 582
261 Ga0207679_10086865 3300025945 Bacteria 2407
262 Ga0207667_10000026 3300025949 Bacteria 343713
263 Ga0207667_11978808 3300025949 Bacteria 543
264 Ga0207651_10020268 3300025960 Bacteria 4009
265 Ga0207712_10192182 3300025961 Bacteria 1612
266 Ga0207712_10927028 3300025961 Bacteria 771
267 Ga0207712_12055447 3300025961 Bacteria 511
268 Ga0207668_10133041 3300025972 Bacteria 1902
269 Ga0207668_10195676 3300025972 Bacteria 1606
270 Ga0207668_11070084 3300025972 Bacteria 722
271 Ga0207668_11231088 3300025972 Bacteria 673
272 Ga0207640_11573293 3300025981 Bacteria 592
273 Ga0207677_10460895 3300026023 Bacteria 1091
274 Ga0207703_10000873 3300026035 Bacteria 29570
275 Ga0207703_10263333 3300026035 Bacteria 1559
276 Ga0207639_10123123 3300026041 Bacteria 2134
277 Ga0207678_10047177 3300026067 Bacteria 3726
278 Ga0207678_10294361 3300026067 Bacteria 1394
279 Ga0207708_10694064 3300026075 Bacteria 870
280 Ga0207702_10063715 3300026078 Bacteria 3153
281 Ga0207702_12317834 3300026078 Bacteria 525
282 Ga0207641_10091006 3300026088 Bacteria 2669
283 Ga0207641_10728829 3300026088 Bacteria 978
284 Ga0207648_10194886 3300026089 Bacteria 1796
285 Ga0207648_10287045 3300026089 Bacteria 1473
286 Ga0207676_10313318 3300026095 Bacteria 1437
287 Ga0207676_10641657 3300026095 Bacteria 1024
288 Ga0207674_10141808 3300026116 Bacteria 2362
289 Ga0207674_11424252 3300026116 Bacteria 662
290 Ga0207675_100147433 3300026118 Bacteria 2238
291 Ga0207675_100735165 3300026118 Bacteria 997
292 Ga0207675_100971851 3300026118 Bacteria 867
293 Ga0207675_101137381 3300026118 Bacteria 801
294 Ga0207683_10005980 3300026121 Bacteria 10420
295 Ga0207683_10371911 3300026121 Bacteria 1313
296 Ga0207683_11923362 3300026121 Bacteria 540
297 Ga0207683_11939863 3300026121 Bacteria 537
298 Ga0207698_10000365 3300026142 Bacteria 26602
299 Ga0207698_11186851 3300026142 Bacteria 777
300 Ga0207698_11384315 3300026142 Bacteria 718
301 Ga0207698_11582648 3300026142 Bacteria 671
302 Ga0209966_1006348 3300027695 Bacteria 2051
303 Ga0209998_10216412 3300027717 Bacteria 503
304 Ga0209974_10053266 3300027876 Bacteria 1363
305 Ga0207428_10134263 3300027907 Bacteria 1893
306 Ga0207428_10178974 3300027907 Bacteria 1603
307 Ga0268266_10000062 3300028379 Bacteria 253490
308 Ga0268266_10052321 3300028379 Bacteria 3507
309 Ga0268266_10734334 3300028379 Bacteria 952
310 Ga0268265_10015065 3300028380 Bacteria 5281
311 Ga0268265_10042911 3300028380 Bacteria 3358
312 Ga0268265_10627116 3300028380 Bacteria 1031
313 Ga0268265_10815589 3300028380 Bacteria 910
314 Ga0268265_11375438 3300028380 Bacteria 707
315 Ga0268264_12398660 3300028381 Bacteria 534
316 Ga0307517_10174245 3300028786 Bacteria 1406
317 Ga0307517_10316943 3300028786 Bacteria 865
318 Ga0265328_10175828 3300031239 Bacteria 809
319 Ga0307508_10006689 3300031616 Bacteria 10812
320 Ga0307514_10544768 3300031649 Bacteria 537
321 Ga0307405_10973583 3300031731 Bacteria 722
322 Ga0307410_10424847 3300031852 Bacteria 1079
323 Ga0307412_10291320 3300031911 Bacteria 1286
324 Ga0307409_100387957 3300031995 Bacteria 1330
325 Ga0307416_100226048 3300032002 Bacteria 1800
326 Ga0307416_100568056 3300032002 Bacteria 1210
327 Ga0307411_10215397 3300032005 Bacteria 1486
328 Ga0307510_10336055 3300033180 Bacteria 964
329 Ga0307510_10624503 3300033180 Bacteria 532
330 Ga0373930_0149589 3300034816 Bacteria 585
331 Ga0373959_0035848 3300034820 Bacteria 1022
332 Ga0373936_0001350 3300035113 Bacteria 8915
333 Ga0373943_0156799 3300035170 Bacteria 1237
334 Ga0373931_0635454 3300035691 Bacteria 700
335 Ga0373935_0200576 3300035692 Bacteria 1378
336 Ga0373925_0008164 3300037068 Bacteria 7621
337 Ga0439465_0031898 3300041413 Bacteria 1680
338 Ga0451791_0798306 3300041451 Bacteria 775
339 Ga0451798_0348374 3300041458 Bacteria 1047
340 Ga0451807_1625728 3300041486 Bacteria 1500
341 Ga0451849_0542985 3300041505 Bacteria 3337
342 Ga0451843_0976675 3300041509 Bacteria 765
343 Ga0439458_0025529 3300042157 Bacteria 1387
344 Ga0439459_0109214 3300042438 Bacteria 686
345 Ga0439464_0095345 3300042439 Bacteria 900
346 Ga0439464_0301123 3300042439 Bacteria 524
347 Ga0466972_0003498 3300044658 Bacteria 7798
348 Ga0466966_0047292 3300044684 Bacteria 2744
349 Ga0466961_0004729 3300044693 Bacteria 8566
350 Ga0466964_0018601 3300044706 Bacteria 2667
351 Ga0466971_0236666 3300044719 Bacteria 868
352 Ga0466970_0019410 3300044765 Bacteria 3524
353 Ga0466960_0046104 3300044901 Bacteria 2085
354 Ga0466959_0006392 3300045049 Bacteria 8158
355 Ga0495603_0157915 3300046455 Bacteria 1316
356 Ga0495629_1013042 3300046459 Bacteria 540
357 Ga0495638_0006082 3300046460 Bacteria 8833
358 Ga0495638_0007622 3300046460 Bacteria 7737
359 Ga0495662_0054569 3300046476 Bacteria 1931
360 Ga0495584_0036115 3300046491 Bacteria 2496
361 Ga0495607_0149086 3300046501 Bacteria 1199
362 Ga0495606_0259124 3300046507 Bacteria 961
363 Ga0495608_0263833 3300046511 Bacteria 1072
364 Ga0495637_0169771 3300046520 Bacteria 814
365 Ga0495643_0384155 3300046522 Bacteria 622
366 Ga0495642_0013080 3300046528 Bacteria 3206
367 Ga0495598_0141322 3300046537 Bacteria 833
368 Ga0495621_0146750 3300046539 Bacteria 926
369 Ga0495597_0176762 3300046542 Bacteria 864
370 Ga0495658_0292819 3300046683 Bacteria 1029
371 Ga0495670_0000028 3300046691 Bacteria 90085
372 Ga0495589_0491189 3300046794 Bacteria 561
373 Ga0495589_0538083 3300046794 Bacteria 533
374 Ga0495677_0000757 3300047445 Bacteria 13022
375 Ga0495684_0252909 3300047471 Bacteria 1281
376 Ga0495686_0013186 3300047472 Bacteria 5748
377 Ga0495614_0134031 3300048089 Bacteria 1098
378 Ga0496100_1412596 3300048903 Bacteria 549
379 Ga0496102_1209662 3300048905 Bacteria 675
380 Ga0496102_1372184 3300048905 Bacteria 626
381 Ga0496103_0122885 3300048906 Bacteria 1655
382 Ga0496104_0026508 3300048907 Bacteria 5353
383 Ga0496105_0148807 3300048908 Bacteria 1925
384 Ga0496107_0537337 3300048910 Bacteria 866
385 Ga0496108_0158326 3300048911 Bacteria 1956
386 Ga0496109_0018865 3300048912 Bacteria 6070
387 Ga0496110_0054090 3300048913 Bacteria 3531
388 Ga0496111_0089078 3300048914 Bacteria 2260
389 Ga0496112_0041065 3300048915 Bacteria 4525
390 Ga0496113_0394831 3300048916 Bacteria 1110
391 Ga0496113_0960445 3300048916 Bacteria 674
392 Ga0496115_0011017 3300048918 Bacteria 6773
393 Ga0496126_0056887 3300048929 Bacteria 3534
394 Ga0501067_0101536 3300049583 Bacteria 1599
395 nmdc:mga03683_42220_c1 3300050489 Bacteria 1876
396 nmdc:mga03683_7152_c2 3300050489 Bacteria 3555
397 nmdc:mga00v17_1067123_c1 3300050491 Bacteria 507
398 nmdc:mga00v17_252500_c1 3300050491 Bacteria 1143
399 nmdc:mga00v17_6036_c1 3300050491 Bacteria 6407
400 nmdc:mga0yw44_297078_c1 3300050492 Bacteria 1082
401 nmdc:mga0yw44_40164_c1 3300050492 Bacteria 2778
402 nmdc:mga0yw44_478501_c1 3300050492 Bacteria 844
403 nmdc:mga0yw44_807671_c1 3300050492 Bacteria 637
404 nmdc:mga0k408_273497_c1 3300050493 Bacteria 1008
405 nmdc:mga0k408_83960_c1 3300050493 Bacteria 1868
406 nmdc:mga06z11_152486_c1 3300050494 Bacteria 1315
407 nmdc:mga06z11_16465_c1 3300050494 Bacteria 3331
408 nmdc:mga06z11_170332_c1 3300050494 Bacteria 1250
409 nmdc:mga06z11_191568_c1 3300050494 Bacteria 1184
410 nmdc:mga06z11_34575_c1 3300050494 Bacteria 2482
411 nmdc:mga07m45_60543_c1 3300050496 Bacteria 2143
412 nmdc:mga07m45_630261_c1 3300050496 Bacteria 618
413 nmdc:mga07m45_76596_c1 3300050496 Bacteria 1907
414 nmdc:mga07m45_805217_c1 3300050496 Bacteria 538
415 nmdc:mga05p37_201259_c1 3300050507 Bacteria 2412
416 nmdc:mga05p37_837896_c1 3300050507 Bacteria 1001
417 nmdc:mga09592_231452_c1 3300050508 Bacteria 1601
418 nmdc:mga09592_39779_c1 3300050508 Bacteria 3950
419 nmdc:mga0qj67_350874_c1 3300050509 Bacteria 1193
420 nmdc:mga0qj67_678735_c1 3300050509 Bacteria 821
421 nmdc:mga06r32_1104_c1 3300050510 Bacteria 24200
422 nmdc:mga06r32_344560_c1 3300050510 Bacteria 1475
423 nmdc:mga06r32_398819_c1 3300050510 Bacteria 1358
424 nmdc:mga08y16_304534_c1 3300050511 Bacteria 1642
425 nmdc:mga08y16_67998_c1 3300050511 Bacteria 3716
426 nmdc:mga08y16_75642_c1 3300050511 Bacteria 3510
427 nmdc:mga0n895_99639_c1 3300050512 Bacteria 2914
428 nmdc:mga0a205_171411_c2 3300050515 Bacteria 1245
429 nmdc:mga0a205_678579_c1 3300050515 Bacteria 881
430 nmdc:mga0sz30_129_c1 3300050516 Bacteria 27866
431 Ga0500635_0232601 3300053080 Bacteria 721
432 Ga0500618_006698 3300053125 Bacteria 3355
433 Ga0500655_013248 3300053133 Bacteria 1504
434 Ga0500655_085655 3300053133 Bacteria 651
435 Ga0500559_0016984 3300053136 Bacteria 3074
436 Ga0500568_0020378 3300053139 Bacteria 2869
437 Ga0500604_0166333 3300053151 Bacteria 753
438 Ga0500616_0110533 3300053153 Bacteria 1328
439 Ga0500619_001138 3300053154 Bacteria 4620
440 Ga0500622_0233780 3300053156 Bacteria 816
441 Ga0500645_008567 3300053730 Bacteria 3485
442 Ga0500645_017468 3300053730 Bacteria 2248
443 Ga0466962_0049418 3300061719 Bacteria 2010

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050492 nmdc:mga0yw44_807671_c1 nmdc:mga0yw44_807671_c1_67_489 133
2 3300009094 Ga0111539_10132359 Ga0111539_101323593 134
3 3300041486 Ga0451807_1625728 Ga0451807_1625728_842_1255 134
4 3300046794 Ga0495589_0538083 Ga0495589_0538083_91_504 134
5 3300013296 Ga0157374_11450189 Ga0157374_114501892 135
6 3300048089 Ga0495614_0134031 Ga0495614_0134031_579_1010 135
7 3300026118 Ga0207675_101137381 Ga0207675_1011373812 136
8 3300053730 Ga0500645_017468 Ga0500645_017468_1513_1932 136
9 3300005842 Ga0068858_101492289 Ga0068858_1014922891 137
10 3300014326 Ga0157380_10594512 Ga0157380_105945121 137
11 3300031239 Ga0265328_10175828 Ga0265328_101758282 137
12 3300031616 Ga0307508_10006689 Ga0307508_100066895 137
13 3300042439 Ga0439464_0301123 Ga0439464_0301123_39_467 137
14 3300046455 Ga0495603_0157915 Ga0495603_0157915_523_942 137
15 3300046476 Ga0495662_0054569 Ga0495662_0054569_1046_1462 137
16 3300050494 nmdc:mga06z11_152486_c1 nmdc:mga06z11_152486_c1_277_690 137
17 iso_pu_bacteria 2643221545 2643748636 137
18 iso_pu_bacteria 2643221691 2644510309 137
19 iso_pu_bacteria 2818991461 2819683767 137
20 3300005289 Ga0065704_10126899 Ga0065704_101268991 138
21 3300005459 Ga0068867_100205535 Ga0068867_1002055352 138
22 3300009093 Ga0105240_10830642 Ga0105240_108306422 138
23 3300009093 Ga0105240_11050812 Ga0105240_110508121 138
24 3300009094 Ga0111539_10013494 Ga0111539_100134946 138
25 3300009094 Ga0111539_13089120 Ga0111539_130891201 138
26 3300009098 Ga0105245_10141539 Ga0105245_101415392 138
27 3300009147 Ga0114129_10380423 Ga0114129_103804232 138
28 3300009147 Ga0114129_11292034 Ga0114129_112920341 138
29 3300009148 Ga0105243_10843324 Ga0105243_108433241 138
30 3300009176 Ga0105242_10090488 Ga0105242_100904882 138
31 3300009177 Ga0105248_10674873 Ga0105248_106748732 138
32 3300009553 Ga0105249_10007875 Ga0105249_100078757 138
33 3300009553 Ga0105249_10177161 Ga0105249_101771613 138
34 3300013100 Ga0157373_10126261 Ga0157373_101262612 138
35 3300013297 Ga0157378_11494598 Ga0157378_114945981 138
36 3300013306 Ga0163162_11342470 Ga0163162_113424701 138
37 3300013306 Ga0163162_12469209 Ga0163162_124692091 138
38 3300014745 Ga0157377_10130954 Ga0157377_101309542 138
39 3300034816 Ga0373930_0149589 Ga0373930_0149589_24_440 138
40 3300035170 Ga0373943_0156799 Ga0373943_0156799_165_584 138
41 3300035691 Ga0373931_0635454 Ga0373931_0635454_90_506 138
42 3300035692 Ga0373935_0200576 Ga0373935_0200576_415_831 138
43 3300041413 Ga0439465_0031898 Ga0439465_0031898_157_573 138
44 3300041458 Ga0451798_0348374 Ga0451798_0348374_409_825 138
45 3300042157 Ga0439458_0025529 Ga0439458_0025529_649_1074 138
46 3300042438 Ga0439459_0109214 Ga0439459_0109214_133_558 138
47 3300042439 Ga0439464_0095345 Ga0439464_0095345_275_703 138
48 3300046459 Ga0495629_1013042 Ga0495629_1013042_114_530 138
49 3300046507 Ga0495606_0259124 Ga0495606_0259124_191_607 138
50 3300046511 Ga0495608_0263833 Ga0495608_0263833_192_608 138
51 3300046520 Ga0495637_0169771 Ga0495637_0169771_94_510 138
52 3300046537 Ga0495598_0141322 Ga0495598_0141322_192_608 138
53 3300046542 Ga0495597_0176762 Ga0495597_0176762_358_783 138
54 3300046683 Ga0495658_0292819 Ga0495658_0292819_331_747 138
55 3300046691 Ga0495670_0000028 Ga0495670_0000028_89206_89631 138
56 3300046794 Ga0495589_0491189 Ga0495589_0491189_19_435 138
57 3300048905 Ga0496102_1372184 Ga0496102_1372184_45_461 138
58 3300048910 Ga0496107_0537337 Ga0496107_0537337_310_726 138
59 3300048916 Ga0496113_0960445 Ga0496113_0960445_137_553 138
60 3300048929 Ga0496126_0056887 Ga0496126_0056887_2076_2501 138
61 3300049583 Ga0501067_0101536 Ga0501067_0101536_407_823 138
62 3300050491 nmdc:mga00v17_1067123_c1 nmdc:mga00v17_1067123_c1_69_485 138
63 3300050491 nmdc:mga00v17_252500_c1 nmdc:mga00v17_252500_c1_37_453 138
64 3300050492 nmdc:mga0yw44_478501_c1 nmdc:mga0yw44_478501_c1_152_568 138
65 3300050496 nmdc:mga07m45_60543_c1 nmdc:mga07m45_60543_c1_955_1371 138
66 3300050496 nmdc:mga07m45_630261_c1 nmdc:mga07m45_630261_c1_178_606 138
67 3300050507 nmdc:mga05p37_201259_c1 nmdc:mga05p37_201259_c1_1651_2076 138
68 3300050508 nmdc:mga09592_231452_c1 nmdc:mga09592_231452_c1_288_713 138
69 3300050509 nmdc:mga0qj67_350874_c1 nmdc:mga0qj67_350874_c1_665_1081 138
70 3300050510 nmdc:mga06r32_344560_c1 nmdc:mga06r32_344560_c1_771_1196 138
71 3300050510 nmdc:mga06r32_398819_c1 nmdc:mga06r32_398819_c1_236_652 138
72 3300050511 nmdc:mga08y16_304534_c1 nmdc:mga08y16_304534_c1_426_851 138
73 3300050511 nmdc:mga08y16_67998_c1 nmdc:mga08y16_67998_c1_96_521 138
74 3300050512 nmdc:mga0n895_99639_c1 nmdc:mga0n895_99639_c1_1023_1439 138
75 3300050515 nmdc:mga0a205_171411_c2 nmdc:mga0a205_171411_c2_628_1053 138
76 3300050515 nmdc:mga0a205_678579_c1 nmdc:mga0a205_678579_c1_390_806 138
77 3300053136 Ga0500559_0016984 Ga0500559_0016984_417_842 138
78 3300053139 Ga0500568_0020378 Ga0500568_0020378_382_798 138
79 3300053151 Ga0500604_0166333 Ga0500604_0166333_98_514 138
80 3300053730 Ga0500645_008567 Ga0500645_008567_2249_2674 138
81 3300005290 Ga0065712_10002464 Ga0065712_100024647 139
82 3300005340 Ga0070689_101746614 Ga0070689_1017466141 139
83 3300005344 Ga0070661_100183898 Ga0070661_1001838982 139
84 3300005347 Ga0070668_100154251 Ga0070668_1001542511 139
85 3300005354 Ga0070675_100105520 Ga0070675_1001055203 139
86 3300005355 Ga0070671_100309407 Ga0070671_1003094072 139
87 3300005367 Ga0070667_100430521 Ga0070667_1004305213 139
88 3300005456 Ga0070678_100346669 Ga0070678_1003466692 139
89 3300005466 Ga0070685_10028427 Ga0070685_100284274 139
90 3300005548 Ga0070665_100020573 Ga0070665_1000205737 139
91 3300005563 Ga0068855_100000144 Ga0068855_10000014442 139
92 3300005616 Ga0068852_101418482 Ga0068852_1014184821 139
93 3300005616 Ga0068852_102467574 Ga0068852_1024675741 139
94 3300005618 Ga0068864_100031721 Ga0068864_1000317215 139
95 3300005841 Ga0068863_100029480 Ga0068863_1000294806 139
96 3300005844 Ga0068862_100354754 Ga0068862_1003547542 139
97 3300006237 Ga0097621_100289194 Ga0097621_1002891942 139
98 3300009101 Ga0105247_10015421 Ga0105247_100154213 139
99 3300009174 Ga0105241_10331413 Ga0105241_103314133 139
100 3300009177 Ga0105248_10000001 Ga0105248_10000001244 139
101 3300010375 Ga0105239_10036242 Ga0105239_100362427 139
102 3300013105 Ga0157369_10010907 Ga0157369_100109075 139
103 3300013297 Ga0157378_10153217 Ga0157378_101532172 139
104 3300014325 Ga0163163_10156309 Ga0163163_101563092 139
105 3300025903 Ga0207680_10796913 Ga0207680_107969131 139
106 3300025913 Ga0207695_10000012 Ga0207695_1000001258 139
107 3300025920 Ga0207649_10106388 Ga0207649_101063882 139
108 3300025925 Ga0207650_10033844 Ga0207650_100338443 139
109 3300025926 Ga0207659_10063488 Ga0207659_100634882 139
110 3300025927 Ga0207687_11218794 Ga0207687_112187941 139
111 3300025931 Ga0207644_10505679 Ga0207644_105056791 139
112 3300025936 Ga0207670_10448476 Ga0207670_104484761 139
113 3300025941 Ga0207711_10000002 Ga0207711_10000002945 139
114 3300025941 Ga0207711_10929134 Ga0207711_109291341 139
115 3300025942 Ga0207689_11418557 Ga0207689_114185571 139
116 3300025949 Ga0207667_10000026 Ga0207667_10000026338 139
117 3300025961 Ga0207712_10192182 Ga0207712_101921821 139
118 3300025972 Ga0207668_11231088 Ga0207668_112310882 139
119 3300026078 Ga0207702_12317834 Ga0207702_123178341 139
120 3300026088 Ga0207641_10091006 Ga0207641_100910062 139
121 3300026095 Ga0207676_10313318 Ga0207676_103133182 139
122 3300026118 Ga0207675_100971851 Ga0207675_1009718511 139
123 3300026142 Ga0207698_11384315 Ga0207698_113843151 139
124 3300028379 Ga0268266_10052321 Ga0268266_100523213 139
125 3300028380 Ga0268265_10815589 Ga0268265_108155892 139
126 3300035113 Ga0373936_0001350 Ga0373936_0001350_7619_8053 139
127 3300048903 Ga0496100_1412596 Ga0496100_1412596_69_503 139
128 3300048905 Ga0496102_1209662 Ga0496102_1209662_226_660 139
129 3300048907 Ga0496104_0026508 Ga0496104_0026508_2879_3313 139
130 3300048908 Ga0496105_0148807 Ga0496105_0148807_457_891 139
131 3300048911 Ga0496108_0158326 Ga0496108_0158326_1242_1676 139
132 3300048912 Ga0496109_0018865 Ga0496109_0018865_1487_1921 139
133 3300048913 Ga0496110_0054090 Ga0496110_0054090_2276_2710 139
134 3300048914 Ga0496111_0089078 Ga0496111_0089078_442_876 139
135 3300048915 Ga0496112_0041065 Ga0496112_0041065_1487_1921 139
136 3300048916 Ga0496113_0394831 Ga0496113_0394831_54_488 139
137 3300053133 Ga0500655_013248 Ga0500655_013248_793_1224 139
138 3300053154 Ga0500619_001138 Ga0500619_001138_2244_2675 139
139 3300005328 Ga0070676_11540509 Ga0070676_115405091 140
140 3300005339 Ga0070660_100085560 Ga0070660_1000855604 140
141 3300005345 Ga0070692_11228545 Ga0070692_112285451 140
142 3300005471 Ga0070698_101562545 Ga0070698_1015625451 140
143 3300005548 Ga0070665_100000397 Ga0070665_10000039717 140
144 3300005549 Ga0070704_100485505 Ga0070704_1004855052 140
145 3300005577 Ga0068857_101171215 Ga0068857_1011712151 140
146 3300006178 Ga0075367_10012895 Ga0075367_100128953 140
147 3300006195 Ga0075366_10110967 Ga0075366_101109674 140
148 3300009093 Ga0105240_10547335 Ga0105240_105473352 140
149 3300010375 Ga0105239_10172999 Ga0105239_101729992 140
150 3300014326 Ga0157380_10313023 Ga0157380_103130231 140
151 3300025940 Ga0207691_10786993 Ga0207691_107869932 140
152 3300026089 Ga0207648_10287045 Ga0207648_102870451 140
153 3300028379 Ga0268266_10000062 Ga0268266_1000006290 140
154 3300048918 Ga0496115_0011017 Ga0496115_0011017_4200_4631 140
155 2088090001 CNB_F6ESG4R02JQ950 CNB_00057510 141
156 3300001989 JGI24739J22299_10042547 JGI24739J22299_100425472 141
157 3300001990 JGI24737J22298_10005942 JGI24737J22298_100059421 141
158 3300001991 JGI24743J22301_10150980 JGI24743J22301_101509801 141
159 3300002067 JGI24735J21928_10020780 JGI24735J21928_100207802 141
160 3300002075 JGI24738J21930_10016124 JGI24738J21930_100161243 141
161 3300002077 JGI24744J21845_10001231 JGI24744J21845_100012312 141
162 3300003794 Ga0055531_10009924 Ga0055531_100099242 141
163 3300005293 Ga0065715_10424166 Ga0065715_104241661 141
164 3300005293 Ga0065715_10525224 Ga0065715_105252241 141
165 3300005295 Ga0065707_10111443 Ga0065707_101114432 141
166 3300005327 Ga0070658_10803862 Ga0070658_108038622 141
167 3300005328 Ga0070676_10240031 Ga0070676_102400312 141
168 3300005328 Ga0070676_10732128 Ga0070676_107321281 141
169 3300005330 Ga0070690_100465903 Ga0070690_1004659032 141
170 3300005333 Ga0070677_10169096 Ga0070677_101690962 141
171 3300005334 Ga0068869_100473458 Ga0068869_1004734581 141
172 3300005335 Ga0070666_10487726 Ga0070666_104877261 141
173 3300005335 Ga0070666_10617726 Ga0070666_106177261 141
174 3300005339 Ga0070660_100125384 Ga0070660_1001253842 141
175 3300005340 Ga0070689_100228846 Ga0070689_1002288461 141
176 3300005341 Ga0070691_10051722 Ga0070691_100517223 141
177 3300005343 Ga0070687_100054518 Ga0070687_1000545183 141
178 3300005347 Ga0070668_100391743 Ga0070668_1003917431 141
179 3300005347 Ga0070668_100788289 Ga0070668_1007882891 141
180 3300005353 Ga0070669_100009424 Ga0070669_1000094242 141
181 3300005353 Ga0070669_100705022 Ga0070669_1007050221 141
182 3300005354 Ga0070675_100001422 Ga0070675_10000142214 141
183 3300005354 Ga0070675_100286949 Ga0070675_1002869492 141
184 3300005355 Ga0070671_100025461 Ga0070671_1000254612 141
185 3300005355 Ga0070671_100211844 Ga0070671_1002118441 141
186 3300005356 Ga0070674_100370331 Ga0070674_1003703312 141
187 3300005364 Ga0070673_100004870 Ga0070673_1000048708 141
188 3300005364 Ga0070673_100634376 Ga0070673_1006343761 141
189 3300005365 Ga0070688_100241229 Ga0070688_1002412292 141
190 3300005366 Ga0070659_100047492 Ga0070659_1000474923 141
191 3300005366 Ga0070659_100377836 Ga0070659_1003778361 141
192 3300005366 Ga0070659_100530678 Ga0070659_1005306782 141
193 3300005438 Ga0070701_10421329 Ga0070701_104213292 141
194 3300005440 Ga0070705_100587324 Ga0070705_1005873241 141
195 3300005441 Ga0070700_100418700 Ga0070700_1004187002 141
196 3300005441 Ga0070700_100555329 Ga0070700_1005553291 141
197 3300005444 Ga0070694_100869270 Ga0070694_1008692701 141
198 3300005444 Ga0070694_101184903 Ga0070694_1011849031 141
199 3300005456 Ga0070678_100021895 Ga0070678_1000218953 141
200 3300005456 Ga0070678_101626728 Ga0070678_1016267281 141
201 3300005457 Ga0070662_100168657 Ga0070662_1001686571 141
202 3300005457 Ga0070662_101103083 Ga0070662_1011030831 141
203 3300005458 Ga0070681_11158163 Ga0070681_111581631 141
204 3300005539 Ga0068853_100192822 Ga0068853_1001928222 141
205 3300005543 Ga0070672_100034204 Ga0070672_1000342044 141
206 3300005543 Ga0070672_100117121 Ga0070672_1001171212 141
207 3300005543 Ga0070672_100131608 Ga0070672_1001316082 141
208 3300005543 Ga0070672_102128361 Ga0070672_1021283611 141
209 3300005544 Ga0070686_100107552 Ga0070686_1001075522 141
210 3300005545 Ga0070695_100567520 Ga0070695_1005675202 141
211 3300005546 Ga0070696_100181946 Ga0070696_1001819462 141
212 3300005546 Ga0070696_100614554 Ga0070696_1006145541 141
213 3300005547 Ga0070693_100415026 Ga0070693_1004150262 141
214 3300005549 Ga0070704_100073774 Ga0070704_1000737743 141
215 3300005563 Ga0068855_101203036 Ga0068855_1012030362 141
216 3300005564 Ga0070664_100115309 Ga0070664_1001153092 141
217 3300005564 Ga0070664_100395348 Ga0070664_1003953481 141
218 3300005577 Ga0068857_100408144 Ga0068857_1004081442 141
219 3300005578 Ga0068854_100099130 Ga0068854_1000991303 141
220 3300005615 Ga0070702_100036036 Ga0070702_1000360363 141
221 3300005616 Ga0068852_101150173 Ga0068852_1011501731 141
222 3300005616 Ga0068852_101848826 Ga0068852_1018488261 141
223 3300005617 Ga0068859_101696706 Ga0068859_1016967061 141
224 3300005618 Ga0068864_100484445 Ga0068864_1004844451 141
225 3300005618 Ga0068864_101023828 Ga0068864_1010238282 141
226 3300005718 Ga0068866_10162479 Ga0068866_101624792 141
227 3300005719 Ga0068861_100043170 Ga0068861_1000431702 141
228 3300005719 Ga0068861_100047351 Ga0068861_1000473512 141
229 3300005719 Ga0068861_100445968 Ga0068861_1004459682 141
230 3300005719 Ga0068861_100546066 Ga0068861_1005460662 141
231 3300005834 Ga0068851_10228332 Ga0068851_102283321 141
232 3300005841 Ga0068863_101160814 Ga0068863_1011608141 141
233 3300005842 Ga0068858_100000355 Ga0068858_10000035538 141
234 3300005842 Ga0068858_100220141 Ga0068858_1002201413 141
235 3300005843 Ga0068860_100227389 Ga0068860_1002273892 141
236 3300005844 Ga0068862_100018454 Ga0068862_1000184544 141
237 3300005844 Ga0068862_100019817 Ga0068862_1000198176 141
238 3300005844 Ga0068862_100066451 Ga0068862_1000664512 141
239 3300005844 Ga0068862_100823887 Ga0068862_1008238872 141
240 3300005844 Ga0068862_101205290 Ga0068862_1012052901 141
241 3300006038 Ga0075365_10004655 Ga0075365_100046553 141
242 3300006038 Ga0075365_10048736 Ga0075365_100487364 141
243 3300006038 Ga0075365_10050150 Ga0075365_100501504 141
244 3300006042 Ga0075368_10207242 Ga0075368_102072421 141
245 3300006042 Ga0075368_10230868 Ga0075368_102308681 141
246 3300006042 Ga0075368_10399306 Ga0075368_103993061 141
247 3300006048 Ga0075363_100022596 Ga0075363_1000225964 141
248 3300006048 Ga0075363_100039864 Ga0075363_1000398645 141
249 3300006051 Ga0075364_10126339 Ga0075364_101263391 141
250 3300006051 Ga0075364_10171125 Ga0075364_101711252 141
251 3300006058 Ga0075432_10481430 Ga0075432_104814301 141
252 3300006177 Ga0075362_10000312 Ga0075362_1000031211 141
253 3300006177 Ga0075362_10045680 Ga0075362_100456802 141
254 3300006177 Ga0075362_10087871 Ga0075362_100878712 141
255 3300006178 Ga0075367_10028911 Ga0075367_100289112 141
256 3300006178 Ga0075367_10058146 Ga0075367_100581464 141
257 3300006178 Ga0075367_10062237 Ga0075367_100622372 141
258 3300006178 Ga0075367_10074095 Ga0075367_100740952 141
259 3300006178 Ga0075367_10105283 Ga0075367_101052832 141
260 3300006178 Ga0075367_10194119 Ga0075367_101941192 141
261 3300006178 Ga0075367_10332597 Ga0075367_103325971 141
262 3300006178 Ga0075367_11081472 Ga0075367_110814721 141
263 3300006186 Ga0075369_10000236 Ga0075369_1000023618 141
264 3300006186 Ga0075369_10001134 Ga0075369_1000113411 141
265 3300006195 Ga0075366_10031086 Ga0075366_100310864 141
266 3300006353 Ga0075370_10019581 Ga0075370_100195812 141
267 3300006353 Ga0075370_10067139 Ga0075370_100671392 141
268 3300006353 Ga0075370_10417615 Ga0075370_104176151 141
269 3300006358 Ga0068871_101193039 Ga0068871_1011930391 141
270 3300006844 Ga0075428_100013655 Ga0075428_1000136555 141
271 3300006844 Ga0075428_100121470 Ga0075428_1001214702 141
272 3300006844 Ga0075428_100561951 Ga0075428_1005619512 141
273 3300006844 Ga0075428_100943103 Ga0075428_1009431032 141
274 3300006846 Ga0075430_101069501 Ga0075430_1010695011 141
275 3300006846 Ga0075430_101235773 Ga0075430_1012357731 141
276 3300006847 Ga0075431_100331592 Ga0075431_1003315922 141
277 3300006847 Ga0075431_100489747 Ga0075431_1004897471 141
278 3300006852 Ga0075433_10247370 Ga0075433_102473703 141
279 3300006852 Ga0075433_10285195 Ga0075433_102851952 141
280 3300006871 Ga0075434_100195692 Ga0075434_1001956923 141
281 3300006880 Ga0075429_100057689 Ga0075429_1000576892 141
282 3300006880 Ga0075429_100213402 Ga0075429_1002134022 141
283 3300006880 Ga0075429_100880865 Ga0075429_1008808651 141
284 3300006931 Ga0097620_101696696 Ga0097620_1016966961 141
285 3300007076 Ga0075435_100526736 Ga0075435_1005267362 141
286 3300009094 Ga0111539_10140212 Ga0111539_101402123 141
287 3300009094 Ga0111539_10261278 Ga0111539_102612782 141
288 3300009147 Ga0114129_10042292 Ga0114129_100422928 141
289 3300009148 Ga0105243_11331955 Ga0105243_113319551 141
290 3300009551 Ga0105238_10781140 Ga0105238_107811401 141
291 3300009553 Ga0105249_10048470 Ga0105249_100484702 141
292 3300010375 Ga0105239_10992007 Ga0105239_109920071 141
293 3300012513 Ga0157326_1092420 Ga0157326_10924201 141
294 3300013100 Ga0157373_11286411 Ga0157373_112864111 141
295 3300014326 Ga0157380_10133128 Ga0157380_101331281 141
296 3300014326 Ga0157380_12806435 Ga0157380_128064351 141
297 3300017792 Ga0163161_10041423 Ga0163161_100414233 141
298 3300017792 Ga0163161_10142844 Ga0163161_101428444 141
299 3300025233 Ga0209437_102111 Ga0209437_1021112 141
300 3300025261 Ga0209233_1000065 Ga0209233_1000065305 141
301 3300025304 Ga0209257_1002058 Ga0209257_100205810 141
302 3300025321 Ga0207656_10134755 Ga0207656_101347552 141
303 3300025899 Ga0207642_10383772 Ga0207642_103837722 141
304 3300025899 Ga0207642_10397061 Ga0207642_103970611 141
305 3300025901 Ga0207688_10034265 Ga0207688_100342651 141
306 3300025901 Ga0207688_10034928 Ga0207688_100349282 141
307 3300025901 Ga0207688_10362492 Ga0207688_103624922 141
308 3300025903 Ga0207680_10255779 Ga0207680_102557792 141
309 3300025904 Ga0207647_10229340 Ga0207647_102293401 141
310 3300025907 Ga0207645_10018571 Ga0207645_100185714 141
311 3300025909 Ga0207705_10294459 Ga0207705_102944592 141
312 3300025911 Ga0207654_10196241 Ga0207654_101962412 141
313 3300025912 Ga0207707_10257247 Ga0207707_102572471 141
314 3300025913 Ga0207695_10369802 Ga0207695_103698022 141
315 3300025917 Ga0207660_11510042 Ga0207660_115100421 141
316 3300025918 Ga0207662_10017085 Ga0207662_100170853 141
317 3300025919 Ga0207657_10012407 Ga0207657_100124079 141
318 3300025919 Ga0207657_10043143 Ga0207657_100431434 141
319 3300025923 Ga0207681_10032439 Ga0207681_100324392 141
320 3300025923 Ga0207681_10331270 Ga0207681_103312702 141
321 3300025923 Ga0207681_10948339 Ga0207681_109483392 141
322 3300025924 Ga0207694_10278397 Ga0207694_102783971 141
323 3300025924 Ga0207694_10765132 Ga0207694_107651321 141
324 3300025926 Ga0207659_10003104 Ga0207659_100031044 141
325 3300025927 Ga0207687_10761809 Ga0207687_107618092 141
326 3300025931 Ga0207644_10163279 Ga0207644_101632792 141
327 3300025931 Ga0207644_10503823 Ga0207644_105038232 141
328 3300025932 Ga0207690_10034214 Ga0207690_100342142 141
329 3300025932 Ga0207690_11270120 Ga0207690_112701201 141
330 3300025933 Ga0207706_10195650 Ga0207706_101956502 141
331 3300025933 Ga0207706_10212375 Ga0207706_102123753 141
332 3300025934 Ga0207686_10101128 Ga0207686_101011282 141
333 3300025934 Ga0207686_10851420 Ga0207686_108514202 141
334 3300025936 Ga0207670_10455467 Ga0207670_104554672 141
335 3300025936 Ga0207670_11931866 Ga0207670_119318661 141
336 3300025937 Ga0207669_10243508 Ga0207669_102435082 141
337 3300025940 Ga0207691_10065496 Ga0207691_100654963 141
338 3300025940 Ga0207691_10080147 Ga0207691_100801474 141
339 3300025940 Ga0207691_10164498 Ga0207691_101644982 141
340 3300025940 Ga0207691_10188020 Ga0207691_101880202 141
341 3300025941 Ga0207711_10133522 Ga0207711_101335222 141
342 3300025942 Ga0207689_10442194 Ga0207689_104421942 141
343 3300025942 Ga0207689_10510899 Ga0207689_105108992 141
344 3300025945 Ga0207679_10086865 Ga0207679_100868652 141
345 3300025949 Ga0207667_11978808 Ga0207667_119788081 141
346 3300025960 Ga0207651_10020268 Ga0207651_100202684 141
347 3300025961 Ga0207712_10927028 Ga0207712_109270282 141
348 3300025961 Ga0207712_12055447 Ga0207712_120554471 141
349 3300025972 Ga0207668_10133041 Ga0207668_101330412 141
350 3300025972 Ga0207668_10195676 Ga0207668_101956762 141
351 3300025972 Ga0207668_11070084 Ga0207668_110700841 141
352 3300025981 Ga0207640_11573293 Ga0207640_115732931 141
353 3300026023 Ga0207677_10460895 Ga0207677_104608952 141
354 3300026035 Ga0207703_10000873 Ga0207703_1000087323 141
355 3300026035 Ga0207703_10263333 Ga0207703_102633332 141
356 3300026041 Ga0207639_10123123 Ga0207639_101231232 141
357 3300026067 Ga0207678_10047177 Ga0207678_100471771 141
358 3300026067 Ga0207678_10294361 Ga0207678_102943612 141
359 3300026075 Ga0207708_10694064 Ga0207708_106940642 141
360 3300026078 Ga0207702_10063715 Ga0207702_100637153 141
361 3300026088 Ga0207641_10728829 Ga0207641_107288292 141
362 3300026089 Ga0207648_10194886 Ga0207648_101948862 141
363 3300026095 Ga0207676_10641657 Ga0207676_106416572 141
364 3300026116 Ga0207674_10141808 Ga0207674_101418082 141
365 3300026116 Ga0207674_11424252 Ga0207674_114242521 141
366 3300026118 Ga0207675_100147433 Ga0207675_1001474333 141
367 3300026118 Ga0207675_100735165 Ga0207675_1007351651 141
368 3300026121 Ga0207683_10005980 Ga0207683_100059806 141
369 3300026121 Ga0207683_10371911 Ga0207683_103719111 141
370 3300026121 Ga0207683_11923362 Ga0207683_119233621 141
371 3300026121 Ga0207683_11939863 Ga0207683_119398631 141
372 3300026142 Ga0207698_10000365 Ga0207698_1000036511 141
373 3300026142 Ga0207698_11186851 Ga0207698_111868512 141
374 3300026142 Ga0207698_11582648 Ga0207698_115826481 141
375 3300027695 Ga0209966_1006348 Ga0209966_10063481 141
376 3300027717 Ga0209998_10216412 Ga0209998_102164121 141
377 3300027876 Ga0209974_10053266 Ga0209974_100532662 141
378 3300027907 Ga0207428_10134263 Ga0207428_101342632 141
379 3300027907 Ga0207428_10178974 Ga0207428_101789742 141
380 3300028379 Ga0268266_10734334 Ga0268266_107343342 141
381 3300028380 Ga0268265_10015065 Ga0268265_100150655 141
382 3300028380 Ga0268265_10042911 Ga0268265_100429113 141
383 3300028380 Ga0268265_10627116 Ga0268265_106271161 141
384 3300028380 Ga0268265_11375438 Ga0268265_113754381 141
385 3300028381 Ga0268264_12398660 Ga0268264_123986601 141
386 3300028786 Ga0307517_10174245 Ga0307517_101742452 141
387 3300028786 Ga0307517_10316943 Ga0307517_103169431 141
388 3300031649 Ga0307514_10544768 Ga0307514_105447681 141
389 3300031731 Ga0307405_10973583 Ga0307405_109735832 141
390 3300031852 Ga0307410_10424847 Ga0307410_104248471 141
391 3300031911 Ga0307412_10291320 Ga0307412_102913202 141
392 3300031995 Ga0307409_100387957 Ga0307409_1003879572 141
393 3300032002 Ga0307416_100226048 Ga0307416_1002260483 141
394 3300032002 Ga0307416_100568056 Ga0307416_1005680563 141
395 3300032005 Ga0307411_10215397 Ga0307411_102153971 141
396 3300033180 Ga0307510_10336055 Ga0307510_103360551 141
397 3300033180 Ga0307510_10624503 Ga0307510_106245031 141
398 3300034820 Ga0373959_0035848 Ga0373959_0035848_241_666 141
399 3300037068 Ga0373925_0008164 Ga0373925_0008164_2489_2914 141
400 3300041451 Ga0451791_0798306 Ga0451791_0798306_245_679 141
401 3300041505 Ga0451849_0542985 Ga0451849_0542985_653_1087 141
402 3300041509 Ga0451843_0976675 Ga0451843_0976675_161_595 141
403 3300044658 Ga0466972_0003498 Ga0466972_0003498_2586_3020 141
404 3300044684 Ga0466966_0047292 Ga0466966_0047292_2194_2628 141
405 3300044693 Ga0466961_0004729 Ga0466961_0004729_4819_5253 141
406 3300044706 Ga0466964_0018601 Ga0466964_0018601_848_1282 141
407 3300044719 Ga0466971_0236666 Ga0466971_0236666_411_851 141
408 3300044765 Ga0466970_0019410 Ga0466970_0019410_133_567 141
409 3300044901 Ga0466960_0046104 Ga0466960_0046104_683_1117 141
410 3300045049 Ga0466959_0006392 Ga0466959_0006392_4837_5271 141
411 3300046460 Ga0495638_0006082 Ga0495638_0006082_2981_3415 141
412 3300046460 Ga0495638_0007622 Ga0495638_0007622_465_890 141
413 3300046491 Ga0495584_0036115 Ga0495584_0036115_324_758 141
414 3300046501 Ga0495607_0149086 Ga0495607_0149086_377_802 141
415 3300046522 Ga0495643_0384155 Ga0495643_0384155_93_518 141
416 3300046528 Ga0495642_0013080 Ga0495642_0013080_276_710 141
417 3300046539 Ga0495621_0146750 Ga0495621_0146750_257_682 141
418 3300047445 Ga0495677_0000757 Ga0495677_0000757_12157_12591 141
419 3300047471 Ga0495684_0252909 Ga0495684_0252909_677_1102 141
420 3300047472 Ga0495686_0013186 Ga0495686_0013186_900_1334 141
421 3300048906 Ga0496103_0122885 Ga0496103_0122885_103_528 141
422 3300050489 nmdc:mga03683_42220_c1 nmdc:mga03683_42220_c1_1145_1579 141
423 3300050489 nmdc:mga03683_7152_c2 nmdc:mga03683_7152_c2_674_1099 141
424 3300050491 nmdc:mga00v17_6036_c1 nmdc:mga00v17_6036_c1_5236_5670 141
425 3300050492 nmdc:mga0yw44_297078_c1 nmdc:mga0yw44_297078_c1_296_721 141
426 3300050492 nmdc:mga0yw44_40164_c1 nmdc:mga0yw44_40164_c1_449_874 141
427 3300050493 nmdc:mga0k408_273497_c1 nmdc:mga0k408_273497_c1_113_547 141
428 3300050493 nmdc:mga0k408_83960_c1 nmdc:mga0k408_83960_c1_1204_1638 141
429 3300050494 nmdc:mga06z11_16465_c1 nmdc:mga06z11_16465_c1_2372_2806 141
430 3300050494 nmdc:mga06z11_170332_c1 nmdc:mga06z11_170332_c1_773_1198 141
431 3300050494 nmdc:mga06z11_191568_c1 nmdc:mga06z11_191568_c1_620_1045 141
432 3300050494 nmdc:mga06z11_34575_c1 nmdc:mga06z11_34575_c1_1040_1465 141
433 3300050496 nmdc:mga07m45_76596_c1 nmdc:mga07m45_76596_c1_865_1290 141
434 3300050496 nmdc:mga07m45_805217_c1 nmdc:mga07m45_805217_c1_99_524 141
435 3300050507 nmdc:mga05p37_837896_c1 nmdc:mga05p37_837896_c1_489_923 141
436 3300050508 nmdc:mga09592_39779_c1 nmdc:mga09592_39779_c1_1481_1915 141
437 3300050509 nmdc:mga0qj67_678735_c1 nmdc:mga0qj67_678735_c1_371_805 141
438 3300050510 nmdc:mga06r32_1104_c1 nmdc:mga06r32_1104_c1_11155_11589 141
439 3300050511 nmdc:mga08y16_75642_c1 nmdc:mga08y16_75642_c1_996_1430 141
440 3300050516 nmdc:mga0sz30_129_c1 nmdc:mga0sz30_129_c1_23361_23786 141
441 3300053080 Ga0500635_0232601 Ga0500635_0232601_71_496 141
442 3300053125 Ga0500618_006698 Ga0500618_006698_2508_2933 141
443 3300053133 Ga0500655_085655 Ga0500655_085655_181_606 141
444 3300053153 Ga0500616_0110533 Ga0500616_0110533_606_1040 141
445 3300053156 Ga0500622_0233780 Ga0500622_0233780_72_506 141
446 3300061719 Ga0466962_0049418 Ga0466962_0049418_155_589 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

116

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4liv-assembly1.cif.gz_A-2 structure of ycfd, a ribosomal oxygenase from escherichia coli in complex with cobalt and succinic acid. 0.3966 13 81
4zoh-assembly1.cif.gz_B-2 crystal structure of glyceraldehyde oxidoreductase 0.3819 50 110
4jjo-assembly1.cif.gz_A crystal structure of apo-clavibacter michiganensis expansin 0.3792 48 115
3qnw-assembly2.cif.gz_F caspase-6 in complex with z-vad-fmk inhibitor 0.3786 5 41
4fer-assembly1.cif.gz_A crystal structure of bacillus subtilis expansin (exlx1) in complex with cellohexaose 0.3785 42 115
ID Description Score Start End Superfamily
af_C0PDG6_22_115_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.5155 51 81 2.60.200.20
af_Q7YWS4_25_106_3.30.740.10 Alpha Beta;2-Layer Sandwich;Protein Inhibitor Of Neuronal Nitric Oxide Synthase;Protein Inhibitor Of Neuronal Nitric Oxide Synthase; 0.4964 52 110 3.30.740.10
af_M1ZMM0_290_417_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.4527 48 113 3.30.465.10
af_F1RBF2_107_190_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.4479 46 81 2.60.40.10
af_Q0DKN3_245_359_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.4464 51 81 3.40.20.10
ID Description Score Start End GO Terms
AF-A0A2W0AZC0-F1-model_v4 Dehydrogenase 0.7813 46 124
AF-A0A7K2QFP3-F1-model_v4 Transcriptional regulator 0.7293 44 111
AF-A0A7K2QFP3-F1-model_v4 Transcriptional regulator 0.6578 44 111
AF-A0A2W0AZC0-F1-model_v4 Dehydrogenase 0.6377 46 124
AF-A0A848FE34-F1-model_v4 YCII-related domain-containing protein 0.6238 9 130

Feature Viewer

pLDDT pTM Quality
77.03 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map