F445671

General Info

Members Datasets Scaffolds Average Seq Length
446 256 417 285

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100004166|Ga0070697_10000416613
Length 322
Sequence MTQHSHQTAPTQFVEANGIRFAYRRFGKTPDFDPNLFLDGIDPQYQAELNGSIGGVPLVFNQHFTGTMDHWDPAVTDGLAKDREVILFDNAGISSSSGEVPTTFEEMGANAIAFIKALGLKRVDLLGFSIGGFVAQEITLQAPKLVRRLVLVGTGPRGGQNMATLTPEAQQIFGATYKVPEELWLKVHFTDSEASQAAGREFLKRFLRRTENRDPEVNEKVAPAQIEAIGKWGVQREGSGEGSYGYLKTIKQPTLVVNGDNDVIIYSINSWILQQNIPNAQLIIYPDASHGSQYQYPERFVRHVSDFAAAPAIFESTEQSGS

Samples

Sample ID Description Type Environment
1 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
2 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2511231015 Pseudomonas sp. GM49 Isolate Nodule
4 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
5 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
6 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
7 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
8 2818991444 Filimonas endophytica 3197 Isolate Unclassified
9 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
10 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
11 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
12 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
13 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
14 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
15 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
16 2919404418 Luteibacter sp. 3190 Isolate Unclassified
17 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
18 2928037797 Variovorax sp. 1126 Isolate Unclassified
19 2928044640 Variovorax sp. 1128 Isolate Unclassified
20 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
21 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
22 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
30 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
31 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
32 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
99 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
161 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
162 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
231 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
244 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
245 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
246 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
247 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
248 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
249 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
251 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
254 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
255 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
256 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.5
Metatranscriptomes 0.22
Isolates 6.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.85
Nodule 2.02
Rhizoplane 3.14
Rhizosphere 75.78
Stem 0
Stem Tuber 0
Unclassified 11.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000295 3300002705 Bacteria 33633
2 JGI25156J39149_1001000 3300002705 Bacteria 13330
3 JGI25165J46597_1001890 3300003214 Bacteria 8455
4 rootH1_10097004 3300003316 Bacteria 1501
5 rootH2_10049941 3300003320 Bacteria 8709
6 rootH2_10159984 3300003320 Bacteria 3142
7 rootL2_10125244 3300003322 Bacteria 9830
8 rootH1_10101817 3300003323 Bacteria 2677
9 rootH1_10133041 3300003323 Bacteria 10864
10 rootH1_10183558 3300003323 Bacteria 2586
11 JGI25160J50197_1000208 3300003354 Bacteria 48426
12 Ga0055533_1000095 3300003756 Bacteria 114060
13 Ga0055532_1000010 3300003758 Bacteria 392055
14 Ga0055532_1000254 3300003758 Bacteria 36666
15 Ga0055527_1000008 3300003760 Bacteria 392055
16 Ga0055535_1000007 3300003761 Bacteria 392055
17 Ga0055542_1000011 3300003762 Bacteria 392055
18 Ga0055529_1000009 3300003763 Bacteria 392055
19 Ga0065165_1000119 3300005262 Bacteria 134464
20 Ga0065704_10025481 3300005289 Bacteria 1182
21 Ga0065704_10194441 3300005289 Bacteria 1174
22 Ga0068868_100449181 3300005338 Bacteria 1121
23 Ga0070661_100236917 3300005344 Bacteria 1404
24 Ga0070668_100000214 3300005347 Bacteria 37668
25 Ga0070668_100148575 3300005347 Bacteria 1893
26 Ga0070675_100106735 3300005354 Bacteria 2364
27 Ga0070675_100377323 3300005354 Bacteria 1261
28 Ga0070674_100209435 3300005356 Bacteria 1510
29 Ga0070667_100620870 3300005367 Bacteria 997
30 Ga0070703_10015819 3300005406 Bacteria 2161
31 Ga0070714_100468203 3300005435 Bacteria 1199
32 Ga0070713_100016740 3300005436 Bacteria 5520
33 Ga0070710_10097381 3300005437 Bacteria 1745
34 Ga0070711_100055892 3300005439 Bacteria 2728
35 Ga0070711_100334830 3300005439 Bacteria 1213
36 Ga0070708_100059309 3300005445 Bacteria 3412
37 Ga0070708_100068258 3300005445 Bacteria 3195
38 Ga0070708_100122166 3300005445 Bacteria 2403
39 Ga0070708_100153633 3300005445 Bacteria 2141
40 Ga0070708_100182581 3300005445 Bacteria 1961
41 Ga0070663_100242703 3300005455 Bacteria 1423
42 Ga0070678_100183973 3300005456 Bacteria 1713
43 Ga0070706_100042357 3300005467 Bacteria 4206
44 Ga0070706_100063198 3300005467 Bacteria 3421
45 Ga0070706_100125477 3300005467 Bacteria 2393
46 Ga0070707_100080333 3300005468 Bacteria 3147
47 Ga0070707_100573581 3300005468 Bacteria 1091
48 Ga0070707_100775356 3300005468 Bacteria 922
49 Ga0070698_100096179 3300005471 Bacteria 2938
50 Ga0070698_100523879 3300005471 Bacteria 1124
51 Ga0070699_100038630 3300005518 Bacteria 4133
52 Ga0070699_100085777 3300005518 Bacteria 2747
53 Ga0070697_100004166 3300005536 Bacteria 11077
54 Ga0070697_100077083 3300005536 Bacteria 2742
55 Ga0070697_100258485 3300005536 Bacteria 1490
56 Ga0070697_100434790 3300005536 Bacteria 1141
57 Ga0070665_100178580 3300005548 Bacteria 2124
58 Ga0070704_100101758 3300005549 Bacteria 2166
59 Ga0068852_100487354 3300005616 Bacteria 1226
60 Ga0068864_100545833 3300005618 Bacteria 1120
61 Ga0068851_10027294 3300005834 Bacteria 2813
62 Ga0068863_100060278 3300005841 Bacteria 3589
63 Ga0068860_100000019 3300005843 Bacteria 299860
64 Ga0068860_100000458 3300005843 Bacteria 51184
65 Ga0068862_100325729 3300005844 Bacteria 1419
66 Ga0070717_10139332 3300006028 Bacteria 2091
67 Ga0070717_10156530 3300006028 Bacteria 1974
68 Ga0075365_10029914 3300006038 Bacteria 3484
69 Ga0070716_100074717 3300006173 Bacteria 2003
70 Ga0070716_100142153 3300006173 Bacteria 1532
71 Ga0070712_100001682 3300006175 Bacteria 13536
72 Ga0070712_100043812 3300006175 Bacteria 3082
73 Ga0068871_100014326 3300006358 Bacteria 5908
74 Ga0068871_100250778 3300006358 Bacteria 1542
75 Ga0075428_100049896 3300006844 Bacteria 4591
76 Ga0075428_100057837 3300006844 Bacteria 4244
77 Ga0075428_100565928 3300006844 Bacteria 1215
78 Ga0075430_100187366 3300006846 Bacteria 1720
79 Ga0075431_100052464 3300006847 Bacteria 4206
80 Ga0075431_100167791 3300006847 Bacteria 2256
81 Ga0075433_10021593 3300006852 Bacteria 5399
82 Ga0075433_10178630 3300006852 Bacteria 1889
83 Ga0075434_100068985 3300006871 Bacteria 3524
84 Ga0075434_100087950 3300006871 Bacteria 3108
85 Ga0075434_100113262 3300006871 Bacteria 2725
86 Ga0075434_100480508 3300006871 Bacteria 1263
87 Ga0075434_100688990 3300006871 Bacteria 1040
88 Ga0075436_100048207 3300006914 Bacteria 2939
89 Ga0075436_100157576 3300006914 Bacteria 1600
90 Ga0075435_100114912 3300007076 Bacteria 2241
91 Ga0075435_100284653 3300007076 Bacteria 1411
92 Ga0075435_100379115 3300007076 Bacteria 1215
93 Ga0075435_100415802 3300007076 Bacteria 1158
94 Ga0075435_100532574 3300007076 Bacteria 1016
95 Ga0099794_10001943 3300007265 Bacteria 7443
96 Ga0099794_10005352 3300007265 Bacteria 5138
97 Ga0099794_10016812 3300007265 Bacteria 3250
98 Ga0099794_10043256 3300007265 Bacteria 2149
99 Ga0099794_10048316 3300007265 Bacteria 2042
100 Ga0099794_10080991 3300007265 Bacteria 1601
101 Ga0099794_10085795 3300007265 Bacteria 1558
102 Ga0099794_10101922 3300007265 Bacteria 1433
103 Ga0099794_10124302 3300007265 Bacteria 1300
104 Ga0099795_10003046 3300007788 Bacteria 4086
105 Ga0099795_10014412 3300007788 Bacteria 2451
106 Ga0099795_10049921 3300007788 Bacteria 1520
107 Ga0099795_10050217 3300007788 Bacteria 1516
108 Ga0099795_10056118 3300007788 Bacteria 1448
109 Ga0105251_10001427 3300009011 Bacteria 20595
110 Ga0105251_10089530 3300009011 Bacteria 1415
111 Ga0105240_10039922 3300009093 Bacteria 6007
112 Ga0111539_10489313 3300009094 Bacteria 1433
113 Ga0111539_10723361 3300009094 Bacteria 1159
114 Ga0111539_10918518 3300009094 Bacteria 1018
115 Ga0105245_10203752 3300009098 Bacteria 1901
116 Ga0105245_10647589 3300009098 Bacteria 1087
117 Ga0114129_10056121 3300009147 Bacteria 5518
118 Ga0114129_10167612 3300009147 Bacteria 2996
119 Ga0114129_10331987 3300009147 Bacteria 2019
120 Ga0105243_10585337 3300009148 Bacteria 1072
121 Ga0105242_10073089 3300009176 Bacteria 2850
122 Ga0105248_10010338 3300009177 Bacteria 10271
123 Ga0105248_10593054 3300009177 Bacteria 1250
124 Ga0105248_10618087 3300009177 Bacteria 1222
125 Ga0105237_10003419 3300009545 Bacteria 18876
126 Ga0105237_10404501 3300009545 Bacteria 1370
127 Ga0105238_10377481 3300009551 Bacteria 1409
128 Ga0099796_10010075 3300010159 Bacteria 2584
129 Ga0099796_10054209 3300010159 Bacteria 1401
130 Ga0105239_10248539 3300010375 Bacteria 1998
131 Ga0157378_10070885 3300013297 Bacteria 3129
132 Ga0157378_10258693 3300013297 Bacteria 1669
133 Ga0157378_10281431 3300013297 Bacteria 1603
134 Ga0163162_10019574 3300013306 Bacteria 6644
135 Ga0163162_10343878 3300013306 Bacteria 1624
136 Ga0163162_10732429 3300013306 Bacteria 1109
137 Ga0157375_10616943 3300013308 Bacteria 1243
138 Ga0157380_10314250 3300014326 Bacteria 1449
139 Ga0157379_10102287 3300014968 Bacteria 2572
140 Ga0157376_10030855 3300014969 Bacteria 4285
141 Ga0163161_10124434 3300017792 Bacteria 1940
142 Ga0213872_10000910 3300021361 Bacteria 21167
143 Ga0213872_10016823 3300021361 Bacteria 3389
144 Ga0213872_10025288 3300021361 Bacteria 2730
145 Ga0213872_10027117 3300021361 Bacteria 2630
146 Ga0213872_10064005 3300021361 Bacteria 1661
147 Ga0213872_10065409 3300021361 Bacteria 1641
148 Ga0213872_10077216 3300021361 Bacteria 1497
149 Ga0228598_1006416 3300024227 Bacteria 2435
150 Ga0209674_100022 3300025226 Bacteria 563656
151 Ga0209672_100001 3300025228 Bacteria 2828210
152 Ga0209147_100001 3300025229 Bacteria 2384371
153 Ga0209147_100021 3300025229 Bacteria 464719
154 Ga0209563_102365 3300025230 Bacteria 4307
155 Ga0207427_101741 3300025231 Bacteria 7122
156 Ga0209258_100001 3300025242 Bacteria 2384269
157 Ga0209148_1000003 3300025254 Bacteria 2384288
158 Ga0209759_1000082 3300025256 Bacteria 169562
159 Ga0209759_1000097 3300025256 Bacteria 157627
160 Ga0209759_1000101 3300025256 Bacteria 155034
161 Ga0209233_1000061 3300025261 Bacteria 406211
162 Ga0209455_1000001 3300025272 Bacteria 2384278
163 Ga0209564_1019243 3300025295 Bacteria 2562
164 Ga0207426_1000215 3300025302 Bacteria 136757
165 Ga0207656_10017113 3300025321 Bacteria 2835
166 Ga0207655_1007094 3300025728 Bacteria 7320
167 Ga0207713_1024092 3300025735 Bacteria 2846
168 Ga0207653_10077582 3300025885 Bacteria 1145
169 Ga0207642_10065820 3300025899 Bacteria 1704
170 Ga0207685_10021413 3300025905 Bacteria 2166
171 Ga0207685_10082881 3300025905 Bacteria 1332
172 Ga0207645_10090926 3300025907 Bacteria 1963
173 Ga0207684_10018295 3300025910 Bacteria 5997
174 Ga0207684_10239207 3300025910 Bacteria 1566
175 Ga0207695_10011702 3300025913 Bacteria 10602
176 Ga0207695_10095531 3300025913 Bacteria 2976
177 Ga0207695_10374541 3300025913 Bacteria 1310
178 Ga0207671_10003470 3300025914 Bacteria 15686
179 Ga0207693_10001311 3300025915 Bacteria 22068
180 Ga0207693_10011178 3300025915 Bacteria 7268
181 Ga0207693_10028001 3300025915 Bacteria 4454
182 Ga0207693_10053864 3300025915 Bacteria 3157
183 Ga0207693_10090378 3300025915 Bacteria 2400
184 Ga0207693_10277744 3300025915 Bacteria 1313
185 Ga0207646_10010524 3300025922 Bacteria 9027
186 Ga0207646_10012321 3300025922 Bacteria 8223
187 Ga0207646_10165865 3300025922 Bacteria 1994
188 Ga0207646_10234687 3300025922 Bacteria 1657
189 Ga0207659_10082451 3300025926 Bacteria 2381
190 Ga0207664_10088963 3300025929 Bacteria 2528
191 Ga0207664_10198214 3300025929 Bacteria 1732
192 Ga0207706_10034210 3300025933 Bacteria 4521
193 Ga0207669_10188931 3300025937 Bacteria 1484
194 Ga0207665_10016434 3300025939 Bacteria 4858
195 Ga0207665_10032366 3300025939 Bacteria 3462
196 Ga0207665_10045460 3300025939 Bacteria 2940
197 Ga0207665_10046474 3300025939 Bacteria 2908
198 Ga0207665_10262967 3300025939 Bacteria 1279
199 Ga0207711_10024147 3300025941 Bacteria 5088
200 Ga0207711_10328457 3300025941 Bacteria 1414
201 Ga0207689_10094808 3300025942 Bacteria 2451
202 Ga0207689_10151659 3300025942 Bacteria 1910
203 Ga0207668_10000257 3300025972 Bacteria 35322
204 Ga0207668_10129538 3300025972 Bacteria 1924
205 Ga0207703_10207624 3300026035 Bacteria 1744
206 Ga0207678_10417730 3300026067 Bacteria 1163
207 Ga0207708_10130491 3300026075 Bacteria 1964
208 Ga0207641_10283823 3300026088 Bacteria 1558
209 Ga0207674_10334616 3300026116 Bacteria 1464
210 Ga0209179_1007505 3300027512 Bacteria 1804
211 Ga0209179_1024042 3300027512 Bacteria 1207
212 Ga0209588_1000435 3300027671 Bacteria 10726
213 Ga0209588_1011393 3300027671 Bacteria 2685
214 Ga0209588_1011749 3300027671 Bacteria 2650
215 Ga0209588_1012749 3300027671 Bacteria 2556
216 Ga0209588_1017679 3300027671 Bacteria 2212
217 Ga0209588_1028252 3300027671 Bacteria 1785
218 Ga0209588_1044358 3300027671 Bacteria 1438
219 Ga0209588_1048312 3300027671 Bacteria 1377
220 Ga0207428_10041871 3300027907 Bacteria 3706
221 Ga0268265_10071394 3300028380 Bacteria 2704
222 Ga0268264_10000642 3300028381 Bacteria 41302
223 Ga0307517_10132139 3300028786 Bacteria 1792
224 Ga0307515_10052334 3300028794 Bacteria 6058
225 Ga0265760_10088276 3300031090 Bacteria 968
226 Ga0265327_10000776 3300031251 Bacteria 49288
227 Ga0265327_10006581 3300031251 Bacteria 9235
228 Ga0307513_10148199 3300031456 Unclassified 2261
229 Ga0307408_100002870 3300031548 Bacteria 11937
230 Ga0265314_10024135 3300031711 Bacteria 4618
231 Ga0307510_10008632 3300033180 Bacteria 12144
232 Ga0373948_0008171 3300034817 Bacteria 1777
233 Ga0373951_0025395 3300035091 Bacteria 1376
234 Ga0373952_0004250 3300035092 Bacteria 2590
235 Ga0373939_0018537 3300035114 Bacteria 1866
236 Ga0373943_0137827 3300035170 Bacteria 1312
237 Ga0373931_0003658 3300035691 Bacteria 6951
238 Ga0373935_0258187 3300035692 Bacteria 1221
239 Ga0373927_0027052 3300035695 Bacteria 3748
240 Ga0373927_0301442 3300035695 Bacteria 1054
241 Ga0373947_0021113 3300035725 Bacteria 3767
242 Ga0373925_0376529 3300037068 Bacteria 1155
243 Ga0436361_0020532 3300039447 Bacteria 44080
244 Ga0436361_0029438 3300039447 Bacteria 10221
245 Ga0436361_0093516 3300039447 Bacteria 1420
246 Ga0436361_0296376 3300039447 Bacteria 2655
247 Ga0436361_0298003 3300039447 Bacteria 15847
248 Ga0436361_0326225 3300039447 Bacteria 5067
249 Ga0436361_0530782 3300039447 Bacteria 6456
250 Ga0436361_0545213 3300039447 Bacteria 2122
251 Ga0436361_1062103 3300039447 Bacteria 1800
252 Ga0436361_1109977 3300039447 Bacteria 2514
253 Ga0453683_0023760 3300044673 Bacteria 3905
254 Ga0495617_001570 3300046452 Bacteria 9879
255 Ga0495590_0014308 3300046457 Bacteria 2897
256 Ga0495590_0066287 3300046457 Bacteria 1264
257 Ga0495653_0005512 3300046463 Bacteria 10308
258 Ga0495653_0239578 3300046463 Bacteria 1210
259 Ga0495580_0008442 3300046472 Bacteria 8194
260 Ga0495580_0397401 3300046472 Bacteria 930
261 Ga0495605_0013923 3300046474 Unclassified 4418
262 Ga0495605_0026565 3300046474 Bacteria 3008
263 Ga0495605_0029885 3300046474 Bacteria 2798
264 Ga0495584_0053808 3300046491 Bacteria 2026
265 Ga0495585_0001103 3300046492 Bacteria 22231
266 Ga0495607_0019132 3300046501 Bacteria 4354
267 Ga0495583_0000005 3300046506 Bacteria 636894
268 Ga0495583_0004547 3300046506 Bacteria 9865
269 Ga0495583_0015927 3300046506 Bacteria 4065
270 Ga0495583_0058514 3300046506 Bacteria 1730
271 Ga0495606_0000409 3300046507 Bacteria 72543
272 Ga0495606_0001267 3300046507 Bacteria 35115
273 Ga0495606_0039628 3300046507 Bacteria 3172
274 Ga0495616_0007389 3300046513 Bacteria 6573
275 Ga0495616_0025680 3300046513 Bacteria 3144
276 Ga0495630_0001745 3300046517 Bacteria 15181
277 Ga0495631_0006184 3300046518 Bacteria 6202
278 Ga0495631_0091429 3300046518 Bacteria 1310
279 Ga0495632_0134241 3300046519 Bacteria 1150
280 Ga0495648_0008962 3300046524 Bacteria 7815
281 Ga0495648_0029200 3300046524 Bacteria 3663
282 Ga0495648_0171423 3300046524 Bacteria 1112
283 Ga0495666_0093396 3300046526 Bacteria 1419
284 Ga0495642_0000614 3300046528 Bacteria 17935
285 Ga0495642_0008131 3300046528 Bacteria 4015
286 Ga0495642_0098658 3300046528 Bacteria 1242
287 Ga0495652_0002141 3300046529 Bacteria 20814
288 Ga0495654_0045078 3300046530 Bacteria 2177
289 Ga0495665_0000898 3300046531 Bacteria 15647
290 Ga0495586_0190252 3300046535 Bacteria 1162
291 Ga0495587_0038295 3300046536 Bacteria 2876
292 Ga0495609_0000318 3300046538 Bacteria 43149
293 Ga0495656_0086446 3300046615 Bacteria 1426
294 Ga0495668_0001366 3300046616 Bacteria 23914
295 Ga0495668_0010239 3300046616 Bacteria 5691
296 Ga0495668_0204619 3300046616 Bacteria 1081
297 Ga0495668_0261011 3300046616 Bacteria 948
298 Ga0495634_0208210 3300046642 Bacteria 1212
299 Ga0495611_0018915 3300046648 Bacteria 2956
300 Ga0495611_0044257 3300046648 Bacteria 1991
301 Ga0495625_0012262 3300046660 Bacteria 6951
302 Ga0495625_0033148 3300046660 Bacteria 3822
303 Ga0495625_0188136 3300046660 Bacteria 1369
304 Ga0495635_0005151 3300046663 Bacteria 9103
305 Ga0495635_0411962 3300046663 Unclassified 897
306 Ga0495659_0004339 3300046664 Bacteria 4463
307 Ga0495657_0191191 3300046675 Bacteria 1251
308 Ga0495599_0070701 3300046678 Bacteria 2178
309 Ga0495623_0000953 3300046679 Bacteria 19514
310 Ga0495646_0002066 3300046680 Bacteria 12176
311 Ga0495669_0004781 3300046684 Bacteria 5619
312 Ga0495624_0000522 3300046690 Bacteria 30099
313 Ga0495670_0009718 3300046691 Bacteria 4727
314 Ga0495670_0127312 3300046691 Bacteria 1326
315 Ga0495671_0006501 3300046692 Bacteria 6747
316 Ga0495671_0147212 3300046692 Bacteria 1147
317 Ga0495649_0022581 3300046694 Bacteria 3520
318 Ga0495600_0136658 3300046809 Bacteria 1592
319 Ga0495660_0001339 3300046810 Bacteria 16963
320 Ga0495604_0012060 3300047317 Bacteria 6872
321 Ga0495604_0028118 3300047317 Bacteria 4473
322 Ga0495604_0033951 3300047317 Bacteria 4036
323 Ga0495636_0120165 3300047318 Bacteria 1162
324 Ga0495674_0011202 3300047319 Bacteria 8468
325 Ga0495672_0003345 3300047320 Bacteria 13817
326 Ga0495672_0015871 3300047320 Bacteria 5099
327 Ga0495672_0030565 3300047320 Bacteria 3376
328 Ga0495680_0001635 3300047322 Bacteria 23829
329 Ga0495680_0106434 3300047322 Bacteria 2084
330 Ga0495683_0064869 3300047323 Bacteria 1802
331 Ga0495687_005564 3300047443 Bacteria 7985
332 Ga0495675_0032387 3300047444 Bacteria 3336
333 Ga0495677_0010421 3300047445 Bacteria 3414
334 Ga0495677_0012891 3300047445 Bacteria 3044
335 Ga0495673_0005404 3300047469 Bacteria 7733
336 Ga0495673_0005808 3300047469 Bacteria 7382
337 Ga0495673_0006862 3300047469 Bacteria 6636
338 Ga0495673_0032792 3300047469 Unclassified 2417
339 Ga0495686_0000162 3300047472 Bacteria 126699
340 Ga0495602_0002334 3300048088 Bacteria 19195
341 Ga0495602_0204368 3300048088 Bacteria 1504
342 Ga0495626_0009005 3300048091 Bacteria 5412
343 Ga0495626_0027316 3300048091 Bacteria 2776
344 Ga0496100_0107512 3300048903 Bacteria 1932
345 Ga0496100_0283604 3300048903 Bacteria 1235
346 Ga0496101_0341169 3300048904 Bacteria 1177
347 Ga0496102_0001539 3300048905 Bacteria 20355
348 Ga0496103_0000371 3300048906 Bacteria 40307
349 Ga0496104_0023369 3300048907 Bacteria 5683
350 Ga0496105_0088836 3300048908 Bacteria 2553
351 Ga0496105_0210044 3300048908 Bacteria 1587
352 Ga0496106_0204756 3300048909 Bacteria 1571
353 Ga0496106_0333554 3300048909 Bacteria 1218
354 Ga0496106_0333803 3300048909 Bacteria 1217
355 Ga0496110_0446428 3300048913 Bacteria 1179
356 Ga0496112_0108823 3300048915 Bacteria 2742
357 Ga0496112_0115704 3300048915 Bacteria 2652
358 Ga0496117_0002705 3300048920 Bacteria 21898
359 Ga0496117_0006550 3300048920 Bacteria 11723
360 Ga0496117_0142734 3300048920 Bacteria 1431
361 Ga0496118_0000698 3300048921 Bacteria 54435
362 Ga0496118_0004083 3300048921 Bacteria 17705
363 Ga0496121_0000021 3300048924 Bacteria 478544
364 Ga0496121_0001198 3300048924 Bacteria 45422
365 Ga0496121_0001778 3300048924 Bacteria 34958
366 Ga0496121_0003399 3300048924 Bacteria 22766
367 Ga0496121_0010421 3300048924 Bacteria 10487
368 Ga0496122_0039884 3300048925 Bacteria 3739
369 Ga0496124_0108698 3300048927 Bacteria 2236
370 Ga0496124_0205114 3300048927 Bacteria 1496
371 Ga0496126_0001141 3300048929 Bacteria 44182
372 Ga0496126_0001647 3300048929 Bacteria 33697
373 Ga0496126_0001679 3300048929 Bacteria 33125
374 Ga0496126_0134723 3300048929 Bacteria 2132
375 Ga0496126_0448109 3300048929 Bacteria 1039
376 Ga0495678_023494 3300049459 Bacteria 2678
377 Ga0495682_0002622 3300049460 Bacteria 8418
378 Ga0495682_0003355 3300049460 Bacteria 7146
379 Ga0495682_0044301 3300049460 Bacteria 1628
380 Ga0501067_0077564 3300049583 Bacteria 1841
381 nmdc:mga0yw44_20130_c1 3300050492 Bacteria 3697
382 nmdc:mga05p37_1017_c1 3300050507 Bacteria 31916
383 nmdc:mga05p37_156898_c1 3300050507 Bacteria 2781
384 nmdc:mga05p37_21325_c1 3300050507 Bacteria 7843
385 nmdc:mga05p37_324324_c1 3300050507 Bacteria 1822
386 nmdc:mga05p37_392247_c1 3300050507 Bacteria 1623
387 nmdc:mga05p37_552074_c1 3300050507 Bacteria 1311
388 nmdc:mga05p37_84292_c1 3300050507 Bacteria 3916
389 nmdc:mga09592_371540_c1 3300050508 Bacteria 1237
390 nmdc:mga0qj67_3704_c1 3300050509 Bacteria 11031
391 nmdc:mga0qj67_432656_c1 3300050509 Bacteria 1061
392 nmdc:mga06r32_1053_c1 3300050510 Bacteria 24905
393 nmdc:mga06r32_324276_c1 3300050510 Bacteria 1525
394 nmdc:mga08y16_220852_c1 3300050511 Bacteria 1962
395 nmdc:mga08y16_741355_c1 3300050511 Bacteria 979
396 nmdc:mga08y16_76079_c1 3300050511 Bacteria 3499
397 nmdc:mga0n895_287843_c1 3300050512 Bacteria 1666
398 nmdc:mga0n895_339909_c1 3300050512 Bacteria 1520
399 nmdc:mga0n895_86991_c1 3300050512 Bacteria 3122
400 nmdc:mga0rr50_154904_c1 3300050513 Bacteria 1855
401 nmdc:mga0rr50_93557_c1 3300050513 Bacteria 2345
402 nmdc:mga08x19_230131_c1 3300050514 Bacteria 1276
403 nmdc:mga0a205_122358_c1 3300050515 Bacteria 2502
404 nmdc:mga0a205_39090_c1 3300050515 Bacteria 4566
405 nmdc:mga0a205_65414_c1 3300050515 Bacteria 3513
406 nmdc:mga0a205_77225_c1 3300050515 Bacteria 3218
407 Ga0500610_0091567 3300053079 Unclassified 1579
408 Ga0500578_0091681 3300053086 Bacteria 1928
409 Ga0500644_0018688 3300053088 Bacteria 2035
410 Ga0500583_0005010 3300053092 Unclassified 4390
411 Ga0500651_0071350 3300053093 Bacteria 2161
412 Ga0500557_057401 3300053105 Bacteria 1259
413 Ga0500618_000306 3300053125 Bacteria 36367
414 Ga0500658_0010993 3300053134 Bacteria 3337
415 Ga0500577_0100824 3300053142 Bacteria 1180
416 Ga0500645_001535 3300053730 Bacteria 11537
417 Ga0500645_001875 3300053730 Bacteria 10051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046663 Ga0495635_0411962 Ga0495635_0411962_11_733 235
2 3300048904 Ga0496101_0341169 Ga0496101_0341169_152_886 235
3 3300048909 Ga0496106_0204756 Ga0496106_0204756_396_1130 235
4 3300035695 Ga0373927_0027052 Ga0373927_0027052_2546_3304 247
5 3300039447 Ga0436361_0093516 Ga0436361_0093516_658_1401 247
6 3300005467 Ga0070706_100125477 Ga0070706_1001254772 268
7 3300005471 Ga0070698_100096179 Ga0070698_1000961793 268
8 3300009545 Ga0105237_10404501 Ga0105237_104045011 273
9 3300035695 Ga0373927_0301442 Ga0373927_0301442_19_879 273
10 3300035725 Ga0373947_0021113 Ga0373947_0021113_11_871 273
11 iso_pu_bacteria 2501025504 2501407788 273
12 iso_pu_bacteria 2510917014 2511097665 273
13 iso_pu_bacteria 2513237082 2513558199 273
14 iso_pu_bacteria 2513237098 2513671844 273
15 iso_pu_bacteria 2852387548 2852390642 273
16 iso_pu_bacteria 2883087390 2883091765 273
17 iso_pu_bacteria 2909399089 2909399565 273
18 iso_pu_bacteria 2919404418 2919406403 273
19 iso_pu_bacteria 8046767195 8046768989 273
20 iso_pu_bacteria 8057575449 8057582469 273
21 3300009011 Ga0105251_10089530 Ga0105251_100895301 274
22 iso_pu_bacteria 2501025504 2501407804 274
23 iso_pu_bacteria 2510917014 2511097680 274
24 iso_pu_bacteria 2511231015 2511322330 274
25 iso_pu_bacteria 2562617112 2563065062 274
26 iso_pu_bacteria 2711768613 2713481950 274
27 iso_pu_bacteria 2842324504 2842326980 274
28 iso_pu_bacteria 2842348783 2842350585 274
29 iso_pu_bacteria 2885270888 2885272700 274
30 iso_pu_bacteria 2904483920 2904485506 274
31 iso_pu_bacteria 2921643360 2921645194 274
32 iso_pu_bacteria 2928037797 2928043144 274
33 iso_pu_bacteria 2928044640 2928050197 274
34 iso_pu_bacteria 2928064002 2928070600 274
35 iso_pu_bacteria 2937822353 2937827978 274
36 iso_pu_bacteria 642555113 642617684 274
37 iso_pu_bacteria 8055301274 8055304903 274
38 3300021361 Ga0213872_10025288 Ga0213872_100252883 275
39 3300039447 Ga0436361_0298003 Ga0436361_0298003_1693_2592 275
40 3300046675 Ga0495657_0191191 Ga0495657_0191191_104_946 275
41 3300047317 Ga0495604_0033951 Ga0495604_0033951_1903_2745 275
42 iso_pu_bacteria 2818991444 2819587225 275
43 3300005437 Ga0070710_10097381 Ga0070710_100973811 276
44 3300006914 Ga0075436_100048207 Ga0075436_1000482074 276
45 3300009098 Ga0105245_10203752 Ga0105245_102037522 276
46 3300025939 Ga0207665_10045460 Ga0207665_100454603 276
47 3300005344 Ga0070661_100236917 Ga0070661_1002369172 277
48 3300005347 Ga0070668_100000214 Ga0070668_10000021425 277
49 3300005356 Ga0070674_100209435 Ga0070674_1002094352 277
50 3300005468 Ga0070707_100080333 Ga0070707_1000803334 277
51 3300005468 Ga0070707_100573581 Ga0070707_1005735811 277
52 3300006038 Ga0075365_10029914 Ga0075365_100299143 277
53 3300006175 Ga0070712_100001682 Ga0070712_1000016823 277
54 3300006358 Ga0068871_100250778 Ga0068871_1002507782 277
55 3300006844 Ga0075428_100049896 Ga0075428_1000498964 277
56 3300006844 Ga0075428_100565928 Ga0075428_1005659281 277
57 3300006846 Ga0075430_100187366 Ga0075430_1001873662 277
58 3300006847 Ga0075431_100167791 Ga0075431_1001677912 277
59 3300006852 Ga0075433_10021593 Ga0075433_100215936 277
60 3300006852 Ga0075433_10178630 Ga0075433_101786301 277
61 3300006871 Ga0075434_100113262 Ga0075434_1001132623 277
62 3300006871 Ga0075434_100688990 Ga0075434_1006889901 277
63 3300007076 Ga0075435_100532574 Ga0075435_1005325741 277
64 3300007265 Ga0099794_10085795 Ga0099794_100857952 277
65 3300007788 Ga0099795_10014412 Ga0099795_100144123 277
66 3300007788 Ga0099795_10050217 Ga0099795_100502172 277
67 3300009011 Ga0105251_10001427 Ga0105251_100014272 277
68 3300009093 Ga0105240_10039922 Ga0105240_100399222 277
69 3300009094 Ga0111539_10723361 Ga0111539_107233611 277
70 3300009094 Ga0111539_10918518 Ga0111539_109185182 277
71 3300009147 Ga0114129_10056121 Ga0114129_100561214 277
72 3300009147 Ga0114129_10331987 Ga0114129_103319872 277
73 3300009176 Ga0105242_10073089 Ga0105242_100730893 277
74 3300009177 Ga0105248_10010338 Ga0105248_1001033810 277
75 3300009545 Ga0105237_10003419 Ga0105237_1000341912 277
76 3300021361 Ga0213872_10000910 Ga0213872_100009105 277
77 3300021361 Ga0213872_10027117 Ga0213872_100271172 277
78 3300021361 Ga0213872_10064005 Ga0213872_100640052 277
79 3300021361 Ga0213872_10065409 Ga0213872_100654092 277
80 3300021361 Ga0213872_10077216 Ga0213872_100772162 277
81 3300024227 Ga0228598_1006416 Ga0228598_10064162 277
82 3300025735 Ga0207713_1024092 Ga0207713_10240922 277
83 3300025910 Ga0207684_10018295 Ga0207684_100182954 277
84 3300025913 Ga0207695_10095531 Ga0207695_100955313 277
85 3300025914 Ga0207671_10003470 Ga0207671_100034707 277
86 3300025915 Ga0207693_10001311 Ga0207693_1000131119 277
87 3300025922 Ga0207646_10012321 Ga0207646_100123215 277
88 3300025937 Ga0207669_10188931 Ga0207669_101889311 277
89 3300025939 Ga0207665_10046474 Ga0207665_100464743 277
90 3300025941 Ga0207711_10024147 Ga0207711_100241473 277
91 3300025972 Ga0207668_10000257 Ga0207668_100002577 277
92 3300027512 Ga0209179_1024042 Ga0209179_10240422 277
93 3300027907 Ga0207428_10041871 Ga0207428_100418711 277
94 3300031251 Ga0265327_10000776 Ga0265327_1000077612 277
95 3300031251 Ga0265327_10006581 Ga0265327_100065818 277
96 3300034817 Ga0373948_0008171 Ga0373948_0008171_383_1228 277
97 3300035091 Ga0373951_0025395 Ga0373951_0025395_365_1210 277
98 3300035092 Ga0373952_0004250 Ga0373952_0004250_52_897 277
99 3300035691 Ga0373931_0003658 Ga0373931_0003658_3441_4286 277
100 3300039447 Ga0436361_0020532 Ga0436361_0020532_5404_6237 277
101 3300039447 Ga0436361_0029438 Ga0436361_0029438_9078_9911 277
102 3300039447 Ga0436361_0296376 Ga0436361_0296376_287_1120 277
103 3300039447 Ga0436361_0545213 Ga0436361_0545213_938_1771 277
104 3300039447 Ga0436361_1062103 Ga0436361_1062103_443_1276 277
105 3300039447 Ga0436361_1109977 Ga0436361_1109977_248_1081 277
106 3300046472 Ga0495580_0397401 Ga0495580_0397401_53_901 277
107 3300046474 Ga0495605_0013923 Ga0495605_0013923_2491_3336 277
108 3300046506 Ga0495583_0058514 Ga0495583_0058514_825_1670 277
109 3300046518 Ga0495631_0006184 Ga0495631_0006184_144_989 277
110 3300046536 Ga0495587_0038295 Ga0495587_0038295_1764_2612 277
111 3300046642 Ga0495634_0208210 Ga0495634_0208210_65_913 277
112 3300046660 Ga0495625_0012262 Ga0495625_0012262_1983_2828 277
113 3300046691 Ga0495670_0127312 Ga0495670_0127312_376_1221 277
114 3300046692 Ga0495671_0147212 Ga0495671_0147212_248_1093 277
115 3300047318 Ga0495636_0120165 Ga0495636_0120165_180_1025 277
116 3300047469 Ga0495673_0032792 Ga0495673_0032792_1064_1915 277
117 3300047472 Ga0495686_0000162 Ga0495686_0000162_89272_90162 277
118 3300048924 Ga0496121_0000021 Ga0496121_0000021_65434_66270 277
119 3300049459 Ga0495678_023494 Ga0495678_023494_1705_2550 277
120 3300050492 nmdc:mga0yw44_20130_c1 nmdc:mga0yw44_20130_c1_1736_2581 277
121 3300050507 nmdc:mga05p37_552074_c1 nmdc:mga05p37_552074_c1_167_1030 277
122 3300050507 nmdc:mga05p37_84292_c1 nmdc:mga05p37_84292_c1_2815_3732 277
123 3300050509 nmdc:mga0qj67_3704_c1 nmdc:mga0qj67_3704_c1_6131_6994 277
124 3300050511 nmdc:mga08y16_741355_c1 nmdc:mga08y16_741355_c1_45_962 277
125 3300050512 nmdc:mga0n895_287843_c1 nmdc:mga0n895_287843_c1_70_915 277
126 3300050512 nmdc:mga0n895_339909_c1 nmdc:mga0n895_339909_c1_457_1302 277
127 3300050513 nmdc:mga0rr50_93557_c1 nmdc:mga0rr50_93557_c1_584_1432 277
128 3300050515 nmdc:mga0a205_122358_c1 nmdc:mga0a205_122358_c1_1222_2139 277
129 3300050515 nmdc:mga0a205_39090_c1 nmdc:mga0a205_39090_c1_3483_4328 277
130 3300053079 Ga0500610_0091567 Ga0500610_0091567_561_1406 277
131 3300053105 Ga0500557_057401 Ga0500557_057401_165_1010 277
132 3300053125 Ga0500618_000306 Ga0500618_000306_32529_33362 277
133 3300053142 Ga0500577_0100824 Ga0500577_0100824_151_996 277
134 3300053730 Ga0500645_001535 Ga0500645_001535_1710_2561 277
135 3300053730 Ga0500645_001875 Ga0500645_001875_5481_6350 277
136 3300002705 JGI25156J39149_1000295 JGI25156J39149_100029525 278
137 3300002705 JGI25156J39149_1001000 JGI25156J39149_10010006 278
138 3300003214 JGI25165J46597_1001890 JGI25165J46597_10018909 278
139 3300003316 rootH1_10097004 rootH1_100970042 278
140 3300003320 rootH2_10049941 rootH2_100499417 278
141 3300003320 rootH2_10159984 rootH2_101599842 278
142 3300003322 rootL2_10125244 rootL2_101252448 278
143 3300003323 rootH1_10101817 rootH1_101018174 278
144 3300003323 rootH1_10133041 rootH1_101330417 278
145 3300003323 rootH1_10183558 rootH1_101835582 278
146 3300003354 JGI25160J50197_1000208 JGI25160J50197_10002087 278
147 3300003756 Ga0055533_1000095 Ga0055533_100009558 278
148 3300003758 Ga0055532_1000010 Ga0055532_1000010104 278
149 3300003758 Ga0055532_1000254 Ga0055532_10002548 278
150 3300003760 Ga0055527_1000008 Ga0055527_1000008104 278
151 3300003761 Ga0055535_1000007 Ga0055535_1000007104 278
152 3300003762 Ga0055542_1000011 Ga0055542_1000011104 278
153 3300003763 Ga0055529_1000009 Ga0055529_1000009104 278
154 3300005262 Ga0065165_1000119 Ga0065165_10001194 278
155 3300005289 Ga0065704_10025481 Ga0065704_100254811 278
156 3300005289 Ga0065704_10194441 Ga0065704_101944412 278
157 3300005338 Ga0068868_100449181 Ga0068868_1004491812 278
158 3300005347 Ga0070668_100148575 Ga0070668_1001485752 278
159 3300005354 Ga0070675_100106735 Ga0070675_1001067353 278
160 3300005354 Ga0070675_100377323 Ga0070675_1003773232 278
161 3300005367 Ga0070667_100620870 Ga0070667_1006208701 278
162 3300005406 Ga0070703_10015819 Ga0070703_100158193 278
163 3300005435 Ga0070714_100468203 Ga0070714_1004682031 278
164 3300005436 Ga0070713_100016740 Ga0070713_1000167403 278
165 3300005439 Ga0070711_100055892 Ga0070711_1000558922 278
166 3300005439 Ga0070711_100334830 Ga0070711_1003348302 278
167 3300005445 Ga0070708_100059309 Ga0070708_1000593092 278
168 3300005445 Ga0070708_100068258 Ga0070708_1000682582 278
169 3300005445 Ga0070708_100122166 Ga0070708_1001221663 278
170 3300005445 Ga0070708_100153633 Ga0070708_1001536331 278
171 3300005445 Ga0070708_100182581 Ga0070708_1001825812 278
172 3300005455 Ga0070663_100242703 Ga0070663_1002427031 278
173 3300005456 Ga0070678_100183973 Ga0070678_1001839732 278
174 3300005467 Ga0070706_100042357 Ga0070706_1000423572 278
175 3300005467 Ga0070706_100063198 Ga0070706_1000631983 278
176 3300005468 Ga0070707_100775356 Ga0070707_1007753561 278
177 3300005471 Ga0070698_100523879 Ga0070698_1005238791 278
178 3300005518 Ga0070699_100038630 Ga0070699_1000386303 278
179 3300005518 Ga0070699_100085777 Ga0070699_1000857771 278
180 3300005536 Ga0070697_100004166 Ga0070697_10000416613 278
181 3300005536 Ga0070697_100077083 Ga0070697_1000770833 278
182 3300005536 Ga0070697_100258485 Ga0070697_1002584852 278
183 3300005536 Ga0070697_100434790 Ga0070697_1004347901 278
184 3300005548 Ga0070665_100178580 Ga0070665_1001785803 278
185 3300005549 Ga0070704_100101758 Ga0070704_1001017582 278
186 3300005616 Ga0068852_100487354 Ga0068852_1004873542 278
187 3300005618 Ga0068864_100545833 Ga0068864_1005458331 278
188 3300005834 Ga0068851_10027294 Ga0068851_100272942 278
189 3300005841 Ga0068863_100060278 Ga0068863_1000602783 278
190 3300005843 Ga0068860_100000019 Ga0068860_100000019113 278
191 3300005843 Ga0068860_100000458 Ga0068860_10000045824 278
192 3300005844 Ga0068862_100325729 Ga0068862_1003257292 278
193 3300006028 Ga0070717_10139332 Ga0070717_101393322 278
194 3300006028 Ga0070717_10156530 Ga0070717_101565302 278
195 3300006173 Ga0070716_100074717 Ga0070716_1000747172 278
196 3300006173 Ga0070716_100142153 Ga0070716_1001421532 278
197 3300006175 Ga0070712_100043812 Ga0070712_1000438122 278
198 3300006358 Ga0068871_100014326 Ga0068871_1000143266 278
199 3300006844 Ga0075428_100057837 Ga0075428_1000578373 278
200 3300006847 Ga0075431_100052464 Ga0075431_1000524644 278
201 3300006871 Ga0075434_100068985 Ga0075434_1000689854 278
202 3300006871 Ga0075434_100087950 Ga0075434_1000879503 278
203 3300006871 Ga0075434_100480508 Ga0075434_1004805082 278
204 3300006914 Ga0075436_100157576 Ga0075436_1001575762 278
205 3300007076 Ga0075435_100114912 Ga0075435_1001149122 278
206 3300007076 Ga0075435_100284653 Ga0075435_1002846532 278
207 3300007076 Ga0075435_100379115 Ga0075435_1003791152 278
208 3300007076 Ga0075435_100415802 Ga0075435_1004158022 278
209 3300007265 Ga0099794_10001943 Ga0099794_100019438 278
210 3300007265 Ga0099794_10005352 Ga0099794_100053522 278
211 3300007265 Ga0099794_10016812 Ga0099794_100168122 278
212 3300007265 Ga0099794_10043256 Ga0099794_100432563 278
213 3300007265 Ga0099794_10048316 Ga0099794_100483163 278
214 3300007265 Ga0099794_10080991 Ga0099794_100809912 278
215 3300007265 Ga0099794_10101922 Ga0099794_101019222 278
216 3300007265 Ga0099794_10124302 Ga0099794_101243022 278
217 3300007788 Ga0099795_10003046 Ga0099795_100030463 278
218 3300007788 Ga0099795_10049921 Ga0099795_100499212 278
219 3300007788 Ga0099795_10056118 Ga0099795_100561182 278
220 3300009094 Ga0111539_10489313 Ga0111539_104893132 278
221 3300009098 Ga0105245_10647589 Ga0105245_106475891 278
222 3300009147 Ga0114129_10167612 Ga0114129_101676125 278
223 3300009148 Ga0105243_10585337 Ga0105243_105853371 278
224 3300009177 Ga0105248_10593054 Ga0105248_105930542 278
225 3300009177 Ga0105248_10618087 Ga0105248_106180871 278
226 3300009551 Ga0105238_10377481 Ga0105238_103774812 278
227 3300010159 Ga0099796_10010075 Ga0099796_100100752 278
228 3300010159 Ga0099796_10054209 Ga0099796_100542092 278
229 3300010375 Ga0105239_10248539 Ga0105239_102485391 278
230 3300013297 Ga0157378_10070885 Ga0157378_100708854 278
231 3300013297 Ga0157378_10258693 Ga0157378_102586932 278
232 3300013297 Ga0157378_10281431 Ga0157378_102814312 278
233 3300013306 Ga0163162_10019574 Ga0163162_100195745 278
234 3300013306 Ga0163162_10343878 Ga0163162_103438782 278
235 3300013306 Ga0163162_10732429 Ga0163162_107324292 278
236 3300013308 Ga0157375_10616943 Ga0157375_106169431 278
237 3300014326 Ga0157380_10314250 Ga0157380_103142502 278
238 3300014968 Ga0157379_10102287 Ga0157379_101022872 278
239 3300014969 Ga0157376_10030855 Ga0157376_100308555 278
240 3300017792 Ga0163161_10124434 Ga0163161_101244342 278
241 3300021361 Ga0213872_10016823 Ga0213872_100168234 278
242 3300025226 Ga0209674_100022 Ga0209674_100022251 278
243 3300025228 Ga0209672_100001 Ga0209672_100001245 278
244 3300025229 Ga0209147_100001 Ga0209147_100001245 278
245 3300025229 Ga0209147_100021 Ga0209147_100021285 278
246 3300025230 Ga0209563_102365 Ga0209563_1023652 278
247 3300025231 Ga0207427_101741 Ga0207427_1017417 278
248 3300025242 Ga0209258_100001 Ga0209258_100001245 278
249 3300025254 Ga0209148_1000003 Ga0209148_1000003245 278
250 3300025256 Ga0209759_1000082 Ga0209759_1000082136 278
251 3300025256 Ga0209759_1000097 Ga0209759_100009768 278
252 3300025256 Ga0209759_1000101 Ga0209759_100010113 278
253 3300025261 Ga0209233_1000061 Ga0209233_1000061235 278
254 3300025272 Ga0209455_1000001 Ga0209455_1000001245 278
255 3300025295 Ga0209564_1019243 Ga0209564_10192432 278
256 3300025302 Ga0207426_1000215 Ga0207426_10002155 278
257 3300025321 Ga0207656_10017113 Ga0207656_100171132 278
258 3300025728 Ga0207655_1007094 Ga0207655_10070945 278
259 3300025885 Ga0207653_10077582 Ga0207653_100775821 278
260 3300025899 Ga0207642_10065820 Ga0207642_100658201 278
261 3300025905 Ga0207685_10021413 Ga0207685_100214132 278
262 3300025905 Ga0207685_10082881 Ga0207685_100828812 278
263 3300025907 Ga0207645_10090926 Ga0207645_100909263 278
264 3300025910 Ga0207684_10239207 Ga0207684_102392072 278
265 3300025913 Ga0207695_10011702 Ga0207695_100117027 278
266 3300025913 Ga0207695_10374541 Ga0207695_103745411 278
267 3300025915 Ga0207693_10011178 Ga0207693_100111782 278
268 3300025915 Ga0207693_10028001 Ga0207693_100280013 278
269 3300025915 Ga0207693_10053864 Ga0207693_100538642 278
270 3300025915 Ga0207693_10090378 Ga0207693_100903782 278
271 3300025915 Ga0207693_10277744 Ga0207693_102777442 278
272 3300025922 Ga0207646_10010524 Ga0207646_1001052411 278
273 3300025922 Ga0207646_10165865 Ga0207646_101658652 278
274 3300025922 Ga0207646_10234687 Ga0207646_102346872 278
275 3300025926 Ga0207659_10082451 Ga0207659_100824513 278
276 3300025929 Ga0207664_10088963 Ga0207664_100889633 278
277 3300025929 Ga0207664_10198214 Ga0207664_101982142 278
278 3300025933 Ga0207706_10034210 Ga0207706_100342105 278
279 3300025939 Ga0207665_10016434 Ga0207665_100164343 278
280 3300025939 Ga0207665_10032366 Ga0207665_100323662 278
281 3300025939 Ga0207665_10262967 Ga0207665_102629672 278
282 3300025941 Ga0207711_10328457 Ga0207711_103284571 278
283 3300025942 Ga0207689_10094808 Ga0207689_100948082 278
284 3300025942 Ga0207689_10151659 Ga0207689_101516593 278
285 3300025972 Ga0207668_10129538 Ga0207668_101295382 278
286 3300026035 Ga0207703_10207624 Ga0207703_102076241 278
287 3300026067 Ga0207678_10417730 Ga0207678_104177301 278
288 3300026075 Ga0207708_10130491 Ga0207708_101304912 278
289 3300026088 Ga0207641_10283823 Ga0207641_102838232 278
290 3300026116 Ga0207674_10334616 Ga0207674_103346162 278
291 3300027512 Ga0209179_1007505 Ga0209179_10075053 278
292 3300027671 Ga0209588_1000435 Ga0209588_100043511 278
293 3300027671 Ga0209588_1011393 Ga0209588_10113934 278
294 3300027671 Ga0209588_1011749 Ga0209588_10117491 278
295 3300027671 Ga0209588_1012749 Ga0209588_10127493 278
296 3300027671 Ga0209588_1017679 Ga0209588_10176792 278
297 3300027671 Ga0209588_1028252 Ga0209588_10282522 278
298 3300027671 Ga0209588_1044358 Ga0209588_10443582 278
299 3300027671 Ga0209588_1048312 Ga0209588_10483121 278
300 3300028380 Ga0268265_10071394 Ga0268265_100713943 278
301 3300028381 Ga0268264_10000642 Ga0268264_1000064222 278
302 3300028786 Ga0307517_10132139 Ga0307517_101321392 278
303 3300028794 Ga0307515_10052334 Ga0307515_100523343 278
304 3300031090 Ga0265760_10088276 Ga0265760_100882761 278
305 3300031456 Ga0307513_10148199 Ga0307513_101481992 278
306 3300031548 Ga0307408_100002870 Ga0307408_1000028708 278
307 3300031711 Ga0265314_10024135 Ga0265314_100241353 278
308 3300033180 Ga0307510_10008632 Ga0307510_100086329 278
309 3300035114 Ga0373939_0018537 Ga0373939_0018537_681_1547 278
310 3300035170 Ga0373943_0137827 Ga0373943_0137827_406_1254 278
311 3300035692 Ga0373935_0258187 Ga0373935_0258187_358_1206 278
312 3300037068 Ga0373925_0376529 Ga0373925_0376529_17_865 278
313 3300039447 Ga0436361_0326225 Ga0436361_0326225_3948_4784 278
314 3300039447 Ga0436361_0530782 Ga0436361_0530782_1206_2042 278
315 3300044673 Ga0453683_0023760 Ga0453683_0023760_747_1595 278
316 3300046452 Ga0495617_001570 Ga0495617_001570_3861_4709 278
317 3300046457 Ga0495590_0014308 Ga0495590_0014308_1351_2229 278
318 3300046457 Ga0495590_0066287 Ga0495590_0066287_145_1047 278
319 3300046463 Ga0495653_0005512 Ga0495653_0005512_7816_8685 278
320 3300046463 Ga0495653_0239578 Ga0495653_0239578_194_1060 278
321 3300046472 Ga0495580_0008442 Ga0495580_0008442_2808_3686 278
322 3300046474 Ga0495605_0026565 Ga0495605_0026565_119_967 278
323 3300046474 Ga0495605_0029885 Ga0495605_0029885_1208_2086 278
324 3300046491 Ga0495584_0053808 Ga0495584_0053808_194_1042 278
325 3300046492 Ga0495585_0001103 Ga0495585_0001103_5745_6593 278
326 3300046501 Ga0495607_0019132 Ga0495607_0019132_1752_2600 278
327 3300046506 Ga0495583_0000005 Ga0495583_0000005_478265_479104 278
328 3300046506 Ga0495583_0004547 Ga0495583_0004547_1946_2824 278
329 3300046506 Ga0495583_0015927 Ga0495583_0015927_292_1140 278
330 3300046507 Ga0495606_0000409 Ga0495606_0000409_25078_25968 278
331 3300046507 Ga0495606_0001267 Ga0495606_0001267_4493_5353 278
332 3300046507 Ga0495606_0039628 Ga0495606_0039628_2223_3089 278
333 3300046513 Ga0495616_0007389 Ga0495616_0007389_2802_3650 278
334 3300046513 Ga0495616_0025680 Ga0495616_0025680_2171_3049 278
335 3300046517 Ga0495630_0001745 Ga0495630_0001745_10401_11270 278
336 3300046518 Ga0495631_0091429 Ga0495631_0091429_176_1024 278
337 3300046519 Ga0495632_0134241 Ga0495632_0134241_221_1069 278
338 3300046524 Ga0495648_0008962 Ga0495648_0008962_4039_4887 278
339 3300046524 Ga0495648_0029200 Ga0495648_0029200_2397_3257 278
340 3300046524 Ga0495648_0171423 Ga0495648_0171423_183_1034 278
341 3300046526 Ga0495666_0093396 Ga0495666_0093396_19_888 278
342 3300046528 Ga0495642_0000614 Ga0495642_0000614_16822_17697 278
343 3300046528 Ga0495642_0008131 Ga0495642_0008131_378_1229 278
344 3300046528 Ga0495642_0098658 Ga0495642_0098658_105_1025 278
345 3300046529 Ga0495652_0002141 Ga0495652_0002141_17177_18046 278
346 3300046530 Ga0495654_0045078 Ga0495654_0045078_715_1563 278
347 3300046531 Ga0495665_0000898 Ga0495665_0000898_7356_8225 278
348 3300046535 Ga0495586_0190252 Ga0495586_0190252_31_900 278
349 3300046538 Ga0495609_0000318 Ga0495609_0000318_39429_40277 278
350 3300046615 Ga0495656_0086446 Ga0495656_0086446_470_1318 278
351 3300046616 Ga0495668_0001366 Ga0495668_0001366_18218_19069 278
352 3300046616 Ga0495668_0001366 Ga0495668_0001366_21114_21989 278
353 3300046616 Ga0495668_0010239 Ga0495668_0010239_1355_2224 278
354 3300046616 Ga0495668_0204619 Ga0495668_0204619_191_1039 278
355 3300046616 Ga0495668_0261011 Ga0495668_0261011_66_902 278
356 3300046648 Ga0495611_0018915 Ga0495611_0018915_705_1580 278
357 3300046648 Ga0495611_0044257 Ga0495611_0044257_345_1196 278
358 3300046660 Ga0495625_0033148 Ga0495625_0033148_1550_2398 278
359 3300046660 Ga0495625_0188136 Ga0495625_0188136_518_1354 278
360 3300046663 Ga0495635_0005151 Ga0495635_0005151_7765_8634 278
361 3300046664 Ga0495659_0004339 Ga0495659_0004339_613_1461 278
362 3300046678 Ga0495599_0070701 Ga0495599_0070701_555_1391 278
363 3300046679 Ga0495623_0000953 Ga0495623_0000953_11029_11898 278
364 3300046680 Ga0495646_0002066 Ga0495646_0002066_1997_2866 278
365 3300046684 Ga0495669_0004781 Ga0495669_0004781_1960_2808 278
366 3300046690 Ga0495624_0000522 Ga0495624_0000522_7021_7890 278
367 3300046691 Ga0495670_0009718 Ga0495670_0009718_1008_1856 278
368 3300046692 Ga0495671_0006501 Ga0495671_0006501_4688_5536 278
369 3300046694 Ga0495649_0022581 Ga0495649_0022581_443_1303 278
370 3300046809 Ga0495600_0136658 Ga0495600_0136658_522_1391 278
371 3300046810 Ga0495660_0001339 Ga0495660_0001339_13186_14034 278
372 3300047317 Ga0495604_0012060 Ga0495604_0012060_4611_5480 278
373 3300047317 Ga0495604_0028118 Ga0495604_0028118_2701_3567 278
374 3300047319 Ga0495674_0011202 Ga0495674_0011202_6699_7568 278
375 3300047320 Ga0495672_0003345 Ga0495672_0003345_2794_3642 278
376 3300047320 Ga0495672_0015871 Ga0495672_0015871_2603_3481 278
377 3300047320 Ga0495672_0030565 Ga0495672_0030565_2144_3019 278
378 3300047322 Ga0495680_0001635 Ga0495680_0001635_12117_12986 278
379 3300047322 Ga0495680_0106434 Ga0495680_0106434_275_1237 278
380 3300047323 Ga0495683_0064869 Ga0495683_0064869_656_1534 278
381 3300047443 Ga0495687_005564 Ga0495687_005564_2299_3177 278
382 3300047444 Ga0495675_0032387 Ga0495675_0032387_1832_2698 278
383 3300047445 Ga0495677_0010421 Ga0495677_0010421_1719_2597 278
384 3300047445 Ga0495677_0012891 Ga0495677_0012891_2153_3004 278
385 3300047469 Ga0495673_0005404 Ga0495673_0005404_2638_3516 278
386 3300047469 Ga0495673_0005808 Ga0495673_0005808_195_1043 278
387 3300047469 Ga0495673_0006862 Ga0495673_0006862_2860_3708 278
388 3300048088 Ga0495602_0002334 Ga0495602_0002334_10773_11642 278
389 3300048088 Ga0495602_0204368 Ga0495602_0204368_19_885 278
390 3300048091 Ga0495626_0009005 Ga0495626_0009005_2689_3537 278
391 3300048091 Ga0495626_0027316 Ga0495626_0027316_845_1723 278
392 3300048903 Ga0496100_0107512 Ga0496100_0107512_724_1602 278
393 3300048903 Ga0496100_0283604 Ga0496100_0283604_15_863 278
394 3300048905 Ga0496102_0001539 Ga0496102_0001539_13163_14029 278
395 3300048906 Ga0496103_0000371 Ga0496103_0000371_39284_40150 278
396 3300048907 Ga0496104_0023369 Ga0496104_0023369_1818_2678 278
397 3300048908 Ga0496105_0088836 Ga0496105_0088836_1519_2385 278
398 3300048908 Ga0496105_0210044 Ga0496105_0210044_344_1192 278
399 3300048909 Ga0496106_0333554 Ga0496106_0333554_24_872 278
400 3300048909 Ga0496106_0333803 Ga0496106_0333803_177_1025 278
401 3300048913 Ga0496110_0446428 Ga0496110_0446428_169_1038 278
402 3300048915 Ga0496112_0108823 Ga0496112_0108823_1111_1977 278
403 3300048915 Ga0496112_0115704 Ga0496112_0115704_324_1202 278
404 3300048920 Ga0496117_0002705 Ga0496117_0002705_13163_14029 278
405 3300048920 Ga0496117_0006550 Ga0496117_0006550_553_1389 278
406 3300048920 Ga0496117_0142734 Ga0496117_0142734_72_965 278
407 3300048921 Ga0496118_0000698 Ga0496118_0000698_13163_14029 278
408 3300048921 Ga0496118_0004083 Ga0496118_0004083_15503_16339 278
409 3300048924 Ga0496121_0001198 Ga0496121_0001198_13163_14029 278
410 3300048924 Ga0496121_0001778 Ga0496121_0001778_25247_26125 278
411 3300048924 Ga0496121_0003399 Ga0496121_0003399_16048_16911 278
412 3300048924 Ga0496121_0010421 Ga0496121_0010421_818_1654 278
413 3300048925 Ga0496122_0039884 Ga0496122_0039884_2594_3442 278
414 3300048927 Ga0496124_0108698 Ga0496124_0108698_824_1699 278
415 3300048927 Ga0496124_0205114 Ga0496124_0205114_413_1279 278
416 3300048929 Ga0496126_0001141 Ga0496126_0001141_6577_7431 278
417 3300048929 Ga0496126_0001647 Ga0496126_0001647_17486_18322 278
418 3300048929 Ga0496126_0001679 Ga0496126_0001679_29461_30324 278
419 3300048929 Ga0496126_0134723 Ga0496126_0134723_246_1082 278
420 3300048929 Ga0496126_0448109 Ga0496126_0448109_101_979 278
421 3300049460 Ga0495682_0002622 Ga0495682_0002622_2794_3642 278
422 3300049460 Ga0495682_0003355 Ga0495682_0003355_3536_4414 278
423 3300049460 Ga0495682_0044301 Ga0495682_0044301_569_1429 278
424 3300049583 Ga0501067_0077564 Ga0501067_0077564_635_1483 278
425 3300050507 nmdc:mga05p37_1017_c1 nmdc:mga05p37_1017_c1_21108_21992 278
426 3300050507 nmdc:mga05p37_156898_c1 nmdc:mga05p37_156898_c1_1041_1889 278
427 3300050507 nmdc:mga05p37_21325_c1 nmdc:mga05p37_21325_c1_1874_2761 278
428 3300050507 nmdc:mga05p37_324324_c1 nmdc:mga05p37_324324_c1_799_1647 278
429 3300050507 nmdc:mga05p37_392247_c1 nmdc:mga05p37_392247_c1_46_948 278
430 3300050508 nmdc:mga09592_371540_c1 nmdc:mga09592_371540_c1_313_1197 278
431 3300050509 nmdc:mga0qj67_432656_c1 nmdc:mga0qj67_432656_c1_129_977 278
432 3300050510 nmdc:mga06r32_1053_c1 nmdc:mga06r32_1053_c1_7913_8797 278
433 3300050510 nmdc:mga06r32_324276_c1 nmdc:mga06r32_324276_c1_310_1197 278
434 3300050511 nmdc:mga08y16_220852_c1 nmdc:mga08y16_220852_c1_410_1258 278
435 3300050511 nmdc:mga08y16_76079_c1 nmdc:mga08y16_76079_c1_340_1227 278
436 3300050512 nmdc:mga0n895_86991_c1 nmdc:mga0n895_86991_c1_1308_2174 278
437 3300050513 nmdc:mga0rr50_154904_c1 nmdc:mga0rr50_154904_c1_636_1484 278
438 3300050514 nmdc:mga08x19_230131_c1 nmdc:mga08x19_230131_c1_123_971 278
439 3300050515 nmdc:mga0a205_65414_c1 nmdc:mga0a205_65414_c1_987_1835 278
440 3300050515 nmdc:mga0a205_77225_c1 nmdc:mga0a205_77225_c1_654_1502 278
441 3300053086 Ga0500578_0091681 Ga0500578_0091681_28_888 278
442 3300053088 Ga0500644_0018688 Ga0500644_0018688_649_1506 278
443 3300053092 Ga0500583_0005010 Ga0500583_0005010_2175_3044 278
444 3300053093 Ga0500651_0071350 Ga0500651_0071350_331_1197 278
445 3300053134 Ga0500658_0010993 Ga0500658_0010993_1281_2183 278
446 iso_pu_bacteria 642555113 642615224 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

56

297

0.78

PF12146

Hydrolase_4

Serine aminopeptidase, S33

68

294

0.76

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

49

303

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pw0-assembly1.cif.gz_A-2 alpha/beta hydrolase fold protein from chitinophaga pinensis 0.9339 4 278
4pw0-assembly1.cif.gz_A-2 alpha/beta hydrolase fold protein from chitinophaga pinensis 0.9274 4 278
6eb3-assembly3.cif.gz_C structural and enzymatic characterization of an esterase from a metagenomic library 0.8892 12 277
6eb3-assembly1.cif.gz_A structural and enzymatic characterization of an esterase from a metagenomic library 0.8776 12 277
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.8716 9 127
ID Description Score Start End Superfamily
4pw0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9266 4 278 3.40.50.1820
af_O53327_8_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.922 4 276 3.40.50.1820
4pw0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9199 4 278 3.40.50.1820
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9011 19 130 3.40.50.12270
3bdiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8521 9 276 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6P2ZTK3-F1-model_v4 Alpha/beta hydrolase 0.9798 10 131 GO:0016787
AF-A0A2V5A7J7-F1-model_v4 deleted 0.9762 3 131
AF-A0A2P8G2C1-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.969 2 278
AF-A0A2P8G2C1-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9622 2 278
AF-A0A0K2RDB7-F1-model_v4 Putative aminoacrylate hydrolase RutD 0.9597 2 138 GO:0016787

Feature Viewer

pLDDT pTM Quality
95 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map