F445737

General Info

Members Datasets Scaffolds Average Seq Length
446 327 377 325

Family's Representative Sequence

Representative Sequence 3300020070|Ga0206356_11005689|Ga0206356_110056892
Length 370
Sequence MHCRKWGFGWQDLVEIVHPATANAMSAMLQNKGLSALEMKDVSMTKHADPILEPITQRFIDTLAAQGGKPLYTLSYADARKVLEEAQAIDVRKLPADVEEKVFPVGPTGEVSVRIYRPMDTKGFLPVVMYFHGGGWVLGSKDTHDRLLRDLVSGANAAFVFVNYTLAPEVQFPVPIEQVYAATKYVSEHGKDLGVDASRLAVAGDSAGGYMTAVVAQLAKERKGPSIRYQVMLYPVTDSSMSQPTYKEFANGPWLTAAAMEWFWDAYAPNKRDRTKTTASPLSATLDQLEGLPPALVIVDENDILRDEGEQYAKKLIQAGVEVTPMRILATHHDYALLNALADTPATKTTVQIVSEKLAEVLGSKRLILN

Samples

Sample ID Description Type Environment
1 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
2 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
3 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
4 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
5 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
6 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
7 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
8 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
9 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
10 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
11 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
12 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
13 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
14 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
15 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
16 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
17 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
18 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
19 2718217927 Rhizobium sp. N324 Isolate Nodule
20 2718218423 Rhizobium sp. N941 Isolate Nodule
21 2721755809 Rhizobium sp. N541 Isolate Nodule
22 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
23 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
24 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
25 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
26 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
27 2802429633 Rhizobium anhuiense J3 Isolate Nodule
28 2802429634 Rhizobium anhuiense S10 Isolate Nodule
29 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
30 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
31 2802429637 Rhizobium anhuiense C15 Isolate Nodule
32 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
33 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
34 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
35 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
36 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
37 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
38 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
39 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
40 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
41 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
42 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
43 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
44 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
45 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
46 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
47 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
48 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
49 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
50 2851153111 Caulobacter radicis 736 Isolate Unclassified
51 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
52 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
53 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
54 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
55 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
56 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
57 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
58 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
59 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
60 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
61 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
62 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
63 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
64 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
65 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
66 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
67 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
68 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
69 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
70 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
71 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
72 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
73 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
76 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
79 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
80 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
81 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
82 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
83 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
86 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
87 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
88 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
89 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
90 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
91 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
92 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
93 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
94 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
95 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
96 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
97 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
98 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
99 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
100 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
101 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
102 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
103 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
104 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
105 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
106 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
107 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
108 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
109 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
114 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
115 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
116 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
117 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
118 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
119 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
120 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
121 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
122 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
123 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
124 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
125 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
127 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
128 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
129 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
130 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
131 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
132 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
133 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
134 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
135 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
136 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
138 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
159 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
160 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
161 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
163 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
164 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
165 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
223 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
224 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
225 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
226 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
227 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
228 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
231 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
240 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
243 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
247 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
248 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
249 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
253 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
254 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
275 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
289 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
290 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
295 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
309 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
310 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
311 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
317 8005275841 Rhizobium sp. N4311 Isolate Nodule
318 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
319 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
320 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
321 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
322 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
323 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
324 8018176218 Rhizobium sp. N122 Isolate Nodule
325 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
326 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
327 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.08
Metatranscriptomes 0.45
Isolates 15.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.66
Nodule 11.88
Rhizoplane 1.79
Rhizosphere 70.4
Stem 0
Stem Tuber 0
Unclassified 4.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000484 3300002987 Bacteria 18305
2 JGI25151J46595_10000976 3300003187 Bacteria 21680
3 JGI25153J46596_10003937 3300003215 Bacteria 8137
4 JGI25153J46596_10013063 3300003215 Bacteria 3534
5 JGI25153J46596_10013726 3300003215 Bacteria 3408
6 JGI25160J50197_1001970 3300003354 Bacteria 9790
7 JGI25161J50226_1000370 3300003374 Bacteria 22840
8 Ga0055526_1001724 3300003771 Bacteria 15213
9 Ga0055526_1013154 3300003771 Bacteria 3531
10 Ga0055524_1005295 3300003775 Bacteria 5791
11 Ga0055528_1004574 3300003790 Bacteria 6636
12 Ga0055540_1002130 3300003792 Bacteria 10801
13 Ga0055543_1000060 3300004625 Bacteria 98330
14 Ga0055543_1003633 3300004625 Bacteria 4458
15 Ga0065165_1010372 3300005262 Bacteria 4039
16 Ga0065165_1014366 3300005262 Bacteria 3079
17 Ga0070683_100000143 3300005329 Bacteria 45950
18 Ga0070690_100041022 3300005330 Bacteria 2929
19 Ga0070690_100075066 3300005330 Bacteria 2204
20 Ga0070670_100000972 3300005331 Bacteria 22469
21 Ga0068869_100026825 3300005334 Bacteria 4012
22 Ga0070682_100058845 3300005337 Bacteria 2424
23 Ga0068868_100046836 3300005338 Plasmid 3385
24 Ga0070689_100005894 3300005340 Bacteria 8426
25 Ga0070689_100045189 3300005340 Bacteria 3391
26 Ga0070661_100000234 3300005344 Bacteria 45713
27 Ga0070661_100079275 3300005344 Bacteria 2423
28 Ga0070668_100006458 3300005347 Bacteria 8692
29 Ga0070668_100345674 3300005347 Bacteria 1258
30 Ga0070669_100183124 3300005353 Bacteria 1640
31 Ga0070675_100028888 3300005354 Bacteria 4467
32 Ga0070675_100123450 3300005354 Bacteria 2202
33 Ga0070671_100183343 3300005355 Bacteria 1773
34 Ga0070671_100271965 3300005355 Bacteria 1440
35 Ga0070674_100168861 3300005356 Bacteria 1666
36 Ga0070673_100001149 3300005364 Bacteria 15194
37 Ga0070688_100021948 3300005365 Bacteria 3734
38 Ga0070659_100067863 3300005366 Bacteria 2829
39 Ga0070667_100009506 3300005367 Bacteria 8062
40 Ga0070667_100095016 3300005367 Bacteria 2569
41 Ga0070703_10025589 3300005406 Bacteria 1751
42 Ga0070714_100007135 3300005435 Bacteria 8667
43 Ga0070713_100325333 3300005436 Bacteria 1421
44 Ga0070711_100286983 3300005439 Bacteria 1304
45 Ga0070694_100166808 3300005444 Bacteria 1619
46 Ga0070708_100065450 3300005445 Bacteria 3259
47 Ga0070708_100247444 3300005445 Bacteria 1674
48 Ga0070663_100000408 3300005455 Bacteria 22563
49 Ga0070678_100001016 3300005456 Bacteria 14606
50 Ga0070678_100166288 3300005456 Bacteria 1792
51 Ga0070662_100078036 3300005457 Bacteria 2459
52 Ga0068867_100010333 3300005459 Bacteria 6586
53 Ga0068867_100360439 3300005459 Bacteria 1216
54 Ga0070685_10081649 3300005466 Bacteria 1939
55 Ga0070699_100049811 3300005518 Bacteria 3625
56 Ga0070699_100055761 3300005518 Unclassified 3421
57 Ga0070684_100000160 3300005535 Bacteria 45822
58 Ga0070684_100217936 3300005535 Bacteria 1741
59 Ga0070672_100001716 3300005543 Bacteria 13684
60 Ga0070696_100363691 3300005546 Bacteria 1123
61 Ga0070665_100002722 3300005548 Bacteria 19153
62 Ga0070665_100065938 3300005548 Bacteria 3632
63 Ga0070665_100098645 3300005548 Plasmid 2926
64 Ga0068855_100570906 3300005563 Bacteria 1223
65 Ga0070664_100000167 3300005564 Bacteria 45686
66 Ga0068857_100000125 3300005577 Bacteria 46141
67 Ga0068856_100330340 3300005614 Bacteria 1542
68 Ga0068859_100001693 3300005617 Bacteria 22469
69 Ga0068859_100267498 3300005617 Bacteria 1801
70 Ga0068864_100000279 3300005618 Bacteria 45714
71 Ga0068866_10007755 3300005718 Bacteria 4503
72 Ga0068861_100036785 3300005719 Bacteria 3636
73 Ga0068861_100255265 3300005719 Bacteria 1498
74 Ga0068863_100001947 3300005841 Bacteria 20517
75 Ga0068863_100031424 3300005841 Bacteria 5066
76 Ga0068863_100190502 3300005841 Bacteria 1971
77 Ga0068863_100208230 3300005841 Bacteria 1883
78 Ga0068858_100012127 3300005842 Bacteria 8125
79 Ga0068860_100100575 3300005843 Bacteria 2758
80 Ga0068862_100003738 3300005844 Bacteria 12983
81 Ga0081538_10026954 3300005981 Bacteria 4000
82 Ga0081538_10082500 3300005981 Bacteria 1704
83 Ga0081540_1000377 3300005983 Bacteria 44639
84 Ga0081540_1000411 3300005983 Bacteria 42270
85 Ga0070717_10180309 3300006028 Unclassified 1841
86 Ga0075365_10023561 3300006038 Bacteria 3873
87 Ga0075368_10008507 3300006042 Bacteria 3657
88 Ga0075363_100025351 3300006048 Bacteria 3023
89 Ga0070712_100055104 3300006175 Bacteria 2783
90 Ga0070712_100222863 3300006175 Unclassified 1494
91 Ga0070712_100294166 3300006175 Bacteria 1312
92 Ga0075362_10001747 3300006177 Bacteria 7062
93 Ga0075367_10027780 3300006178 Bacteria 3222
94 Ga0075369_10001560 3300006186 Bacteria 7853
95 Ga0075366_10008127 3300006195 Bacteria 5819
96 Ga0097621_100005937 3300006237 Bacteria 8631
97 Ga0075370_10037161 3300006353 Bacteria 2737
98 Ga0068871_100096608 3300006358 Bacteria 2469
99 Ga0068871_100336384 3300006358 Bacteria 1332
100 Ga0075428_100128891 3300006844 Unclassified 2752
101 Ga0075428_100234000 3300006844 Bacteria 1982
102 Ga0075430_100018287 3300006846 Bacteria 5966
103 Ga0075430_100019949 3300006846 Bacteria 5704
104 Ga0075430_100047200 3300006846 Bacteria 3636
105 Ga0075431_100079111 3300006847 Bacteria 3394
106 Ga0075431_100118268 3300006847 Bacteria 2734
107 Ga0075431_100135637 3300006847 Bacteria 2537
108 Ga0075431_100142866 3300006847 Bacteria 2467
109 Ga0075431_100221566 3300006847 Bacteria 1930
110 Ga0075431_100477037 3300006847 Bacteria 1240
111 Ga0075433_10116675 3300006852 Bacteria 2368
112 Ga0075434_100015836 3300006871 Bacteria 7240
113 Ga0075434_100276977 3300006871 Bacteria 1697
114 Ga0075434_100326941 3300006871 Bacteria 1554
115 Ga0075434_100341966 3300006871 Bacteria 1517
116 Ga0075429_100005221 3300006880 Bacteria 11171
117 Ga0075429_100075845 3300006880 Bacteria 2928
118 Ga0075429_100081609 3300006880 Bacteria 2819
119 Ga0068865_100026098 3300006881 Bacteria 3849
120 Ga0068865_100193107 3300006881 Bacteria 1576
121 Ga0075436_100002734 3300006914 Bacteria 12129
122 Ga0075436_100108409 3300006914 Bacteria 1937
123 Ga0097620_100001693 3300006931 Bacteria 22469
124 Ga0097620_100267506 3300006931 Bacteria 1801
125 Ga0075435_100075799 3300007076 Bacteria 2755
126 Ga0099794_10003313 3300007265 Bacteria 6118
127 Ga0105240_10049482 3300009093 Bacteria 5304
128 Ga0111539_10172870 3300009094 Bacteria 2524
129 Ga0105247_10030331 3300009101 Bacteria 3277
130 Ga0114129_10018978 3300009147 Bacteria 9796
131 Ga0114129_10025871 3300009147 Bacteria 8312
132 Ga0114129_10082978 3300009147 Bacteria 4453
133 Ga0114129_10159218 3300009147 Bacteria 3086
134 Ga0114129_10333634 3300009147 Unclassified 2013
135 Ga0114129_10432661 3300009147 Unclassified 1729
136 Ga0105248_10009394 3300009177 Bacteria 10767
137 Ga0105248_10144060 3300009177 Bacteria 2688
138 Ga0105248_10217961 3300009177 Bacteria 2149
139 Ga0105248_10257273 3300009177 Bacteria 1965
140 Ga0105248_10272911 3300009177 Bacteria 1904
141 Ga0105237_10005448 3300009545 Bacteria 14352
142 Ga0105249_10038675 3300009553 Bacteria 4329
143 Ga0105249_10109575 3300009553 Bacteria 2608
144 Ga0105239_10031647 3300010375 Bacteria 5816
145 Ga0157371_10043983 3300013102 Bacteria 3181
146 Ga0157374_10001634 3300013296 Bacteria 18762
147 Ga0157378_10210012 3300013297 Bacteria 1846
148 Ga0163162_10061101 3300013306 Bacteria 3805
149 Ga0157375_10009404 3300013308 Bacteria 8581
150 Ga0157375_10284511 3300013308 Bacteria 1817
151 Ga0163163_10000331 3300014325 Bacteria 45717
152 Ga0163163_10010527 3300014325 Bacteria 8322
153 Ga0163163_10011825 3300014325 Bacteria 7936
154 Ga0163163_10273463 3300014325 Bacteria 1740
155 Ga0157377_10006200 3300014745 Bacteria 5686
156 Ga0157379_10015700 3300014968 Bacteria 6655
157 Ga0157376_10001052 3300014969 Bacteria 18092
158 Ga0157376_10024038 3300014969 Bacteria 4779
159 Ga0157376_10338708 3300014969 Bacteria 1436
160 Ga0163161_10005720 3300017792 Bacteria 8618
161 Ga0206356_11005689 3300020070 Bacteria 1945
162 Ga0213873_10002215 3300021358 Bacteria 3339
163 Ga0213873_10005705 3300021358 Bacteria 2404
164 Ga0213874_10044129 3300021377 Bacteria 1346
165 Ga0213871_10000988 3300021441 Bacteria 4425
166 Ga0224712_10033874 3300022467 Bacteria 1873
167 Ga0209436_100403 3300025208 Bacteria 19523
168 Ga0207425_1003280 3300025245 Bacteria 5262
169 Ga0209129_1000844 3300025258 Bacteria 19252
170 Ga0209129_1001867 3300025258 Bacteria 11122
171 Ga0209673_1000112 3300025273 Bacteria 179676
172 Ga0209673_1004579 3300025273 Bacteria 7333
173 Ga0209673_1017368 3300025273 Bacteria 2653
174 Ga0209130_1000023 3300025284 Bacteria 359355
175 Ga0209025_1000091 3300025294 Bacteria 250401
176 Ga0209564_1000265 3300025295 Bacteria 110606
177 Ga0209564_1001534 3300025295 Bacteria 22927
178 Ga0209758_1006435 3300025297 Bacteria 8439
179 Ga0209758_1022494 3300025297 Bacteria 2886
180 Ga0209758_1023704 3300025297 Bacteria 2764
181 Ga0209256_1003243 3300025299 Bacteria 11711
182 Ga0209256_1007899 3300025299 Bacteria 5093
183 Ga0207426_1000008 3300025302 Bacteria 848730
184 Ga0207426_1000344 3300025302 Bacteria 85912
185 Ga0209051_1001776 3300025303 Bacteria 17118
186 Ga0209051_1006678 3300025303 Bacteria 6453
187 Ga0207653_10008554 3300025885 Bacteria 3188
188 Ga0207688_10066161 3300025901 Bacteria 2043
189 Ga0207680_10066064 3300025903 Bacteria 2223
190 Ga0207680_10198278 3300025903 Bacteria 1366
191 Ga0207647_10011417 3300025904 Bacteria 6231
192 Ga0207685_10048616 3300025905 Bacteria 1626
193 Ga0207699_10194334 3300025906 Unclassified 1371
194 Ga0207699_10258599 3300025906 Bacteria 1202
195 Ga0207693_10009232 3300025915 Bacteria 8052
196 Ga0207663_10273384 3300025916 Bacteria 1252
197 Ga0207649_10000108 3300025920 Bacteria 69077
198 Ga0207646_10176186 3300025922 Bacteria 1932
199 Ga0207646_10229982 3300025922 Bacteria 1675
200 Ga0207646_10386320 3300025922 Bacteria 1264
201 Ga0207681_10039774 3300025923 Plasmid 3124
202 Ga0207650_10000333 3300025925 Bacteria 45762
203 Ga0207650_10139907 3300025925 Bacteria 1902
204 Ga0207659_10045730 3300025926 Bacteria 3088
205 Ga0207659_10105214 3300025926 Bacteria 2135
206 Ga0207700_10072758 3300025928 Unclassified 2652
207 Ga0207664_10016872 3300025929 Bacteria 5339
208 Ga0207644_10051355 3300025931 Bacteria 2959
209 Ga0207690_10057790 3300025932 Bacteria 2622
210 Ga0207706_10001028 3300025933 Bacteria 28347
211 Ga0207665_10003245 3300025939 Bacteria 10888
212 Ga0207665_10049183 3300025939 Bacteria 2832
213 Ga0207691_10002492 3300025940 Bacteria 18006
214 Ga0207711_10014458 3300025941 Bacteria 6558
215 Ga0207711_10261058 3300025941 Bacteria 1592
216 Ga0207689_10001315 3300025942 Bacteria 23936
217 Ga0207689_10011953 3300025942 Bacteria 7440
218 Ga0207661_10000383 3300025944 Bacteria 28533
219 Ga0207679_10000144 3300025945 Bacteria 58810
220 Ga0207667_10456597 3300025949 Bacteria 1298
221 Ga0207667_10549541 3300025949 Bacteria 1168
222 Ga0207651_10001698 3300025960 Bacteria 10155
223 Ga0207712_10058229 3300025961 Bacteria 2729
224 Ga0207658_10019734 3300025986 Bacteria 4662
225 Ga0207658_10035674 3300025986 Bacteria 3563
226 Ga0207677_10050688 3300026023 Plasmid 2809
227 Ga0207703_10006118 3300026035 Bacteria 9632
228 Ga0207678_10000287 3300026067 Bacteria 45710
229 Ga0207702_10037528 3300026078 Unclassified 4057
230 Ga0207641_10000375 3300026088 Bacteria 53080
231 Ga0207641_10084399 3300026088 Bacteria 2765
232 Ga0207648_10029646 3300026089 Plasmid 4852
233 Ga0207676_10000177 3300026095 Bacteria 56007
234 Ga0207676_10030389 3300026095 Bacteria 4055
235 Ga0207676_10260454 3300026095 Bacteria 1566
236 Ga0207674_10003119 3300026116 Bacteria 20448
237 Ga0207675_100029640 3300026118 Bacteria 5096
238 Ga0207675_100111801 3300026118 Bacteria 2577
239 Ga0207683_10000986 3300026121 Bacteria 26081
240 Ga0209588_1027197 3300027671 Bacteria 1819
241 Ga0268266_10002594 3300028379 Bacteria 19148
242 Ga0268266_10152769 3300028379 Bacteria 2082
243 Ga0268265_10001584 3300028380 Bacteria 18839
244 Ga0268264_10069325 3300028381 Bacteria 2982
245 Ga0268264_10203792 3300028381 Bacteria 1811
246 Ga0307513_10016564 3300031456 Bacteria 8884
247 Ga0307416_100334805 3300032002 Bacteria 1523
248 Ga0307411_10248934 3300032005 Bacteria 1396
249 Ga0373947_0037942 3300035725 Bacteria 2860
250 Ga0395905_0021767 3300037471 Bacteria 6064
251 Ga0436360_0383060 3300039438 Bacteria 8231
252 Ga0436361_0279252 3300039447 Bacteria 2201
253 Ga0436361_0681891 3300039447 Bacteria 2283
254 Ga0436362_0568284 3300039453 Bacteria 4591
255 Ga0436362_0637858 3300039453 Bacteria 3730
256 Ga0451833_0233082 3300041491 Bacteria 2078
257 Ga0451837_0476692 3300041494 Bacteria 3053
258 Ga0451839_0431993 3300041496 Bacteria 5203
259 Ga0451845_0063523 3300041501 Bacteria 2962
260 Ga0451847_0102847 3300041503 Bacteria 3274
261 Ga0451851_1106109 3300041507 Bacteria 3773
262 Ga0451853_1954937 3300041512 Bacteria 3349
263 Ga0439448_0003699 3300042005 Bacteria 4260
264 Ga0439444_0022632 3300042437 Bacteria 1122
265 Ga0495592_0002230 3300046454 Bacteria 13671
266 Ga0495629_0032076 3300046459 Bacteria 3720
267 Ga0495638_0058905 3300046460 Bacteria 2379
268 Ga0495639_0127709 3300046475 Bacteria 1216
269 Ga0495664_0085201 3300046477 Bacteria 1897
270 Ga0495585_0019329 3300046492 Bacteria 3928
271 Ga0495594_0007484 3300046499 Bacteria 5621
272 Ga0495607_0117651 3300046501 Bacteria 1400
273 Ga0495583_0047771 3300046506 Bacteria 1967
274 Ga0495606_0029251 3300046507 Bacteria 3872
275 Ga0495606_0066052 3300046507 Bacteria 2296
276 Ga0495610_0085548 3300046512 Bacteria 1438
277 Ga0495620_0044099 3300046515 Bacteria 1939
278 Ga0495628_0020304 3300046516 Bacteria 5483
279 Ga0495630_0321134 3300046517 Bacteria 1184
280 Ga0495632_0032299 3300046519 Bacteria 2698
281 Ga0495648_0076583 3300046524 Bacteria 1920
282 Ga0495666_0054231 3300046526 Bacteria 1923
283 Ga0495654_0000083 3300046530 Bacteria 107518
284 Ga0495654_0049223 3300046530 Bacteria 2065
285 Ga0495640_0002102 3300046533 Bacteria 15879
286 Ga0495597_0006075 3300046542 Bacteria 6287
287 Ga0495597_0031123 3300046542 Bacteria 2429
288 Ga0495633_0036211 3300046558 Bacteria 2365
289 Ga0495611_0005155 3300046648 Bacteria 5601
290 Ga0495625_0000614 3300046660 Bacteria 51714
291 Ga0495625_0178152 3300046660 Bacteria 1415
292 Ga0495657_0015276 3300046675 Bacteria 5620
293 Ga0495613_0018423 3300046689 Bacteria 5206
294 Ga0495624_0073266 3300046690 Bacteria 2129
295 Ga0495670_0066435 3300046691 Bacteria 1819
296 Ga0495671_0025900 3300046692 Bacteria 3045
297 Ga0495600_0037217 3300046809 Bacteria 3163
298 Ga0495660_0034557 3300046810 Bacteria 2828
299 Ga0495604_0026896 3300047317 Bacteria 4578
300 Ga0495604_0032970 3300047317 Bacteria 4101
301 Ga0495676_0001984 3300047321 Bacteria 17984
302 Ga0495675_0186860 3300047444 Bacteria 1266
303 Ga0495602_0108283 3300048088 Bacteria 2263
304 Ga0495626_0052534 3300048091 Bacteria 1878
305 Ga0496104_0098745 3300048907 Bacteria 2795
306 Ga0496106_0206865 3300048909 Bacteria 1563
307 Ga0496108_0000308 3300048911 Bacteria 42004
308 Ga0496109_0000311 3300048912 Bacteria 45781
309 Ga0496110_0005909 3300048913 Bacteria 9632
310 Ga0496112_0000135 3300048915 Bacteria 45822
311 Ga0496113_0000131 3300048916 Bacteria 32371
312 Ga0496123_0009048 3300048926 Bacteria 9027
313 Ga0501031_0000165 3300049568 Bacteria 37327
314 Ga0501032_0000640 3300049569 Bacteria 28433
315 Ga0501032_0053429 3300049569 Bacteria 2721
316 Ga0501033_0000458 3300049570 Bacteria 38719
317 Ga0501034_0023769 3300049571 Bacteria 6241
318 Ga0501034_0050764 3300049571 Bacteria 4183
319 Ga0501034_0216417 3300049571 Bacteria 1869
320 Ga0501036_0001194 3300049572 Bacteria 19791
321 Ga0501036_0353613 3300049572 Bacteria 1227
322 Ga0501037_0010701 3300049573 Bacteria 6741
323 Ga0501038_0004115 3300049574 Bacteria 13531
324 Ga0501039_0000569 3300049575 Bacteria 26644
325 Ga0501040_0048322 3300049576 Bacteria 2908
326 Ga0501043_0002928 3300049579 Bacteria 14250
327 Ga0501046_0004396 3300049580 Bacteria 12808
328 Ga0501046_0019634 3300049580 Bacteria 5602
329 Ga0501047_0008346 3300049581 Bacteria 9775
330 Ga0501048_0000355 3300049582 Bacteria 31756
331 Ga0501048_0042670 3300049582 Bacteria 3247
332 Ga0501067_0031181 3300049583 Bacteria 2958
333 Ga0501069_0001527 3300049585 Bacteria 11445
334 Ga0501070_0004081 3300049586 Bacteria 12551
335 Ga0501070_0006694 3300049586 Bacteria 9815
336 Ga0501070_0075954 3300049586 Bacteria 2781
337 Ga0501073_0001547 3300049589 Bacteria 17043
338 Ga0501074_0006230 3300049590 Bacteria 8609
339 Ga0501080_0000671 3300049742 Bacteria 27235
340 Ga0501083_0003578 3300049744 Bacteria 10892
341 Ga0501083_0048653 3300049744 Bacteria 2861
342 Ga0501035_0022233 3300049822 Bacteria 5824
343 Ga0501044_0009832 3300049823 Bacteria 10397
344 Ga0501044_0015257 3300049823 Bacteria 8276
345 Ga0501045_0083021 3300049824 Bacteria 2363
346 nmdc:mga00v17_172427_c1 3300050491 Bacteria 1395
347 nmdc:mga0k408_2675_c1 3300050493 Bacteria 9446
348 nmdc:mga05p37_135920_c1 3300050507 Bacteria 3015
349 nmdc:mga05p37_201384_c1 3300050507 Bacteria 2411
350 nmdc:mga05p37_286210_c1 3300050507 Bacteria 1963
351 nmdc:mga05p37_315258_c1 3300050507 Bacteria 1853
352 nmdc:mga05p37_38597_c1 3300050507 Bacteria 5859
353 nmdc:mga05p37_427296_c1 3300050507 Unclassified 1540
354 nmdc:mga05p37_43588_c1 3300050507 Bacteria 5520
355 nmdc:mga05p37_605618_c1 3300050507 Unclassified 1236
356 nmdc:mga05p37_61791_c1 3300050507 Bacteria 4611
357 nmdc:mga09592_188585_c1 3300050508 Bacteria 1785
358 nmdc:mga09592_45415_c1 3300050508 Bacteria 3701
359 nmdc:mga0qj67_187072_c1 3300050509 Bacteria 1682
360 nmdc:mga0qj67_26108_c1 3300050509 Bacteria 4521
361 nmdc:mga06r32_128838_c1 3300050510 Bacteria 2500
362 nmdc:mga06r32_171017_c1 3300050510 Bacteria 2157
363 nmdc:mga08y16_88886_c1 3300050511 Bacteria 3219
364 nmdc:mga0n895_119427_c1 3300050512 Bacteria 2657
365 nmdc:mga0n895_335297_c1 3300050512 Unclassified 1532
366 nmdc:mga0rr50_143649_c1 3300050513 Bacteria 1922
367 nmdc:mga0rr50_66178_c1 3300050513 Unclassified 2740
368 nmdc:mga0a205_25059_c1 3300050515 Bacteria 5680
369 Ga0500578_0031935 3300053086 Bacteria 3384
370 Ga0500555_011237 3300053103 Bacteria 2571
371 Ga0500594_0022823 3300053118 Bacteria 1581
372 Ga0500658_0000306 3300053134 Bacteria 22088
373 Ga0500616_0018276 3300053153 Bacteria 3965
374 Ga0500645_000766 3300053730 Bacteria 19549
375 Ga0501084_0005066 3300054114 Bacteria 10781
376 Ga0501082_0149558 3300060353 Bacteria 2028
377 Ga0501082_0390850 3300060353 Bacteria 1214

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10217961 Ga0105248_102179612 263
2 3300050510 nmdc:mga06r32_171017_c1 nmdc:mga06r32_171017_c1_1274_2065 263
3 3300006847 Ga0075431_100221566 Ga0075431_1002215662 266
4 3300025905 Ga0207685_10048616 Ga0207685_100486162 271
5 3300009147 Ga0114129_10082978 Ga0114129_100829783 278
6 3300050507 nmdc:mga05p37_61791_c1 nmdc:mga05p37_61791_c1_2237_3220 278
7 3300050508 nmdc:mga09592_45415_c1 nmdc:mga09592_45415_c1_1457_2440 278
8 3300042437 Ga0439444_0022632 Ga0439444_0022632_229_1080 283
9 3300006847 Ga0075431_100079111 Ga0075431_1000791115 285
10 3300050507 nmdc:mga05p37_286210_c1 nmdc:mga05p37_286210_c1_513_1505 286
11 3300006847 Ga0075431_100477037 Ga0075431_1004770372 289
12 3300039447 Ga0436361_0279252 Ga0436361_0279252_518_1477 293
13 3300050509 nmdc:mga0qj67_26108_c1 nmdc:mga0qj67_26108_c1_1507_2490 293
14 3300005439 Ga0070711_100286983 Ga0070711_1002869831 294
15 3300025916 Ga0207663_10273384 Ga0207663_102733841 294
16 3300006846 Ga0075430_100019949 Ga0075430_1000199495 300
17 3300006880 Ga0075429_100081609 Ga0075429_1000816092 300
18 3300006871 Ga0075434_100326941 Ga0075434_1003269411 302
19 3300006880 Ga0075429_100075845 Ga0075429_1000758453 302
20 3300050507 nmdc:mga05p37_315258_c1 nmdc:mga05p37_315258_c1_822_1808 303
21 3300005329 Ga0070683_100000143 Ga0070683_10000014337 308
22 3300005330 Ga0070690_100041022 Ga0070690_1000410221 308
23 3300005331 Ga0070670_100000972 Ga0070670_10000097216 308
24 3300005334 Ga0068869_100026825 Ga0068869_1000268253 308
25 3300005340 Ga0070689_100005894 Ga0070689_1000058944 308
26 3300005344 Ga0070661_100000234 Ga0070661_10000023416 308
27 3300005353 Ga0070669_100183124 Ga0070669_1001831241 308
28 3300005354 Ga0070675_100123450 Ga0070675_1001234502 308
29 3300005364 Ga0070673_100001149 Ga0070673_10000114917 308
30 3300005365 Ga0070688_100021948 Ga0070688_1000219483 308
31 3300005366 Ga0070659_100067863 Ga0070659_1000678632 308
32 3300005367 Ga0070667_100009506 Ga0070667_1000095063 308
33 3300005455 Ga0070663_100000408 Ga0070663_10000040816 308
34 3300005459 Ga0068867_100010333 Ga0068867_1000103331 308
35 3300005466 Ga0070685_10081649 Ga0070685_100816491 308
36 3300005535 Ga0070684_100000160 Ga0070684_10000016036 308
37 3300005543 Ga0070672_100001716 Ga0070672_1000017164 308
38 3300005548 Ga0070665_100002722 Ga0070665_1000027224 308
39 3300005564 Ga0070664_100000167 Ga0070664_10000016716 308
40 3300005577 Ga0068857_100000125 Ga0068857_10000012517 308
41 3300005617 Ga0068859_100001693 Ga0068859_10000169316 308
42 3300005618 Ga0068864_100000279 Ga0068864_10000027940 308
43 3300005841 Ga0068863_100001947 Ga0068863_10000194716 308
44 3300005842 Ga0068858_100012127 Ga0068858_1000121279 308
45 3300005843 Ga0068860_100100575 Ga0068860_1001005751 308
46 3300005844 Ga0068862_100003738 Ga0068862_1000037384 308
47 3300006358 Ga0068871_100096608 Ga0068871_1000966082 308
48 3300006931 Ga0097620_100001693 Ga0097620_10000169316 308
49 3300009101 Ga0105247_10030331 Ga0105247_100303313 308
50 3300009177 Ga0105248_10009394 Ga0105248_100093947 308
51 3300013296 Ga0157374_10001634 Ga0157374_100016344 308
52 3300013306 Ga0163162_10061101 Ga0163162_100611013 308
53 3300013308 Ga0157375_10009404 Ga0157375_100094044 308
54 3300014325 Ga0163163_10000331 Ga0163163_1000033115 308
55 3300014745 Ga0157377_10006200 Ga0157377_100062005 308
56 3300014968 Ga0157379_10015700 Ga0157379_100157004 308
57 3300014969 Ga0157376_10001052 Ga0157376_1000105215 308
58 3300025901 Ga0207688_10066161 Ga0207688_100661611 308
59 3300025903 Ga0207680_10066064 Ga0207680_100660642 308
60 3300025904 Ga0207647_10011417 Ga0207647_100114176 308
61 3300025920 Ga0207649_10000108 Ga0207649_1000010839 308
62 3300025925 Ga0207650_10000333 Ga0207650_1000033335 308
63 3300025926 Ga0207659_10105214 Ga0207659_101052142 308
64 3300025931 Ga0207644_10051355 Ga0207644_100513551 308
65 3300025932 Ga0207690_10057790 Ga0207690_100577901 308
66 3300025940 Ga0207691_10002492 Ga0207691_1000249218 308
67 3300025941 Ga0207711_10014458 Ga0207711_100144584 308
68 3300025942 Ga0207689_10001315 Ga0207689_1000131511 308
69 3300025944 Ga0207661_10000383 Ga0207661_1000038314 308
70 3300025945 Ga0207679_10000144 Ga0207679_1000014443 308
71 3300025949 Ga0207667_10549541 Ga0207667_105495411 308
72 3300025960 Ga0207651_10001698 Ga0207651_100016989 308
73 3300025986 Ga0207658_10035674 Ga0207658_100356742 308
74 3300026035 Ga0207703_10006118 Ga0207703_1000611810 308
75 3300026067 Ga0207678_10000287 Ga0207678_1000028735 308
76 3300026088 Ga0207641_10000375 Ga0207641_1000037535 308
77 3300026095 Ga0207676_10000177 Ga0207676_1000017735 308
78 3300026116 Ga0207674_10003119 Ga0207674_100031195 308
79 3300028379 Ga0268266_10002594 Ga0268266_1000259416 308
80 3300028380 Ga0268265_10001584 Ga0268265_100015846 308
81 3300028381 Ga0268264_10069325 Ga0268264_100693253 308
82 3300028381 Ga0268264_10203792 Ga0268264_102037921 308
83 3300048911 Ga0496108_0000308 Ga0496108_0000308_16215_17210 308
84 3300048912 Ga0496109_0000311 Ga0496109_0000311_28607_29602 308
85 3300048913 Ga0496110_0005909 Ga0496110_0005909_7645_8640 308
86 3300048915 Ga0496112_0000135 Ga0496112_0000135_16238_17233 308
87 3300048916 Ga0496113_0000131 Ga0496113_0000131_28787_29782 308
88 3300006237 Ga0097621_100005937 Ga0097621_10000593710 309
89 3300006881 Ga0068865_100026098 Ga0068865_1000260981 309
90 3300009177 Ga0105248_10144060 Ga0105248_101440602 309
91 3300013297 Ga0157378_10210012 Ga0157378_102100123 309
92 3300014969 Ga0157376_10024038 Ga0157376_100240382 309
93 3300017792 Ga0163161_10005720 Ga0163161_100057202 309
94 3300025933 Ga0207706_10001028 Ga0207706_1000102812 309
95 iso_pu_bacteria 2738543027 2739325651 311
96 3300005338 Ga0068868_100046836 Ga0068868_1000468363 313
97 3300005347 Ga0070668_100006458 Ga0070668_10000645810 313
98 3300005355 Ga0070671_100183343 Ga0070671_1001833431 313
99 3300005356 Ga0070674_100168861 Ga0070674_1001688611 313
100 3300005367 Ga0070667_100095016 Ga0070667_1000950164 313
101 3300005456 Ga0070678_100001016 Ga0070678_1000010162 313
102 3300005548 Ga0070665_100098645 Ga0070665_1000986452 313
103 3300005718 Ga0068866_10007755 Ga0068866_100077553 313
104 3300005719 Ga0068861_100255265 Ga0068861_1002552652 313
105 3300010375 Ga0105239_10031647 Ga0105239_100316478 313
106 3300013102 Ga0157371_10043983 Ga0157371_100439832 313
107 3300025903 Ga0207680_10198278 Ga0207680_101982781 313
108 3300025923 Ga0207681_10039774 Ga0207681_100397742 313
109 3300025942 Ga0207689_10011953 Ga0207689_100119532 313
110 3300025986 Ga0207658_10019734 Ga0207658_100197343 313
111 3300026023 Ga0207677_10050688 Ga0207677_100506882 313
112 3300026089 Ga0207648_10029646 Ga0207648_100296467 313
113 3300026095 Ga0207676_10260454 Ga0207676_102604541 313
114 3300026118 Ga0207675_100111801 Ga0207675_1001118014 313
115 3300026121 Ga0207683_10000986 Ga0207683_100009867 313
116 3300006846 Ga0075430_100047200 Ga0075430_1000472001 314
117 3300025922 Ga0207646_10386320 Ga0207646_103863202 315
118 3300039453 Ga0436362_0637858 Ga0436362_0637858_508_1455 315
119 3300046454 Ga0495592_0002230 Ga0495592_0002230_1929_2879 315
120 3300046459 Ga0495629_0032076 Ga0495629_0032076_1169_2119 315
121 3300046477 Ga0495664_0085201 Ga0495664_0085201_118_1068 315
122 3300046499 Ga0495594_0007484 Ga0495594_0007484_3293_4243 315
123 3300046516 Ga0495628_0020304 Ga0495628_0020304_3207_4157 315
124 3300046526 Ga0495666_0054231 Ga0495666_0054231_455_1405 315
125 3300046533 Ga0495640_0002102 Ga0495640_0002102_12286_13236 315
126 3300046648 Ga0495611_0005155 Ga0495611_0005155_11_961 315
127 3300046675 Ga0495657_0015276 Ga0495657_0015276_3272_4222 315
128 3300046689 Ga0495613_0018423 Ga0495613_0018423_2516_3466 315
129 3300046690 Ga0495624_0073266 Ga0495624_0073266_882_1832 315
130 3300046809 Ga0495600_0037217 Ga0495600_0037217_374_1324 315
131 3300047317 Ga0495604_0026896 Ga0495604_0026896_2017_2973 315
132 3300047317 Ga0495604_0032970 Ga0495604_0032970_2862_3812 315
133 3300047321 Ga0495676_0001984 Ga0495676_0001984_13800_14750 315
134 3300047444 Ga0495675_0186860 Ga0495675_0186860_283_1233 315
135 3300048907 Ga0496104_0098745 Ga0496104_0098745_1724_2698 315
136 3300049571 Ga0501034_0050764 Ga0501034_0050764_575_1525 315
137 3300049571 Ga0501034_0216417 Ga0501034_0216417_853_1812 315
138 3300049572 Ga0501036_0353613 Ga0501036_0353613_242_1201 315
139 3300049580 Ga0501046_0019634 Ga0501046_0019634_4067_5026 315
140 3300049586 Ga0501070_0004081 Ga0501070_0004081_1408_2358 315
141 3300049586 Ga0501070_0075954 Ga0501070_0075954_1691_2650 315
142 3300049568 Ga0501031_0000165 Ga0501031_0000165_26165_27121 317
143 3300049569 Ga0501032_0000640 Ga0501032_0000640_26099_27055 317
144 3300049570 Ga0501033_0000458 Ga0501033_0000458_11642_12598 317
145 3300049571 Ga0501034_0023769 Ga0501034_0023769_4804_5760 317
146 3300049572 Ga0501036_0001194 Ga0501036_0001194_13874_14830 317
147 3300049573 Ga0501037_0010701 Ga0501037_0010701_1187_2143 317
148 3300049574 Ga0501038_0004115 Ga0501038_0004115_5690_6646 317
149 3300049575 Ga0501039_0000569 Ga0501039_0000569_3092_4048 317
150 3300049576 Ga0501040_0048322 Ga0501040_0048322_1532_2488 317
151 3300049579 Ga0501043_0002928 Ga0501043_0002928_7375_8331 317
152 3300049580 Ga0501046_0004396 Ga0501046_0004396_3726_4682 317
153 3300049581 Ga0501047_0008346 Ga0501047_0008346_3118_4074 317
154 3300049582 Ga0501048_0000355 Ga0501048_0000355_23372_24328 317
155 3300049583 Ga0501067_0031181 Ga0501067_0031181_972_1928 317
156 3300049585 Ga0501069_0001527 Ga0501069_0001527_3679_4635 317
157 3300049586 Ga0501070_0006694 Ga0501070_0006694_5009_5965 317
158 3300049589 Ga0501073_0001547 Ga0501073_0001547_2883_3839 317
159 3300049590 Ga0501074_0006230 Ga0501074_0006230_5336_6292 317
160 3300049742 Ga0501080_0000671 Ga0501080_0000671_8760_9716 317
161 3300049744 Ga0501083_0003578 Ga0501083_0003578_2810_3766 317
162 3300049822 Ga0501035_0022233 Ga0501035_0022233_1468_2424 317
163 3300049823 Ga0501044_0009832 Ga0501044_0009832_4815_5771 317
164 3300049824 Ga0501045_0083021 Ga0501045_0083021_1137_2093 317
165 3300054114 Ga0501084_0005066 Ga0501084_0005066_2703_3659 317
166 3300005406 Ga0070703_10025589 Ga0070703_100255891 318
167 3300005444 Ga0070694_100166808 Ga0070694_1001668082 318
168 3300005518 Ga0070699_100049811 Ga0070699_1000498114 318
169 3300005546 Ga0070696_100363691 Ga0070696_1003636911 318
170 3300006175 Ga0070712_100222863 Ga0070712_1002228632 318
171 3300006844 Ga0075428_100128891 Ga0075428_1001288912 318
172 3300006847 Ga0075431_100118268 Ga0075431_1001182683 318
173 3300006852 Ga0075433_10116675 Ga0075433_101166752 318
174 3300006871 Ga0075434_100015836 Ga0075434_1000158365 318
175 3300006914 Ga0075436_100002734 Ga0075436_10000273410 318
176 3300006914 Ga0075436_100108409 Ga0075436_1001084091 318
177 3300007265 Ga0099794_10003313 Ga0099794_100033132 318
178 3300009147 Ga0114129_10018978 Ga0114129_100189784 318
179 3300009147 Ga0114129_10025871 Ga0114129_100258712 318
180 3300009147 Ga0114129_10159218 Ga0114129_101592182 318
181 3300009147 Ga0114129_10333634 Ga0114129_103336341 318
182 3300009147 Ga0114129_10432661 Ga0114129_104326612 318
183 3300025885 Ga0207653_10008554 Ga0207653_100085542 318
184 3300025906 Ga0207699_10194334 Ga0207699_101943342 318
185 3300025906 Ga0207699_10258599 Ga0207699_102585991 318
186 3300025922 Ga0207646_10229982 Ga0207646_102299822 318
187 3300025939 Ga0207665_10003245 Ga0207665_100032456 318
188 3300025939 Ga0207665_10049183 Ga0207665_100491832 318
189 3300027671 Ga0209588_1027197 Ga0209588_10271972 318
190 3300046501 Ga0495607_0117651 Ga0495607_0117651_408_1376 318
191 3300050507 nmdc:mga05p37_135920_c1 nmdc:mga05p37_135920_c1_167_1144 318
192 3300050507 nmdc:mga05p37_201384_c1 nmdc:mga05p37_201384_c1_340_1326 318
193 3300050507 nmdc:mga05p37_38597_c1 nmdc:mga05p37_38597_c1_2498_3505 318
194 3300050507 nmdc:mga05p37_427296_c1 nmdc:mga05p37_427296_c1_173_1159 318
195 3300050507 nmdc:mga05p37_605618_c1 nmdc:mga05p37_605618_c1_180_1166 318
196 3300050510 nmdc:mga06r32_128838_c1 nmdc:mga06r32_128838_c1_263_1225 318
197 3300050512 nmdc:mga0n895_119427_c1 nmdc:mga0n895_119427_c1_613_1578 318
198 3300050512 nmdc:mga0n895_335297_c1 nmdc:mga0n895_335297_c1_440_1426 318
199 3300050513 nmdc:mga0rr50_66178_c1 nmdc:mga0rr50_66178_c1_930_1916 318
200 3300050515 nmdc:mga0a205_25059_c1 nmdc:mga0a205_25059_c1_1643_2608 318
201 3300005445 Ga0070708_100247444 Ga0070708_1002474442 319
202 3300005841 Ga0068863_100190502 Ga0068863_1001905023 319
203 3300005841 Ga0068863_100208230 Ga0068863_1002082302 319
204 3300005981 Ga0081538_10026954 Ga0081538_100269546 319
205 3300006175 Ga0070712_100055104 Ga0070712_1000551042 319
206 3300006358 Ga0068871_100336384 Ga0068871_1003363841 319
207 3300006871 Ga0075434_100276977 Ga0075434_1002769772 319
208 3300006871 Ga0075434_100341966 Ga0075434_1003419662 319
209 3300007076 Ga0075435_100075799 Ga0075435_1000757992 319
210 3300009553 Ga0105249_10109575 Ga0105249_101095751 319
211 3300014325 Ga0163163_10011825 Ga0163163_100118251 319
212 3300014969 Ga0157376_10338708 Ga0157376_103387081 319
213 3300021358 Ga0213873_10002215 Ga0213873_100022151 319
214 3300021358 Ga0213873_10005705 Ga0213873_100057052 319
215 3300021377 Ga0213874_10044129 Ga0213874_100441292 319
216 3300021441 Ga0213871_10000988 Ga0213871_100009884 319
217 3300025915 Ga0207693_10009232 Ga0207693_100092327 319
218 3300025922 Ga0207646_10176186 Ga0207646_101761862 319
219 3300025925 Ga0207650_10139907 Ga0207650_101399072 319
220 3300025941 Ga0207711_10261058 Ga0207711_102610582 319
221 3300026088 Ga0207641_10084399 Ga0207641_100843992 319
222 3300035725 Ga0373947_0037942 Ga0373947_0037942_1730_2695 319
223 3300037471 Ga0395905_0021767 Ga0395905_0021767_3456_4451 319
224 3300039438 Ga0436360_0383060 Ga0436360_0383060_1054_2013 319
225 3300039447 Ga0436361_0681891 Ga0436361_0681891_286_1245 319
226 3300039453 Ga0436362_0568284 Ga0436362_0568284_2167_3126 319
227 3300048088 Ga0495602_0108283 Ga0495602_0108283_116_1081 319
228 3300050513 nmdc:mga0rr50_143649_c1 nmdc:mga0rr50_143649_c1_754_1719 319
229 3300053103 Ga0500555_011237 Ga0500555_011237_1066_2052 319
230 3300053730 Ga0500645_000766 Ga0500645_000766_16937_17923 319
231 iso_pu_bacteria 2842271015 2842271669 319
232 3300005330 Ga0070690_100075066 Ga0070690_1000750661 320
233 3300005340 Ga0070689_100045189 Ga0070689_1000451891 320
234 3300005344 Ga0070661_100079275 Ga0070661_1000792752 320
235 3300005347 Ga0070668_100345674 Ga0070668_1003456741 320
236 3300005354 Ga0070675_100028888 Ga0070675_1000288883 320
237 3300005355 Ga0070671_100271965 Ga0070671_1002719652 320
238 3300005435 Ga0070714_100007135 Ga0070714_1000071353 320
239 3300005436 Ga0070713_100325333 Ga0070713_1003253331 320
240 3300005456 Ga0070678_100166288 Ga0070678_1001662881 320
241 3300005457 Ga0070662_100078036 Ga0070662_1000780361 320
242 3300005459 Ga0068867_100360439 Ga0068867_1003604391 320
243 3300005535 Ga0070684_100217936 Ga0070684_1002179361 320
244 3300005548 Ga0070665_100065938 Ga0070665_1000659382 320
245 3300005563 Ga0068855_100570906 Ga0068855_1005709061 320
246 3300005614 Ga0068856_100330340 Ga0068856_1003303402 320
247 3300005617 Ga0068859_100267498 Ga0068859_1002674983 320
248 3300005719 Ga0068861_100036785 Ga0068861_1000367853 320
249 3300005841 Ga0068863_100031424 Ga0068863_1000314243 320
250 3300006028 Ga0070717_10180309 Ga0070717_101803092 320
251 3300006175 Ga0070712_100294166 Ga0070712_1002941661 320
252 3300006844 Ga0075428_100234000 Ga0075428_1002340002 320
253 3300006846 Ga0075430_100018287 Ga0075430_1000182875 320
254 3300006847 Ga0075431_100135637 Ga0075431_1001356372 320
255 3300006880 Ga0075429_100005221 Ga0075429_1000052216 320
256 3300006881 Ga0068865_100193107 Ga0068865_1001931072 320
257 3300006931 Ga0097620_100267506 Ga0097620_1002675063 320
258 3300009093 Ga0105240_10049482 Ga0105240_100494822 320
259 3300009094 Ga0111539_10172870 Ga0111539_101728703 320
260 3300009177 Ga0105248_10257273 Ga0105248_102572732 320
261 3300009177 Ga0105248_10272911 Ga0105248_102729111 320
262 3300009545 Ga0105237_10005448 Ga0105237_1000544817 320
263 3300009553 Ga0105249_10038675 Ga0105249_100386753 320
264 3300013308 Ga0157375_10284511 Ga0157375_102845112 320
265 3300014325 Ga0163163_10010527 Ga0163163_100105275 320
266 3300014325 Ga0163163_10273463 Ga0163163_102734631 320
267 3300025926 Ga0207659_10045730 Ga0207659_100457303 320
268 3300025928 Ga0207700_10072758 Ga0207700_100727583 320
269 3300025929 Ga0207664_10016872 Ga0207664_100168725 320
270 3300025949 Ga0207667_10456597 Ga0207667_104565971 320
271 3300025961 Ga0207712_10058229 Ga0207712_100582291 320
272 3300026078 Ga0207702_10037528 Ga0207702_100375282 320
273 3300026095 Ga0207676_10030389 Ga0207676_100303893 320
274 3300026118 Ga0207675_100029640 Ga0207675_1000296403 320
275 3300028379 Ga0268266_10152769 Ga0268266_101527692 320
276 3300032002 Ga0307416_100334805 Ga0307416_1003348052 320
277 3300032005 Ga0307411_10248934 Ga0307411_102489342 320
278 3300046475 Ga0495639_0127709 Ga0495639_0127709_12_983 320
279 3300046517 Ga0495630_0321134 Ga0495630_0321134_78_1049 320
280 3300046542 Ga0495597_0006075 Ga0495597_0006075_5183_6196 320
281 3300046660 Ga0495625_0178152 Ga0495625_0178152_61_1074 320
282 3300048909 Ga0496106_0206865 Ga0496106_0206865_376_1344 320
283 3300050507 nmdc:mga05p37_43588_c1 nmdc:mga05p37_43588_c1_4330_5298 320
284 3300050508 nmdc:mga09592_188585_c1 nmdc:mga09592_188585_c1_588_1556 320
285 3300050511 nmdc:mga08y16_88886_c1 nmdc:mga08y16_88886_c1_1665_2633 320
286 3300005983 Ga0081540_1000411 Ga0081540_100041135 321
287 3300048926 Ga0496123_0009048 Ga0496123_0009048_4483_5544 321
288 3300022467 Ga0224712_10033874 Ga0224712_100338741 322
289 3300005518 Ga0070699_100055761 Ga0070699_1000557613 323
290 3300006847 Ga0075431_100142866 Ga0075431_1001428662 323
291 3300046660 Ga0495625_0000614 Ga0495625_0000614_12144_13169 323
292 3300050509 nmdc:mga0qj67_187072_c1 nmdc:mga0qj67_187072_c1_119_1096 323
293 3300005445 Ga0070708_100065450 Ga0070708_1000654504 324
294 3300005981 Ga0081538_10082500 Ga0081538_100825002 324
295 3300020070 Ga0206356_11005689 Ga0206356_110056892 326
296 3300005983 Ga0081540_1000377 Ga0081540_100037730 327
297 3300042005 Ga0439448_0003699 Ga0439448_0003699_3212_4231 327
298 3300049582 Ga0501048_0042670 Ga0501048_0042670_1671_2696 328
299 3300049744 Ga0501083_0048653 Ga0501083_0048653_839_1864 328
300 3300049823 Ga0501044_0015257 Ga0501044_0015257_250_1275 328
301 3300060353 Ga0501082_0390850 Ga0501082_0390850_27_1052 328
302 iso_pu_bacteria 2851153111 2851154342 328
303 3300046507 Ga0495606_0066052 Ga0495606_0066052_1035_2045 329
304 iso_pu_bacteria 2585428106 2587916470 329
305 iso_pu_bacteria 2791355048 2792463884 329
306 iso_pu_bacteria 2843744320 2843747617 329
307 3300046530 Ga0495654_0000083 Ga0495654_0000083_62253_63281 330
308 iso_pu_bacteria 2510065019 2510134204 333
309 iso_pu_bacteria 2510461076 2510895640 333
310 iso_pu_bacteria 2513237085 2513577202 333
311 iso_pu_bacteria 2513237093 2513633127 333
312 iso_pu_bacteria 2513237103 2513707875 333
313 iso_pu_bacteria 2513237162 2514018049 333
314 iso_pu_bacteria 2515154113 2515635089 333
315 iso_pu_bacteria 2515154114 2515645531 333
316 iso_pu_bacteria 2515154116 2515655089 333
317 iso_pu_bacteria 2515154134 2515739737 333
318 iso_pu_bacteria 2516653085 2517077333 333
319 iso_pu_bacteria 2517093000 2517096092 333
320 iso_pu_bacteria 2529292951 2530646547 333
321 iso_pu_bacteria 2585427526 2585524761 333
322 iso_pu_bacteria 2585427528 2585538444 333
323 iso_pu_bacteria 2585427593 2585836397 333
324 iso_pu_bacteria 2599185236 2599721643 333
325 iso_pu_bacteria 2718217927 2719386656 333
326 iso_pu_bacteria 2718218423 2721400362 333
327 iso_pu_bacteria 2721755809 2724039175 333
328 iso_pu_bacteria 2724679232 2725945352 333
329 iso_pu_bacteria 2738541333 2739033085 333
330 iso_pu_bacteria 2765235942 2766066129 333
331 iso_pu_bacteria 2802429633 2806045224 333
332 iso_pu_bacteria 2802429634 2806049981 333
333 iso_pu_bacteria 2802429635 2806056819 333
334 iso_pu_bacteria 2802429636 2806064200 333
335 iso_pu_bacteria 2802429637 2806071468 333
336 iso_pu_bacteria 2818991461 2819682653 333
337 iso_pu_bacteria 2838729681 2838730249 333
338 iso_pu_bacteria 2838742623 2838742736 333
339 iso_pu_bacteria 2841851746 2841854621 333
340 iso_pu_bacteria 2841864319 2841867207 333
341 iso_pu_bacteria 2842110456 2842113008 333
342 iso_pu_bacteria 2842156927 2842158359 333
343 iso_pu_bacteria 2842163707 2842168538 333
344 iso_pu_bacteria 2842180545 2842181975 333
345 iso_pu_bacteria 2842217011 2842218201 333
346 iso_pu_bacteria 2842229732 2842230026 333
347 iso_pu_bacteria 2842243621 2842243915 333
348 iso_pu_bacteria 2842257432 2842258000 333
349 iso_pu_bacteria 2842304105 2842305300 333
350 iso_pu_bacteria 2842363717 2842368346 333
351 iso_pu_bacteria 2844454524 2844458090 333
352 iso_pu_bacteria 2857516855 2857517166 333
353 iso_pu_bacteria 2933570622 2933571107 333
354 iso_pu_bacteria 2933586486 2933588935 333
355 iso_pu_bacteria 2935901341 2935901699 333
356 iso_pu_bacteria 2936367885 2936371787 333
357 iso_pu_bacteria 2936375103 2936379622 333
358 iso_pu_bacteria 3005409236 3005414314 333
359 iso_pu_bacteria 639633055 639649426 333
360 iso_pu_bacteria 8005275841 8005281466 333
361 iso_pu_bacteria 8005307578 8005313852 333
362 iso_pu_bacteria 8005376324 8005381181 333
363 iso_pu_bacteria 8005556819 8005561474 333
364 iso_pu_bacteria 8005563573 8005568252 333
365 iso_pu_bacteria 8005570704 8005573210 333
366 iso_pu_bacteria 8018163183 8018164314 333
367 iso_pu_bacteria 8018176218 8018176800 333
368 iso_pu_bacteria 8023680758 8023682912 333
369 iso_pu_bacteria 8024479707 8024482609 333
370 iso_pu_bacteria 8057874678 8057880600 333
371 3300046558 Ga0495633_0036211 Ga0495633_0036211_213_1223 336
372 3300002987 JGI25159J45721_1000484 JGI25159J45721_100048413 337
373 3300003187 JGI25151J46595_10000976 JGI25151J46595_1000097616 337
374 3300003215 JGI25153J46596_10003937 JGI25153J46596_100039376 337
375 3300003215 JGI25153J46596_10013063 JGI25153J46596_100130633 337
376 3300003215 JGI25153J46596_10013726 JGI25153J46596_100137262 337
377 3300003354 JGI25160J50197_1001970 JGI25160J50197_10019706 337
378 3300003374 JGI25161J50226_1000370 JGI25161J50226_10003707 337
379 3300003771 Ga0055526_1001724 Ga0055526_10017245 337
380 3300003771 Ga0055526_1013154 Ga0055526_10131541 337
381 3300003775 Ga0055524_1005295 Ga0055524_10052955 337
382 3300003790 Ga0055528_1004574 Ga0055528_10045743 337
383 3300003792 Ga0055540_1002130 Ga0055540_10021309 337
384 3300004625 Ga0055543_1000060 Ga0055543_100006049 337
385 3300004625 Ga0055543_1003633 Ga0055543_10036332 337
386 3300005262 Ga0065165_1010372 Ga0065165_10103722 337
387 3300005262 Ga0065165_1014366 Ga0065165_10143661 337
388 3300005337 Ga0070682_100058845 Ga0070682_1000588452 337
389 3300006038 Ga0075365_10023561 Ga0075365_100235613 337
390 3300006042 Ga0075368_10008507 Ga0075368_100085073 337
391 3300006048 Ga0075363_100025351 Ga0075363_1000253513 337
392 3300006177 Ga0075362_10001747 Ga0075362_100017473 337
393 3300006178 Ga0075367_10027780 Ga0075367_100277803 337
394 3300006186 Ga0075369_10001560 Ga0075369_100015604 337
395 3300006195 Ga0075366_10008127 Ga0075366_100081273 337
396 3300006353 Ga0075370_10037161 Ga0075370_100371612 337
397 3300025208 Ga0209436_100403 Ga0209436_10040317 337
398 3300025245 Ga0207425_1003280 Ga0207425_10032803 337
399 3300025258 Ga0209129_1000844 Ga0209129_100084413 337
400 3300025258 Ga0209129_1001867 Ga0209129_10018679 337
401 3300025273 Ga0209673_1000112 Ga0209673_100011238 337
402 3300025273 Ga0209673_1004579 Ga0209673_10045792 337
403 3300025273 Ga0209673_1017368 Ga0209673_10173683 337
404 3300025284 Ga0209130_1000023 Ga0209130_10000239 337
405 3300025294 Ga0209025_1000091 Ga0209025_1000091152 337
406 3300025295 Ga0209564_1000265 Ga0209564_100026592 337
407 3300025295 Ga0209564_1001534 Ga0209564_10015343 337
408 3300025297 Ga0209758_1006435 Ga0209758_10064356 337
409 3300025297 Ga0209758_1022494 Ga0209758_10224942 337
410 3300025297 Ga0209758_1023704 Ga0209758_10237043 337
411 3300025299 Ga0209256_1003243 Ga0209256_10032438 337
412 3300025299 Ga0209256_1007899 Ga0209256_10078993 337
413 3300025302 Ga0207426_1000008 Ga0207426_100000862 337
414 3300025302 Ga0207426_1000344 Ga0207426_100034441 337
415 3300025303 Ga0209051_1001776 Ga0209051_10017762 337
416 3300025303 Ga0209051_1006678 Ga0209051_10066786 337
417 3300031456 Ga0307513_10016564 Ga0307513_100165646 337
418 3300041491 Ga0451833_0233082 Ga0451833_0233082_235_1248 337
419 3300041494 Ga0451837_0476692 Ga0451837_0476692_782_1795 337
420 3300041496 Ga0451839_0431993 Ga0451839_0431993_782_1795 337
421 3300041501 Ga0451845_0063523 Ga0451845_0063523_899_1912 337
422 3300041503 Ga0451847_0102847 Ga0451847_0102847_2117_3130 337
423 3300041507 Ga0451851_1106109 Ga0451851_1106109_524_1537 337
424 3300041512 Ga0451853_1954937 Ga0451853_1954937_235_1248 337
425 3300046460 Ga0495638_0058905 Ga0495638_0058905_177_1190 337
426 3300046492 Ga0495585_0019329 Ga0495585_0019329_1922_2935 337
427 3300046506 Ga0495583_0047771 Ga0495583_0047771_314_1327 337
428 3300046507 Ga0495606_0029251 Ga0495606_0029251_845_1858 337
429 3300046512 Ga0495610_0085548 Ga0495610_0085548_75_1088 337
430 3300046515 Ga0495620_0044099 Ga0495620_0044099_732_1745 337
431 3300046519 Ga0495632_0032299 Ga0495632_0032299_1410_2423 337
432 3300046524 Ga0495648_0076583 Ga0495648_0076583_537_1550 337
433 3300046530 Ga0495654_0049223 Ga0495654_0049223_1016_2029 337
434 3300046542 Ga0495597_0031123 Ga0495597_0031123_947_1960 337
435 3300046691 Ga0495670_0066435 Ga0495670_0066435_191_1204 337
436 3300046692 Ga0495671_0025900 Ga0495671_0025900_601_1614 337
437 3300046810 Ga0495660_0034557 Ga0495660_0034557_1213_2226 337
438 3300048091 Ga0495626_0052534 Ga0495626_0052534_27_1040 337
439 3300049569 Ga0501032_0053429 Ga0501032_0053429_825_1838 337
440 3300050491 nmdc:mga00v17_172427_c1 nmdc:mga00v17_172427_c1_225_1238 337
441 3300050493 nmdc:mga0k408_2675_c1 nmdc:mga0k408_2675_c1_3202_4215 337
442 3300053086 Ga0500578_0031935 Ga0500578_0031935_511_1524 337
443 3300053118 Ga0500594_0022823 Ga0500594_0022823_221_1234 337
444 3300053134 Ga0500658_0000306 Ga0500658_0000306_2292_3305 337
445 3300053153 Ga0500616_0018276 Ga0500616_0018276_2903_3916 337
446 3300060353 Ga0501082_0149558 Ga0501082_0149558_454_1467 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

128

337

0.97

PF20434

BD-FAE

BD-FAE

113

271

0.89

PF00326

Peptidase_S9

Prolyl oligopeptidase family

173

337

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v2i-assembly1.cif.gz_B biochemical characterization and structural analysis of a new cold- active and salt tolerant esterase from the marine bacterium thalassospira sp 0.985 25 337
7yc0-assembly2.cif.gz_C-2 acetylesterase (lgesti) w.t. 0.981 26 333
4ou4-assembly1.cif.gz_A-2 crystal structure of esterase rppe mutant s159a complexed with (s)-ac-cpa 0.9779 23 335
4ou5-assembly1.cif.gz_A crystal structure of esterase rppe mutant s159a/w187h 0.976 23 335
4v2i-assembly1.cif.gz_B biochemical characterization and structural analysis of a new cold- active and salt tolerant esterase from the marine bacterium thalassospira sp 0.9758 25 337
ID Description Score Start End Superfamily
4v2iB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.985 25 337 3.40.50.1820
4v2iB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9758 25 337 3.40.50.1820
af_Q54L36_11_325_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9747 31 337 3.40.50.1820
4ob8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9707 23 335 3.40.50.1820
4ypvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9499 25 335 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4U9HKL8-F1-model_v4 Lipase 2 (EC 3.1.1.3) 0.9948 198 335 GO:0004806
AF-A0A6B1JUZ2-F1-model_v4 deleted 0.9943 200 336
AF-A0A0D5BJU0-F1-model_v4 deleted 0.9928 102 337
AF-A0A0D0P2T2-F1-model_v4 Lipase 0.9908 25 337 GO:0016787
AF-A0A136QGY0-F1-model_v4 deleted 0.9908 155 335

Feature Viewer

pLDDT pTM Quality
91.7 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map