F445627

General Info

Members Datasets Scaffolds Average Seq Length
445 173 445 471

Family's Representative Sequence

Representative Sequence 3300061719|Ga0466962_0004901|Ga0466962_0004901_2000_3415
Length 462
Sequence VKLRDIADVDSDSEVTGFAIDHRKVVRGSVFGAFKGAVFNGEDFIGEAVDRGAVAVVARPEVPPSRVPVLGDPEPRRLFAELAAKFYAPYPETVVAVTGTNGKTSTVEMTRQIWRMSGHRSASIGTLGVTTADDQVKTGLTTPDIVTFLNNMAGLKRMGISHVAYEASSHGLDQHRAEGVPLAAAAFTNFSRDHLDYHETMEAYFEAKMRLFDELLPTHKPAVIWTDDPKSNEVIARASRRGHEVVRLVDQSPTALGQTLMLEHGGKSHRLALPLIGAYQAANVLTAAGLVLATGGDWTTTFTAMQRVAPVRGRLERAVISRTGVPVYVDYAHTPDALEAAIAALRPHVEGRLITVFGAGGDRDQGKRPEMGRVASELSDVVIVTDDNPRSEDPALIRRAIMTGASGAKEVPGRREAIAEAIHIAREGDIVLVAGKGHETGQIIGDTVLPFDDALVARECAA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.15
Rhizosphere 96.18
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004665 3300001979 Bacteria 5878
2 JGI24740J21852_10009753 3300001979 Bacteria 3738
3 JGI24739J22299_10000788 3300001989 Bacteria 11567
4 JGI24737J22298_10000536 3300001990 Bacteria 13306
5 JGI24737J22298_10000588 3300001990 Bacteria 12772
6 JGI24738J21930_10000374 3300002075 Bacteria 12453
7 JGI24744J21845_10006662 3300002077 Bacteria 2391
8 Ga0065712_10083552 3300005290 Bacteria 2827
9 Ga0070658_10003656 3300005327 Bacteria 12593
10 Ga0070658_10012748 3300005327 Bacteria 6743
11 Ga0070658_10013593 3300005327 Bacteria 6531
12 Ga0070658_10015704 3300005327 Bacteria 6055
13 Ga0070676_10005464 3300005328 Bacteria 6768
14 Ga0070683_100007812 3300005329 Bacteria 9058
15 Ga0070683_100030632 3300005329 Bacteria 4886
16 Ga0070683_100084531 3300005329 Bacteria 2973
17 Ga0070690_100016061 3300005330 Bacteria 4477
18 Ga0070690_100042422 3300005330 Bacteria 2881
19 Ga0070670_100001608 3300005331 Bacteria 18255
20 Ga0070670_100015697 3300005331 Bacteria 6501
21 Ga0070670_100023256 3300005331 Bacteria 5334
22 Ga0070670_100064984 3300005331 Bacteria 3130
23 Ga0070670_100066633 3300005331 Bacteria 3090
24 Ga0070670_100081576 3300005331 Bacteria 2779
25 Ga0068869_100000292 3300005334 Bacteria 26686
26 Ga0070666_10001330 3300005335 Bacteria 14998
27 Ga0070666_10030476 3300005335 Bacteria 3554
28 Ga0070680_100124943 3300005336 Bacteria 2149
29 Ga0068868_100000321 3300005338 Bacteria 32236
30 Ga0068868_100004528 3300005338 Bacteria 9755
31 Ga0070660_100004355 3300005339 Bacteria 9778
32 Ga0070660_100010047 3300005339 Bacteria 6676
33 Ga0070660_100010845 3300005339 Bacteria 6452
34 Ga0070660_100015268 3300005339 Bacteria 5541
35 Ga0070660_100019429 3300005339 Bacteria 4980
36 Ga0070660_100022353 3300005339 Bacteria 4675
37 Ga0070660_100070134 3300005339 Bacteria 2734
38 Ga0070660_100076307 3300005339 Bacteria 2625
39 Ga0070661_100015006 3300005344 Bacteria 5466
40 Ga0070661_100055232 3300005344 Bacteria 2908
41 Ga0070661_100074476 3300005344 Bacteria 2500
42 Ga0070692_10030777 3300005345 Bacteria 2686
43 Ga0070668_100000496 3300005347 Bacteria 26067
44 Ga0070668_100019522 3300005347 Bacteria 5102
45 Ga0070668_100085641 3300005347 Bacteria 2477
46 Ga0070669_100000605 3300005353 Bacteria 26684
47 Ga0070669_100017633 3300005353 Bacteria 5093
48 Ga0070669_100026216 3300005353 Bacteria 4193
49 Ga0070669_100069529 3300005353 Bacteria 2601
50 Ga0070669_100110307 3300005353 Bacteria 2087
51 Ga0070675_100002680 3300005354 Bacteria 13382
52 Ga0070675_100039676 3300005354 Bacteria 3843
53 Ga0070671_100000424 3300005355 Bacteria 29408
54 Ga0070671_100002159 3300005355 Bacteria 15168
55 Ga0070671_100011299 3300005355 Bacteria 7175
56 Ga0070674_100007014 3300005356 Bacteria 6619
57 Ga0070674_100007031 3300005356 Bacteria 6614
58 Ga0070674_100029369 3300005356 Bacteria 3620
59 Ga0070673_100002977 3300005364 Bacteria 10454
60 Ga0070673_100005659 3300005364 Bacteria 8030
61 Ga0070673_100018051 3300005364 Bacteria 5032
62 Ga0070673_100060553 3300005364 Bacteria 3000
63 Ga0070659_100000469 3300005366 Bacteria 29784
64 Ga0070659_100002289 3300005366 Bacteria 13633
65 Ga0070659_100016018 3300005366 Bacteria 5623
66 Ga0070659_100044206 3300005366 Bacteria 3486
67 Ga0070659_100154549 3300005366 Bacteria 1873
68 Ga0070667_100000966 3300005367 Bacteria 26470
69 Ga0070667_100001224 3300005367 Bacteria 23384
70 Ga0070667_100107362 3300005367 Bacteria 2417
71 Ga0070714_100073699 3300005435 Bacteria 2958
72 Ga0070663_100013273 3300005455 Bacteria 5246
73 Ga0070663_100015089 3300005455 Bacteria 4974
74 Ga0070663_100115880 3300005455 Bacteria 2019
75 Ga0070678_100016258 3300005456 Bacteria 4754
76 Ga0070678_100019309 3300005456 Bacteria 4440
77 Ga0070662_100004149 3300005457 Bacteria 9118
78 Ga0070662_100007006 3300005457 Bacteria 7292
79 Ga0070662_100010952 3300005457 Bacteria 5975
80 Ga0070662_100057501 3300005457 Bacteria 2826
81 Ga0070662_100081202 3300005457 Bacteria 2415
82 Ga0070662_100119781 3300005457 Bacteria 2016
83 Ga0070681_10032985 3300005458 Bacteria 5198
84 Ga0068867_100000045 3300005459 Bacteria 75898
85 Ga0068867_100017540 3300005459 Bacteria 5084
86 Ga0070684_100012962 3300005535 Bacteria 6704
87 Ga0068853_100024220 3300005539 Bacteria 5087
88 Ga0070672_100002199 3300005543 Bacteria 12294
89 Ga0070672_100016719 3300005543 Bacteria 5259
90 Ga0070672_100024823 3300005543 Bacteria 4436
91 Ga0070672_100037584 3300005543 Bacteria 3695
92 Ga0070686_100044914 3300005544 Bacteria 2780
93 Ga0070693_100025252 3300005547 Bacteria 3196
94 Ga0070665_100002237 3300005548 Bacteria 21574
95 Ga0070665_100032530 3300005548 Bacteria 5249
96 Ga0070665_100036969 3300005548 Bacteria 4910
97 Ga0070665_100042231 3300005548 Bacteria 4583
98 Ga0068855_100004924 3300005563 Bacteria 16297
99 Ga0068855_100012260 3300005563 Bacteria 10360
100 Ga0068855_100015292 3300005563 Bacteria 9238
101 Ga0068855_100093999 3300005563 Bacteria 3457
102 Ga0070664_100003389 3300005564 Bacteria 12868
103 Ga0070664_100004845 3300005564 Bacteria 10782
104 Ga0070664_100018908 3300005564 Bacteria 5664
105 Ga0070664_100041445 3300005564 Bacteria 3885
106 Ga0070664_100074931 3300005564 Bacteria 2905
107 Ga0070664_100081412 3300005564 Bacteria 2790
108 Ga0070664_100087313 3300005564 Bacteria 2696
109 Ga0068857_100001199 3300005577 Bacteria 20230
110 Ga0068857_100001788 3300005577 Bacteria 17312
111 Ga0068857_100005037 3300005577 Bacteria 11223
112 Ga0068854_100000234 3300005578 Bacteria 37807
113 Ga0068854_100018349 3300005578 Bacteria 4696
114 Ga0068856_100016117 3300005614 Bacteria 7225
115 Ga0068856_100033010 3300005614 Bacteria 5069
116 Ga0068852_100000509 3300005616 Bacteria 25586
117 Ga0068852_100053753 3300005616 Bacteria 3468
118 Ga0068852_100147082 3300005616 Bacteria 2187
119 Ga0068859_100000709 3300005617 Bacteria 33516
120 Ga0068859_100042766 3300005617 Bacteria 4551
121 Ga0068859_100047690 3300005617 Bacteria 4304
122 Ga0068864_100000484 3300005618 Bacteria 34533
123 Ga0068864_100073299 3300005618 Bacteria 2985
124 Ga0068866_10007335 3300005718 Bacteria 4617
125 Ga0068851_10043536 3300005834 Bacteria 2263
126 Ga0068863_100006290 3300005841 Bacteria 11660
127 Ga0068863_100012929 3300005841 Bacteria 8050
128 Ga0068863_100016750 3300005841 Bacteria 7032
129 Ga0068863_100036187 3300005841 Bacteria 4702
130 Ga0068858_100001269 3300005842 Bacteria 26113
131 Ga0068858_100004856 3300005842 Bacteria 13183
132 Ga0068858_100022193 3300005842 Bacteria 5928
133 Ga0068860_100024266 3300005843 Bacteria 5863
134 Ga0068860_100034001 3300005843 Bacteria 4890
135 Ga0068860_100241496 3300005843 Bacteria 1757
136 Ga0068862_100059138 3300005844 Bacteria 3290
137 Ga0081539_10007149 3300005985 Bacteria 10300
138 Ga0081539_10025412 3300005985 Bacteria 3815
139 Ga0075433_10029462 3300006852 Bacteria 4677
140 Ga0068865_100003176 3300006881 Bacteria 9845
141 Ga0097620_100000709 3300006931 Bacteria 33516
142 Ga0097620_100042768 3300006931 Bacteria 4551
143 Ga0097620_100047690 3300006931 Bacteria 4304
144 Ga0075435_100083608 3300007076 Bacteria 2625
145 Ga0105240_10011453 3300009093 Bacteria 12348
146 Ga0105245_10000679 3300009098 Bacteria 30743
147 Ga0105243_10028921 3300009148 Bacteria 4259
148 Ga0105243_10174159 3300009148 Bacteria 1866
149 Ga0105241_10110207 3300009174 Bacteria 2202
150 Ga0105248_10000122 3300009177 Bacteria 89560
151 Ga0105248_10037366 3300009177 Bacteria 5433
152 Ga0105248_10039282 3300009177 Bacteria 5300
153 Ga0105238_10161302 3300009551 Bacteria 2218
154 Ga0105249_10034144 3300009553 Bacteria 4607
155 Ga0105249_10091040 3300009553 Bacteria 2853
156 Ga0105246_10020713 3300011119 Bacteria 4222
157 Ga0105246_10073388 3300011119 Bacteria 2416
158 Ga0157371_10002922 3300013102 Bacteria 15960
159 Ga0157371_10008367 3300013102 Bacteria 8248
160 Ga0157370_10030192 3300013104 Bacteria 5313
161 Ga0157370_10184075 3300013104 Bacteria 1940
162 Ga0157369_10001135 3300013105 Bacteria 33313
163 Ga0157369_10003392 3300013105 Bacteria 18901
164 Ga0157369_10014979 3300013105 Bacteria 8752
165 Ga0157369_10027545 3300013105 Bacteria 6297
166 Ga0157378_10000242 3300013297 Bacteria 53256
167 Ga0157378_10009348 3300013297 Bacteria 8538
168 Ga0163162_10057864 3300013306 Bacteria 3904
169 Ga0163162_10245179 3300013306 Bacteria 1923
170 Ga0157372_10289390 3300013307 Bacteria 1905
171 Ga0157375_10040306 3300013308 Bacteria 4501
172 Ga0157375_10158805 3300013308 Bacteria 2402
173 Ga0163163_10063793 3300014325 Bacteria 3654
174 Ga0157377_10014637 3300014745 Bacteria 3994
175 Ga0157376_10128495 3300014969 Bacteria 2258
176 Ga0213875_10005523 3300021388 Bacteria 6775
177 Ga0207697_10000002 3300025315 Bacteria 92560
178 Ga0207656_10016566 3300025321 Bacteria 2871
179 Ga0207688_10000348 3300025901 Bacteria 21483
180 Ga0207680_10022109 3300025903 Bacteria 3453
181 Ga0207647_10002492 3300025904 Bacteria 13943
182 Ga0207647_10009195 3300025904 Bacteria 7031
183 Ga0207647_10022887 3300025904 Bacteria 4143
184 Ga0207645_10002184 3300025907 Bacteria 15616
185 Ga0207645_10003169 3300025907 Bacteria 12597
186 Ga0207705_10000469 3300025909 Bacteria 34559
187 Ga0207705_10002865 3300025909 Bacteria 13205
188 Ga0207705_10065714 3300025909 Bacteria 2623
189 Ga0207695_10013445 3300025913 Bacteria 9762
190 Ga0207660_10075678 3300025917 Bacteria 2460
191 Ga0207657_10000797 3300025919 Bacteria 33369
192 Ga0207657_10000864 3300025919 Bacteria 31944
193 Ga0207657_10010290 3300025919 Bacteria 9340
194 Ga0207657_10012068 3300025919 Bacteria 8544
195 Ga0207657_10015005 3300025919 Bacteria 7524
196 Ga0207657_10021185 3300025919 Bacteria 6123
197 Ga0207657_10026809 3300025919 Bacteria 5286
198 Ga0207657_10046964 3300025919 Bacteria 3780
199 Ga0207649_10008672 3300025920 Bacteria 5553
200 Ga0207649_10045749 3300025920 Bacteria 2685
201 Ga0207652_10152525 3300025921 Bacteria 2069
202 Ga0207681_10003749 3300025923 Bacteria 9447
203 Ga0207681_10123688 3300025923 Bacteria 1901
204 Ga0207650_10010465 3300025925 Bacteria 6360
205 Ga0207650_10014878 3300025925 Bacteria 5413
206 Ga0207650_10068636 3300025925 Bacteria 2662
207 Ga0207650_10074759 3300025925 Bacteria 2555
208 Ga0207659_10002913 3300025926 Bacteria 10190
209 Ga0207659_10022509 3300025926 Bacteria 4196
210 Ga0207659_10042225 3300025926 Bacteria 3196
211 Ga0207659_10128142 3300025926 Bacteria 1954
212 Ga0207687_10000426 3300025927 Bacteria 28498
213 Ga0207700_10045223 3300025928 Bacteria 3247
214 Ga0207644_10000216 3300025931 Bacteria 39644
215 Ga0207644_10001996 3300025931 Bacteria 13213
216 Ga0207644_10010794 3300025931 Bacteria 6027
217 Ga0207644_10011869 3300025931 Bacteria 5774
218 Ga0207644_10018766 3300025931 Bacteria 4683
219 Ga0207644_10112264 3300025931 Bacteria 2062
220 Ga0207644_10195884 3300025931 Bacteria 1591
221 Ga0207690_10002194 3300025932 Bacteria 11901
222 Ga0207690_10002752 3300025932 Bacteria 10625
223 Ga0207690_10006495 3300025932 Bacteria 6932
224 Ga0207690_10180266 3300025932 Bacteria 1590
225 Ga0207706_10003590 3300025933 Bacteria 14813
226 Ga0207706_10008226 3300025933 Bacteria 9624
227 Ga0207706_10027025 3300025933 Bacteria 5133
228 Ga0207706_10031062 3300025933 Bacteria 4761
229 Ga0207706_10049358 3300025933 Bacteria 3719
230 Ga0207706_10057330 3300025933 Bacteria 3432
231 Ga0207706_10059272 3300025933 Bacteria 3371
232 Ga0207706_10088082 3300025933 Bacteria 2730
233 Ga0207709_10106353 3300025935 Bacteria 1866
234 Ga0207669_10012331 3300025937 Bacteria 4199
235 Ga0207669_10026284 3300025937 Bacteria 3163
236 Ga0207704_10007247 3300025938 Bacteria 5224
237 Ga0207704_10031129 3300025938 Bacteria 3001
238 Ga0207691_10020070 3300025940 Bacteria 6323
239 Ga0207691_10023337 3300025940 Bacteria 5823
240 Ga0207691_10032200 3300025940 Bacteria 4890
241 Ga0207691_10048106 3300025940 Bacteria 3911
242 Ga0207691_10090272 3300025940 Bacteria 2747
243 Ga0207711_10000787 3300025941 Bacteria 31179
244 Ga0207711_10001807 3300025941 Bacteria 19556
245 Ga0207711_10022481 3300025941 Bacteria 5273
246 Ga0207711_10065354 3300025941 Bacteria 3145
247 Ga0207711_10111901 3300025941 Bacteria 2429
248 Ga0207711_10213636 3300025941 Bacteria 1762
249 Ga0207689_10000125 3300025942 Bacteria 64633
250 Ga0207689_10026690 3300025942 Bacteria 4838
251 Ga0207689_10055939 3300025942 Bacteria 3246
252 Ga0207661_10059943 3300025944 Bacteria 3068
253 Ga0207679_10042643 3300025945 Bacteria 3262
254 Ga0207679_10124710 3300025945 Bacteria 2056
255 Ga0207667_10001485 3300025949 Bacteria 29439
256 Ga0207667_10003653 3300025949 Bacteria 18973
257 Ga0207667_10040349 3300025949 Bacteria 4970
258 Ga0207667_10045253 3300025949 Bacteria 4662
259 Ga0207667_10084677 3300025949 Bacteria 3282
260 Ga0207651_10000306 3300025960 Bacteria 21046
261 Ga0207651_10008501 3300025960 Bacteria 5549
262 Ga0207651_10014732 3300025960 Bacteria 4524
263 Ga0207651_10027779 3300025960 Bacteria 3559
264 Ga0207651_10123927 3300025960 Bacteria 1965
265 Ga0207712_10047970 3300025961 Bacteria 2969
266 Ga0207668_10002041 3300025972 Bacteria 11774
267 Ga0207668_10014373 3300025972 Bacteria 4899
268 Ga0207640_10000349 3300025981 Bacteria 30129
269 Ga0207640_10004806 3300025981 Bacteria 7341
270 Ga0207640_10007205 3300025981 Bacteria 6132
271 Ga0207640_10079615 3300025981 Bacteria 2234
272 Ga0207658_10007700 3300025986 Bacteria 7335
273 Ga0207658_10030597 3300025986 Bacteria 3813
274 Ga0207677_10000758 3300026023 Bacteria 18605
275 Ga0207677_10010999 3300026023 Bacteria 5141
276 Ga0207677_10018324 3300026023 Bacteria 4198
277 Ga0207703_10004195 3300026035 Bacteria 11883
278 Ga0207703_10011318 3300026035 Bacteria 6939
279 Ga0207639_10000400 3300026041 Bacteria 29922
280 Ga0207639_10029103 3300026041 Bacteria 4041
281 Ga0207678_10002432 3300026067 Bacteria 16928
282 Ga0207678_10012099 3300026067 Bacteria 7576
283 Ga0207678_10057525 3300026067 Bacteria 3346
284 Ga0207678_10093918 3300026067 Bacteria 2562
285 Ga0207702_10011116 3300026078 Bacteria 7513
286 Ga0207702_10155003 3300026078 Bacteria 2087
287 Ga0207702_10159986 3300026078 Bacteria 2056
288 Ga0207641_10007396 3300026088 Bacteria 9136
289 Ga0207641_10101206 3300026088 Bacteria 2539
290 Ga0207641_10205507 3300026088 Bacteria 1818
291 Ga0207648_10000088 3300026089 Bacteria 86596
292 Ga0207648_10001235 3300026089 Bacteria 28702
293 Ga0207648_10004355 3300026089 Bacteria 14564
294 Ga0207648_10005627 3300026089 Bacteria 12592
295 Ga0207648_10006996 3300026089 Bacteria 11154
296 Ga0207676_10005481 3300026095 Bacteria 8982
297 Ga0207676_10010877 3300026095 Bacteria 6491
298 Ga0207676_10130218 3300026095 Bacteria 2138
299 Ga0207674_10000082 3300026116 Bacteria 101650
300 Ga0207674_10002496 3300026116 Bacteria 23202
301 Ga0207674_10011360 3300026116 Bacteria 10009
302 Ga0207674_10012182 3300026116 Bacteria 9624
303 Ga0207674_10014461 3300026116 Bacteria 8714
304 Ga0207674_10021151 3300026116 Bacteria 7013
305 Ga0207683_10041987 3300026121 Bacteria 3995
306 Ga0207698_10020596 3300026142 Bacteria 4543
307 Ga0207698_10028883 3300026142 Bacteria 3962
308 Ga0207698_10077828 3300026142 Bacteria 2660
309 Ga0207698_10307679 3300026142 Bacteria 1478
310 Ga0268266_10000437 3300028379 Bacteria 62490
311 Ga0268266_10019130 3300028379 Bacteria 5832
312 Ga0268266_10061201 3300028379 Bacteria 3246
313 Ga0268265_10054219 3300028380 Bacteria 3041
314 Ga0268264_10003191 3300028381 Bacteria 14203
315 Ga0268264_10010496 3300028381 Bacteria 7656
316 Ga0268264_10113883 3300028381 Bacteria 2373
317 Ga0307413_10002398 3300031824 Bacteria 7608
318 Ga0307413_10085179 3300031824 Bacteria 2040
319 Ga0307410_10001002 3300031852 Bacteria 12217
320 Ga0307410_10009458 3300031852 Bacteria 5464
321 Ga0307410_10014368 3300031852 Bacteria 4656
322 Ga0307406_10027349 3300031901 Bacteria 3436
323 Ga0307406_10047285 3300031901 Bacteria 2711
324 Ga0307407_10012470 3300031903 Bacteria 4085
325 Ga0307412_10045062 3300031911 Bacteria 2881
326 Ga0307412_10059028 3300031911 Bacteria 2569
327 Ga0307409_100011192 3300031995 Bacteria 5638
328 Ga0307414_10010040 3300032004 Bacteria 5470
329 Ga0307414_10042101 3300032004 Bacteria 3100
330 Ga0307411_10029172 3300032005 Bacteria 3365
331 Ga0307415_100048552 3300032126 Bacteria 2865
332 Ga0395899_0000140 3300037312 Bacteria 109989
333 Ga0395899_0000352 3300037312 Bacteria 56166
334 Ga0395899_0002234 3300037312 Bacteria 15859
335 Ga0395899_0010760 3300037312 Bacteria 7015
336 Ga0395899_0017186 3300037312 Bacteria 5510
337 Ga0395899_0054979 3300037312 Bacteria 2944
338 Ga0395899_0073056 3300037312 Bacteria 2509
339 Ga0395900_0000075 3300037418 Bacteria 183525
340 Ga0395900_0001013 3300037418 Bacteria 36249
341 Ga0395900_0006343 3300037418 Bacteria 12331
342 Ga0395900_0010908 3300037418 Bacteria 9292
343 Ga0395900_0016159 3300037418 Bacteria 7602
344 Ga0395900_0019023 3300037418 Bacteria 7004
345 Ga0395900_0024278 3300037418 Bacteria 6207
346 Ga0395900_0032350 3300037418 Bacteria 5378
347 Ga0395900_0044511 3300037418 Bacteria 4573
348 Ga0395900_0049617 3300037418 Bacteria 4324
349 Ga0395900_0051072 3300037418 Bacteria 4259
350 Ga0395900_0052650 3300037418 Bacteria 4190
351 Ga0395900_0055215 3300037418 Bacteria 4090
352 Ga0395900_0080273 3300037418 Bacteria 3352
353 Ga0395900_0157786 3300037418 Bacteria 2317
354 Ga0395900_0163283 3300037418 Bacteria 2271
355 Ga0395898_0000055 3300037466 Bacteria 278557
356 Ga0395898_0021365 3300037466 Bacteria 6563
357 Ga0395898_0039641 3300037466 Bacteria 4661
358 Ga0395898_0048931 3300037466 Bacteria 4144
359 Ga0395898_0089475 3300037466 Bacteria 2962
360 Ga0395898_0138415 3300037466 Bacteria 2331
361 Ga0395898_0194907 3300037466 Bacteria 1935
362 Ga0395905_0000089 3300037471 Bacteria 152196
363 Ga0395905_0002449 3300037471 Bacteria 20558
364 Ga0395905_0004013 3300037471 Bacteria 15469
365 Ga0395905_0006411 3300037471 Bacteria 11845
366 Ga0395905_0010264 3300037471 Bacteria 9119
367 Ga0395905_0015172 3300037471 Bacteria 7331
368 Ga0395905_0019794 3300037471 Bacteria 6380
369 Ga0395905_0032860 3300037471 Bacteria 4878
370 Ga0395905_0034139 3300037471 Bacteria 4776
371 Ga0395905_0037176 3300037471 Bacteria 4572
372 Ga0395905_0047923 3300037471 Bacteria 4004
373 Ga0395905_0051706 3300037471 Bacteria 3848
374 Ga0395905_0076742 3300037471 Bacteria 3131
375 Ga0395905_0079117 3300037471 Bacteria 3081
376 Ga0395905_0090314 3300037471 Bacteria 2871
377 Ga0395905_0139212 3300037471 Bacteria 2283
378 Ga0436364_1258768 3300037853 Bacteria 24526
379 Ga0395901_0000047 3300038443 Bacteria 175221
380 Ga0395901_0000168 3300038443 Bacteria 85645
381 Ga0395901_0000885 3300038443 Bacteria 32947
382 Ga0395901_0005164 3300038443 Bacteria 13179
383 Ga0395901_0008637 3300038443 Bacteria 10292
384 Ga0395901_0031611 3300038443 Bacteria 5457
385 Ga0395901_0050198 3300038443 Bacteria 4335
386 Ga0395901_0069236 3300038443 Bacteria 3675
387 Ga0395901_0134702 3300038443 Bacteria 2596
388 Ga0395901_0250656 3300038443 Bacteria 1844
389 Ga0395901_0287704 3300038443 Bacteria 1706
390 Ga0436365_1844112 3300039437 Bacteria 13004
391 Ga0439458_0000050 3300042157 Bacteria 19821
392 Ga0439458_0001138 3300042157 Bacteria 6756
393 Ga0466969_0001195 3300044656 Bacteria 14022
394 Ga0466969_0021041 3300044656 Bacteria 3374
395 Ga0466966_0000077 3300044684 Bacteria 62463
396 Ga0466966_0000965 3300044684 Bacteria 18464
397 Ga0466966_0003521 3300044684 Bacteria 10332
398 Ga0466966_0019286 3300044684 Bacteria 4488
399 Ga0466966_0020735 3300044684 Bacteria 4319
400 Ga0466963_0011131 3300044694 Bacteria 5471
401 Ga0466964_0035547 3300044706 Bacteria 1993
402 Ga0466971_0004076 3300044719 Bacteria 6290
403 Ga0466971_0008858 3300044719 Bacteria 4394
404 Ga0466968_0016132 3300044735 Bacteria 2970
405 Ga0466970_0008585 3300044765 Bacteria 5145
406 Ga0466957_0001231 3300044842 Bacteria 13363
407 Ga0466957_0013168 3300044842 Bacteria 4795
408 Ga0466957_0057281 3300044842 Bacteria 2385
409 Ga0466960_0069039 3300044901 Bacteria 1755
410 Ga0466959_0039793 3300045049 Bacteria 3474
411 Ga0466959_0120759 3300045049 Bacteria 1863
412 Ga0466958_0000370 3300045836 Bacteria 18214
413 Ga0466967_0027334 3300045976 Bacteria 4744
414 Ga0495663_0000708 3300046525 Bacteria 11481
415 Ga0495621_0001243 3300046539 Bacteria 6572
416 Ga0495621_0002986 3300046539 Bacteria 4612
417 Ga0495633_0019376 3300046558 Bacteria 3443
418 Ga0495633_0032524 3300046558 Bacteria 2519
419 Ga0495668_0015168 3300046616 Bacteria 4505
420 Ga0495669_0000713 3300046684 Bacteria 14446
421 Ga0495669_0001304 3300046684 Bacteria 10327
422 Ga0495669_0022624 3300046684 Bacteria 2731
423 Ga0495670_0001844 3300046691 Bacteria 10423
424 Ga0495670_0002214 3300046691 Bacteria 9609
425 Ga0495670_0004865 3300046691 Bacteria 6594
426 Ga0496101_0216758 3300048904 Bacteria 1484
427 Ga0496103_0113248 3300048906 Bacteria 1724
428 Ga0496106_0078072 3300048909 Bacteria 2540
429 Ga0496108_0048686 3300048911 Bacteria 3543
430 Ga0496109_0007463 3300048912 Bacteria 9259
431 Ga0496109_0340606 3300048912 Bacteria 1416
432 Ga0496110_0003992 3300048913 Bacteria 11361
433 Ga0496110_0016884 3300048913 Bacteria 6100
434 Ga0496111_0004410 3300048914 Bacteria 8894
435 Ga0496112_0001135 3300048915 Bacteria 19819
436 Ga0496112_0031488 3300048915 Bacteria 5146
437 Ga0496113_0142504 3300048916 Bacteria 1886
438 Ga0496114_0000033 3300048917 Bacteria 166897
439 Ga0496114_0035034 3300048917 Bacteria 4144
440 Ga0501069_0035458 3300049585 Bacteria 2749
441 nmdc:mga0rr50_198134_c1 3300050513 Bacteria 1649
442 nmdc:mga0a205_9003_c1 3300050515 Bacteria 9098
443 Ga0466962_0002189 3300061719 Bacteria 9244
444 Ga0466962_0004901 3300061719 Bacteria 6438
445 Ga0466962_0072583 3300061719 Bacteria 1644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0340606 Ga0496109_0340606_22_1239 339
2 3300044901 Ga0466960_0069039 Ga0466960_0069039_11_1384 391
3 3300044719 Ga0466971_0008858 Ga0466971_0008858_1861_3276 396
4 3300061719 Ga0466962_0004901 Ga0466962_0004901_2000_3415 396
5 3300049585 Ga0501069_0035458 Ga0501069_0035458_105_1496 397
6 3300005327 Ga0070658_10003656 Ga0070658_100036566 399
7 3300005339 Ga0070660_100010845 Ga0070660_1000108455 399
8 3300025909 Ga0207705_10000469 Ga0207705_1000046928 399
9 3300025919 Ga0207657_10000864 Ga0207657_1000086428 399
10 3300037312 Ga0395899_0000352 Ga0395899_0000352_27598_29013 399
11 3300037418 Ga0395900_0001013 Ga0395900_0001013_28511_29926 399
12 3300038443 Ga0395901_0000047 Ga0395901_0000047_111376_112791 399
13 3300037418 Ga0395900_0163283 Ga0395900_0163283_434_1834 400
14 3300037471 Ga0395905_0002449 Ga0395905_0002449_15401_16801 400
15 3300009098 Ga0105245_10000679 Ga0105245_1000067922 402
16 3300009177 Ga0105248_10000122 Ga0105248_1000012261 402
17 3300011119 Ga0105246_10020713 Ga0105246_100207131 402
18 3300013102 Ga0157371_10002922 Ga0157371_1000292211 402
19 3300013297 Ga0157378_10000242 Ga0157378_100002425 402
20 3300014325 Ga0163163_10063793 Ga0163163_100637932 403
21 3300037418 Ga0395900_0032350 Ga0395900_0032350_500_1909 403
22 3300037466 Ga0395898_0039641 Ga0395898_0039641_3014_4423 403
23 3300044684 Ga0466966_0019286 Ga0466966_0019286_2638_4047 403
24 3300044842 Ga0466957_0013168 Ga0466957_0013168_1650_3059 403
25 3300044842 Ga0466957_0057281 Ga0466957_0057281_310_1719 403
26 3300046616 Ga0495668_0015168 Ga0495668_0015168_967_2376 403
27 3300001979 JGI24740J21852_10009753 JGI24740J21852_100097533 404
28 3300001989 JGI24739J22299_10000788 JGI24739J22299_100007888 404
29 3300001990 JGI24737J22298_10000588 JGI24737J22298_100005889 404
30 3300002075 JGI24738J21930_10000374 JGI24738J21930_100003745 404
31 3300002077 JGI24744J21845_10006662 JGI24744J21845_100066622 404
32 3300005327 Ga0070658_10013593 Ga0070658_100135935 404
33 3300005328 Ga0070676_10005464 Ga0070676_100054642 404
34 3300005329 Ga0070683_100084531 Ga0070683_1000845312 404
35 3300005331 Ga0070670_100023256 Ga0070670_1000232562 404
36 3300005331 Ga0070670_100081576 Ga0070670_1000815761 404
37 3300005334 Ga0068869_100000292 Ga0068869_10000029230 404
38 3300005335 Ga0070666_10030476 Ga0070666_100304761 404
39 3300005338 Ga0068868_100000321 Ga0068868_10000032135 404
40 3300005339 Ga0070660_100004355 Ga0070660_1000043555 404
41 3300005339 Ga0070660_100070134 Ga0070660_1000701342 404
42 3300005344 Ga0070661_100074476 Ga0070661_1000744762 404
43 3300005347 Ga0070668_100019522 Ga0070668_1000195224 404
44 3300005353 Ga0070669_100000605 Ga0070669_1000006052 404
45 3300005354 Ga0070675_100039676 Ga0070675_1000396763 404
46 3300005355 Ga0070671_100011299 Ga0070671_1000112993 404
47 3300005364 Ga0070673_100002977 Ga0070673_1000029775 404
48 3300005364 Ga0070673_100018051 Ga0070673_1000180512 404
49 3300005366 Ga0070659_100000469 Ga0070659_1000004692 404
50 3300005367 Ga0070667_100000966 Ga0070667_10000096619 404
51 3300005457 Ga0070662_100007006 Ga0070662_1000070065 404
52 3300005459 Ga0068867_100000045 Ga0068867_1000000452 404
53 3300005459 Ga0068867_100017540 Ga0068867_1000175402 404
54 3300005539 Ga0068853_100024220 Ga0068853_1000242204 404
55 3300005543 Ga0070672_100002199 Ga0070672_1000021998 404
56 3300005548 Ga0070665_100002237 Ga0070665_1000022372 404
57 3300005548 Ga0070665_100036969 Ga0070665_1000369694 404
58 3300005563 Ga0068855_100004924 Ga0068855_10000492411 404
59 3300005564 Ga0070664_100074931 Ga0070664_1000749312 404
60 3300005577 Ga0068857_100001199 Ga0068857_10000119911 404
61 3300005578 Ga0068854_100000234 Ga0068854_1000002343 404
62 3300005616 Ga0068852_100000509 Ga0068852_1000005092 404
63 3300005616 Ga0068852_100147082 Ga0068852_1001470822 404
64 3300005617 Ga0068859_100000709 Ga0068859_10000070931 404
65 3300005618 Ga0068864_100000484 Ga0068864_10000048431 404
66 3300005718 Ga0068866_10007335 Ga0068866_100073354 404
67 3300005841 Ga0068863_100016750 Ga0068863_1000167502 404
68 3300005842 Ga0068858_100004856 Ga0068858_10000485611 404
69 3300006881 Ga0068865_100003176 Ga0068865_1000031766 404
70 3300006931 Ga0097620_100000709 Ga0097620_10000070931 404
71 3300025315 Ga0207697_10000002 Ga0207697_1000000225 404
72 3300025321 Ga0207656_10016566 Ga0207656_100165662 404
73 3300025901 Ga0207688_10000348 Ga0207688_1000034819 404
74 3300025907 Ga0207645_10002184 Ga0207645_1000218415 404
75 3300025909 Ga0207705_10065714 Ga0207705_100657142 404
76 3300025919 Ga0207657_10010290 Ga0207657_100102904 404
77 3300025919 Ga0207657_10012068 Ga0207657_100120683 404
78 3300025925 Ga0207650_10068636 Ga0207650_100686362 404
79 3300025926 Ga0207659_10022509 Ga0207659_100225093 404
80 3300025927 Ga0207687_10000426 Ga0207687_1000042610 404
81 3300025931 Ga0207644_10001996 Ga0207644_1000199610 404
82 3300025931 Ga0207644_10011869 Ga0207644_100118691 404
83 3300025932 Ga0207690_10002752 Ga0207690_1000275210 404
84 3300025933 Ga0207706_10008226 Ga0207706_100082264 404
85 3300025938 Ga0207704_10007247 Ga0207704_100072472 404
86 3300025940 Ga0207691_10020070 Ga0207691_100200704 404
87 3300025941 Ga0207711_10001807 Ga0207711_100018079 404
88 3300025942 Ga0207689_10000125 Ga0207689_100001254 404
89 3300025949 Ga0207667_10001485 Ga0207667_1000148517 404
90 3300025960 Ga0207651_10000306 Ga0207651_1000030610 404
91 3300025972 Ga0207668_10014373 Ga0207668_100143732 404
92 3300025981 Ga0207640_10000349 Ga0207640_100003499 404
93 3300025981 Ga0207640_10007205 Ga0207640_100072052 404
94 3300025981 Ga0207640_10079615 Ga0207640_100796152 404
95 3300025986 Ga0207658_10030597 Ga0207658_100305972 404
96 3300026023 Ga0207677_10000758 Ga0207677_100007582 404
97 3300026035 Ga0207703_10004195 Ga0207703_1000419511 404
98 3300026041 Ga0207639_10000400 Ga0207639_1000040021 404
99 3300026067 Ga0207678_10012099 Ga0207678_100120994 404
100 3300026088 Ga0207641_10205507 Ga0207641_102055072 404
101 3300026089 Ga0207648_10000088 Ga0207648_100000885 404
102 3300026089 Ga0207648_10004355 Ga0207648_1000435512 404
103 3300026095 Ga0207676_10005481 Ga0207676_100054814 404
104 3300026116 Ga0207674_10011360 Ga0207674_100113609 404
105 3300026116 Ga0207674_10012182 Ga0207674_100121824 404
106 3300026142 Ga0207698_10020596 Ga0207698_100205962 404
107 3300026142 Ga0207698_10077828 Ga0207698_100778281 404
108 3300028379 Ga0268266_10000437 Ga0268266_100004373 404
109 3300028380 Ga0268265_10054219 Ga0268265_100542192 404
110 3300037418 Ga0395900_0010908 Ga0395900_0010908_7615_9027 404
111 3300037466 Ga0395898_0138415 Ga0395898_0138415_521_1933 404
112 3300037471 Ga0395905_0090314 Ga0395905_0090314_914_2326 404
113 3300038443 Ga0395901_0134702 Ga0395901_0134702_720_2132 404
114 3300039437 Ga0436365_1844112 Ga0436365_1844112_6875_8287 404
115 3300001990 JGI24737J22298_10000536 JGI24737J22298_100005368 405
116 3300005290 Ga0065712_10083552 Ga0065712_100835522 405
117 3300005327 Ga0070658_10012748 Ga0070658_100127484 405
118 3300005327 Ga0070658_10015704 Ga0070658_100157043 405
119 3300005329 Ga0070683_100007812 Ga0070683_1000078126 405
120 3300005330 Ga0070690_100016061 Ga0070690_1000160612 405
121 3300005330 Ga0070690_100042422 Ga0070690_1000424222 405
122 3300005331 Ga0070670_100001608 Ga0070670_1000016088 405
123 3300005331 Ga0070670_100015697 Ga0070670_1000156974 405
124 3300005331 Ga0070670_100064984 Ga0070670_1000649842 405
125 3300005331 Ga0070670_100066633 Ga0070670_1000666332 405
126 3300005335 Ga0070666_10001330 Ga0070666_1000133012 405
127 3300005336 Ga0070680_100124943 Ga0070680_1001249432 405
128 3300005338 Ga0068868_100004528 Ga0068868_1000045289 405
129 3300005339 Ga0070660_100010047 Ga0070660_1000100471 405
130 3300005339 Ga0070660_100015268 Ga0070660_1000152685 405
131 3300005339 Ga0070660_100019429 Ga0070660_1000194293 405
132 3300005344 Ga0070661_100015006 Ga0070661_1000150064 405
133 3300005344 Ga0070661_100055232 Ga0070661_1000552321 405
134 3300005345 Ga0070692_10030777 Ga0070692_100307772 405
135 3300005347 Ga0070668_100000496 Ga0070668_10000049629 405
136 3300005347 Ga0070668_100085641 Ga0070668_1000856412 405
137 3300005353 Ga0070669_100017633 Ga0070669_1000176333 405
138 3300005353 Ga0070669_100026216 Ga0070669_1000262163 405
139 3300005353 Ga0070669_100069529 Ga0070669_1000695291 405
140 3300005353 Ga0070669_100110307 Ga0070669_1001103072 405
141 3300005354 Ga0070675_100002680 Ga0070675_1000026802 405
142 3300005355 Ga0070671_100002159 Ga0070671_10000215910 405
143 3300005356 Ga0070674_100007014 Ga0070674_1000070142 405
144 3300005356 Ga0070674_100007031 Ga0070674_1000070314 405
145 3300005356 Ga0070674_100029369 Ga0070674_1000293692 405
146 3300005364 Ga0070673_100005659 Ga0070673_1000056593 405
147 3300005364 Ga0070673_100060553 Ga0070673_1000605532 405
148 3300005366 Ga0070659_100016018 Ga0070659_1000160184 405
149 3300005366 Ga0070659_100044206 Ga0070659_1000442063 405
150 3300005366 Ga0070659_100154549 Ga0070659_1001545492 405
151 3300005367 Ga0070667_100001224 Ga0070667_10000122417 405
152 3300005367 Ga0070667_100107362 Ga0070667_1001073622 405
153 3300005435 Ga0070714_100073699 Ga0070714_1000736992 405
154 3300005455 Ga0070663_100015089 Ga0070663_1000150892 405
155 3300005455 Ga0070663_100115880 Ga0070663_1001158801 405
156 3300005456 Ga0070678_100016258 Ga0070678_1000162582 405
157 3300005456 Ga0070678_100019309 Ga0070678_1000193094 405
158 3300005457 Ga0070662_100004149 Ga0070662_1000041491 405
159 3300005457 Ga0070662_100010952 Ga0070662_1000109522 405
160 3300005457 Ga0070662_100057501 Ga0070662_1000575012 405
161 3300005457 Ga0070662_100081202 Ga0070662_1000812022 405
162 3300005457 Ga0070662_100119781 Ga0070662_1001197812 405
163 3300005543 Ga0070672_100016719 Ga0070672_1000167194 405
164 3300005543 Ga0070672_100024823 Ga0070672_1000248234 405
165 3300005543 Ga0070672_100037584 Ga0070672_1000375843 405
166 3300005544 Ga0070686_100044914 Ga0070686_1000449142 405
167 3300005547 Ga0070693_100025252 Ga0070693_1000252522 405
168 3300005548 Ga0070665_100032530 Ga0070665_1000325304 405
169 3300005548 Ga0070665_100042231 Ga0070665_1000422314 405
170 3300005563 Ga0068855_100015292 Ga0068855_1000152925 405
171 3300005563 Ga0068855_100093999 Ga0068855_1000939992 405
172 3300005564 Ga0070664_100003389 Ga0070664_1000033893 405
173 3300005564 Ga0070664_100004845 Ga0070664_1000048455 405
174 3300005564 Ga0070664_100018908 Ga0070664_1000189082 405
175 3300005564 Ga0070664_100041445 Ga0070664_1000414452 405
176 3300005564 Ga0070664_100081412 Ga0070664_1000814122 405
177 3300005564 Ga0070664_100087313 Ga0070664_1000873132 405
178 3300005577 Ga0068857_100001788 Ga0068857_1000017885 405
179 3300005577 Ga0068857_100005037 Ga0068857_10000503711 405
180 3300005578 Ga0068854_100018349 Ga0068854_1000183493 405
181 3300005614 Ga0068856_100016117 Ga0068856_1000161174 405
182 3300005616 Ga0068852_100053753 Ga0068852_1000537531 405
183 3300005617 Ga0068859_100042766 Ga0068859_1000427662 405
184 3300005617 Ga0068859_100047690 Ga0068859_1000476902 405
185 3300005618 Ga0068864_100073299 Ga0068864_1000732992 405
186 3300005834 Ga0068851_10043536 Ga0068851_100435362 405
187 3300005841 Ga0068863_100006290 Ga0068863_1000062902 405
188 3300005841 Ga0068863_100012929 Ga0068863_1000129294 405
189 3300005841 Ga0068863_100036187 Ga0068863_1000361872 405
190 3300005842 Ga0068858_100001269 Ga0068858_10000126915 405
191 3300005842 Ga0068858_100022193 Ga0068858_1000221935 405
192 3300005843 Ga0068860_100024266 Ga0068860_1000242662 405
193 3300005843 Ga0068860_100034001 Ga0068860_1000340012 405
194 3300005843 Ga0068860_100241496 Ga0068860_1002414962 405
195 3300005844 Ga0068862_100059138 Ga0068862_1000591382 405
196 3300005985 Ga0081539_10007149 Ga0081539_100071495 405
197 3300006852 Ga0075433_10029462 Ga0075433_100294624 405
198 3300006931 Ga0097620_100042768 Ga0097620_1000427682 405
199 3300006931 Ga0097620_100047690 Ga0097620_1000476902 405
200 3300007076 Ga0075435_100083608 Ga0075435_1000836082 405
201 3300009093 Ga0105240_10011453 Ga0105240_100114538 405
202 3300009148 Ga0105243_10028921 Ga0105243_100289212 405
203 3300009148 Ga0105243_10174159 Ga0105243_101741592 405
204 3300009174 Ga0105241_10110207 Ga0105241_101102072 405
205 3300009177 Ga0105248_10037366 Ga0105248_100373663 405
206 3300009177 Ga0105248_10039282 Ga0105248_100392823 405
207 3300009551 Ga0105238_10161302 Ga0105238_101613022 405
208 3300009553 Ga0105249_10034144 Ga0105249_100341443 405
209 3300009553 Ga0105249_10091040 Ga0105249_100910402 405
210 3300011119 Ga0105246_10073388 Ga0105246_100733882 405
211 3300013102 Ga0157371_10008367 Ga0157371_100083675 405
212 3300013104 Ga0157370_10184075 Ga0157370_101840752 405
213 3300013105 Ga0157369_10001135 Ga0157369_1000113515 405
214 3300013105 Ga0157369_10003392 Ga0157369_1000339215 405
215 3300013105 Ga0157369_10014979 Ga0157369_100149793 405
216 3300013105 Ga0157369_10027545 Ga0157369_100275454 405
217 3300013297 Ga0157378_10009348 Ga0157378_100093483 405
218 3300013306 Ga0163162_10057864 Ga0163162_100578641 405
219 3300013306 Ga0163162_10245179 Ga0163162_102451792 405
220 3300013308 Ga0157375_10040306 Ga0157375_100403063 405
221 3300013308 Ga0157375_10158805 Ga0157375_101588052 405
222 3300014745 Ga0157377_10014637 Ga0157377_100146372 405
223 3300014969 Ga0157376_10128495 Ga0157376_101284952 405
224 3300021388 Ga0213875_10005523 Ga0213875_100055236 405
225 3300025903 Ga0207680_10022109 Ga0207680_100221092 405
226 3300025904 Ga0207647_10002492 Ga0207647_1000249211 405
227 3300025904 Ga0207647_10009195 Ga0207647_100091954 405
228 3300025907 Ga0207645_10003169 Ga0207645_100031693 405
229 3300025909 Ga0207705_10002865 Ga0207705_1000286512 405
230 3300025913 Ga0207695_10013445 Ga0207695_100134459 405
231 3300025917 Ga0207660_10075678 Ga0207660_100756782 405
232 3300025919 Ga0207657_10015005 Ga0207657_100150054 405
233 3300025919 Ga0207657_10021185 Ga0207657_100211852 405
234 3300025919 Ga0207657_10026809 Ga0207657_100268095 405
235 3300025919 Ga0207657_10046964 Ga0207657_100469642 405
236 3300025920 Ga0207649_10008672 Ga0207649_100086724 405
237 3300025920 Ga0207649_10045749 Ga0207649_100457492 405
238 3300025921 Ga0207652_10152525 Ga0207652_101525252 405
239 3300025923 Ga0207681_10003749 Ga0207681_100037493 405
240 3300025923 Ga0207681_10123688 Ga0207681_101236881 405
241 3300025925 Ga0207650_10010465 Ga0207650_100104654 405
242 3300025925 Ga0207650_10014878 Ga0207650_100148785 405
243 3300025925 Ga0207650_10074759 Ga0207650_100747592 405
244 3300025926 Ga0207659_10002913 Ga0207659_1000291310 405
245 3300025926 Ga0207659_10042225 Ga0207659_100422252 405
246 3300025926 Ga0207659_10128142 Ga0207659_101281421 405
247 3300025928 Ga0207700_10045223 Ga0207700_100452232 405
248 3300025931 Ga0207644_10000216 Ga0207644_1000021614 405
249 3300025931 Ga0207644_10018766 Ga0207644_100187664 405
250 3300025931 Ga0207644_10112264 Ga0207644_101122641 405
251 3300025931 Ga0207644_10195884 Ga0207644_101958842 405
252 3300025932 Ga0207690_10006495 Ga0207690_100064955 405
253 3300025932 Ga0207690_10180266 Ga0207690_101802662 405
254 3300025933 Ga0207706_10003590 Ga0207706_1000359014 405
255 3300025933 Ga0207706_10027025 Ga0207706_100270254 405
256 3300025933 Ga0207706_10031062 Ga0207706_100310623 405
257 3300025933 Ga0207706_10049358 Ga0207706_100493582 405
258 3300025933 Ga0207706_10057330 Ga0207706_100573302 405
259 3300025933 Ga0207706_10059272 Ga0207706_100592723 405
260 3300025933 Ga0207706_10088082 Ga0207706_100880822 405
261 3300025935 Ga0207709_10106353 Ga0207709_101063532 405
262 3300025937 Ga0207669_10012331 Ga0207669_100123313 405
263 3300025937 Ga0207669_10026284 Ga0207669_100262842 405
264 3300025938 Ga0207704_10031129 Ga0207704_100311291 405
265 3300025940 Ga0207691_10023337 Ga0207691_100233374 405
266 3300025940 Ga0207691_10032200 Ga0207691_100322004 405
267 3300025940 Ga0207691_10048106 Ga0207691_100481062 405
268 3300025940 Ga0207691_10090272 Ga0207691_100902722 405
269 3300025941 Ga0207711_10000787 Ga0207711_1000078717 405
270 3300025941 Ga0207711_10022481 Ga0207711_100224814 405
271 3300025941 Ga0207711_10065354 Ga0207711_100653542 405
272 3300025941 Ga0207711_10111901 Ga0207711_101119012 405
273 3300025941 Ga0207711_10213636 Ga0207711_102136362 405
274 3300025942 Ga0207689_10026690 Ga0207689_100266904 405
275 3300025942 Ga0207689_10055939 Ga0207689_100559392 405
276 3300025945 Ga0207679_10042643 Ga0207679_100426432 405
277 3300025945 Ga0207679_10124710 Ga0207679_101247102 405
278 3300025949 Ga0207667_10003653 Ga0207667_1000365315 405
279 3300025949 Ga0207667_10040349 Ga0207667_100403493 405
280 3300025949 Ga0207667_10084677 Ga0207667_100846772 405
281 3300025960 Ga0207651_10008501 Ga0207651_100085013 405
282 3300025960 Ga0207651_10014732 Ga0207651_100147323 405
283 3300025960 Ga0207651_10027779 Ga0207651_100277792 405
284 3300025960 Ga0207651_10123927 Ga0207651_101239272 405
285 3300025961 Ga0207712_10047970 Ga0207712_100479702 405
286 3300025972 Ga0207668_10002041 Ga0207668_100020413 405
287 3300025981 Ga0207640_10004806 Ga0207640_100048062 405
288 3300025986 Ga0207658_10007700 Ga0207658_100077003 405
289 3300026023 Ga0207677_10010999 Ga0207677_100109993 405
290 3300026023 Ga0207677_10018324 Ga0207677_100183243 405
291 3300026035 Ga0207703_10011318 Ga0207703_100113183 405
292 3300026041 Ga0207639_10029103 Ga0207639_100291032 405
293 3300026067 Ga0207678_10057525 Ga0207678_100575252 405
294 3300026067 Ga0207678_10093918 Ga0207678_100939182 405
295 3300026078 Ga0207702_10011116 Ga0207702_100111162 405
296 3300026078 Ga0207702_10155003 Ga0207702_101550032 405
297 3300026088 Ga0207641_10007396 Ga0207641_100073964 405
298 3300026088 Ga0207641_10101206 Ga0207641_101012061 405
299 3300026089 Ga0207648_10001235 Ga0207648_1000123531 405
300 3300026089 Ga0207648_10005627 Ga0207648_100056271 405
301 3300026089 Ga0207648_10006996 Ga0207648_100069969 405
302 3300026095 Ga0207676_10010877 Ga0207676_100108772 405
303 3300026095 Ga0207676_10130218 Ga0207676_101302182 405
304 3300026116 Ga0207674_10000082 Ga0207674_1000008226 405
305 3300026116 Ga0207674_10002496 Ga0207674_1000249616 405
306 3300026116 Ga0207674_10014461 Ga0207674_100144617 405
307 3300026116 Ga0207674_10021151 Ga0207674_100211514 405
308 3300026121 Ga0207683_10041987 Ga0207683_100419872 405
309 3300026142 Ga0207698_10028883 Ga0207698_100288831 405
310 3300026142 Ga0207698_10307679 Ga0207698_103076791 405
311 3300028379 Ga0268266_10019130 Ga0268266_100191305 405
312 3300028379 Ga0268266_10061201 Ga0268266_100612012 405
313 3300028381 Ga0268264_10003191 Ga0268264_1000319115 405
314 3300028381 Ga0268264_10010496 Ga0268264_100104964 405
315 3300028381 Ga0268264_10113883 Ga0268264_101138832 405
316 3300031824 Ga0307413_10002398 Ga0307413_100023982 405
317 3300031824 Ga0307413_10085179 Ga0307413_100851792 405
318 3300031852 Ga0307410_10001002 Ga0307410_1000100210 405
319 3300031852 Ga0307410_10009458 Ga0307410_100094583 405
320 3300031852 Ga0307410_10014368 Ga0307410_100143682 405
321 3300031901 Ga0307406_10027349 Ga0307406_100273492 405
322 3300031901 Ga0307406_10047285 Ga0307406_100472852 405
323 3300031903 Ga0307407_10012470 Ga0307407_100124702 405
324 3300031911 Ga0307412_10045062 Ga0307412_100450622 405
325 3300031911 Ga0307412_10059028 Ga0307412_100590282 405
326 3300032004 Ga0307414_10010040 Ga0307414_100100403 405
327 3300032004 Ga0307414_10042101 Ga0307414_100421012 405
328 3300032005 Ga0307411_10029172 Ga0307411_100291722 405
329 3300037312 Ga0395899_0000140 Ga0395899_0000140_73383_74798 405
330 3300037312 Ga0395899_0010760 Ga0395899_0010760_4989_6404 405
331 3300037312 Ga0395899_0017186 Ga0395899_0017186_4042_5457 405
332 3300037312 Ga0395899_0054979 Ga0395899_0054979_1512_2927 405
333 3300037312 Ga0395899_0073056 Ga0395899_0073056_1058_2473 405
334 3300037418 Ga0395900_0000075 Ga0395900_0000075_150241_151656 405
335 3300037418 Ga0395900_0016159 Ga0395900_0016159_1392_2807 405
336 3300037418 Ga0395900_0019023 Ga0395900_0019023_949_2364 405
337 3300037418 Ga0395900_0024278 Ga0395900_0024278_318_1733 405
338 3300037418 Ga0395900_0044511 Ga0395900_0044511_293_1708 405
339 3300037418 Ga0395900_0049617 Ga0395900_0049617_1770_3185 405
340 3300037418 Ga0395900_0051072 Ga0395900_0051072_275_1690 405
341 3300037418 Ga0395900_0052650 Ga0395900_0052650_2533_3948 405
342 3300037418 Ga0395900_0055215 Ga0395900_0055215_349_1764 405
343 3300037418 Ga0395900_0080273 Ga0395900_0080273_317_1732 405
344 3300037418 Ga0395900_0157786 Ga0395900_0157786_245_1660 405
345 3300037466 Ga0395898_0000055 Ga0395898_0000055_35182_36597 405
346 3300037466 Ga0395898_0021365 Ga0395898_0021365_222_1637 405
347 3300037466 Ga0395898_0048931 Ga0395898_0048931_151_1566 405
348 3300037466 Ga0395898_0089475 Ga0395898_0089475_36_1451 405
349 3300037466 Ga0395898_0194907 Ga0395898_0194907_257_1672 405
350 3300037471 Ga0395905_0000089 Ga0395905_0000089_90581_91996 405
351 3300037471 Ga0395905_0004013 Ga0395905_0004013_7017_8432 405
352 3300037471 Ga0395905_0010264 Ga0395905_0010264_7651_9066 405
353 3300037471 Ga0395905_0015172 Ga0395905_0015172_2096_3517 405
354 3300037471 Ga0395905_0019794 Ga0395905_0019794_533_1960 405
355 3300037471 Ga0395905_0032860 Ga0395905_0032860_2851_4266 405
356 3300037471 Ga0395905_0034139 Ga0395905_0034139_1201_2616 405
357 3300037471 Ga0395905_0037176 Ga0395905_0037176_1705_3120 405
358 3300037471 Ga0395905_0047923 Ga0395905_0047923_174_1589 405
359 3300037471 Ga0395905_0051706 Ga0395905_0051706_2134_3549 405
360 3300037471 Ga0395905_0076742 Ga0395905_0076742_1298_2713 405
361 3300037471 Ga0395905_0079117 Ga0395905_0079117_1438_2853 405
362 3300037471 Ga0395905_0139212 Ga0395905_0139212_815_2230 405
363 3300037853 Ga0436364_1258768 Ga0436364_1258768_12012_13427 405
364 3300038443 Ga0395901_0000168 Ga0395901_0000168_58669_60084 405
365 3300038443 Ga0395901_0000885 Ga0395901_0000885_24592_26007 405
366 3300038443 Ga0395901_0008637 Ga0395901_0008637_3699_5114 405
367 3300038443 Ga0395901_0031611 Ga0395901_0031611_3087_4502 405
368 3300038443 Ga0395901_0050198 Ga0395901_0050198_2411_3826 405
369 3300038443 Ga0395901_0069236 Ga0395901_0069236_1355_2782 405
370 3300038443 Ga0395901_0250656 Ga0395901_0250656_54_1469 405
371 3300038443 Ga0395901_0287704 Ga0395901_0287704_193_1608 405
372 3300042157 Ga0439458_0000050 Ga0439458_0000050_14360_15775 405
373 3300042157 Ga0439458_0001138 Ga0439458_0001138_1286_2701 405
374 3300044656 Ga0466969_0001195 Ga0466969_0001195_1530_2945 405
375 3300044656 Ga0466969_0021041 Ga0466969_0021041_717_2132 405
376 3300044684 Ga0466966_0000077 Ga0466966_0000077_13016_14431 405
377 3300044684 Ga0466966_0000965 Ga0466966_0000965_14237_15652 405
378 3300044684 Ga0466966_0003521 Ga0466966_0003521_3939_5354 405
379 3300044684 Ga0466966_0020735 Ga0466966_0020735_256_1671 405
380 3300044694 Ga0466963_0011131 Ga0466963_0011131_1449_2864 405
381 3300044706 Ga0466964_0035547 Ga0466964_0035547_390_1805 405
382 3300044719 Ga0466971_0004076 Ga0466971_0004076_4732_6147 405
383 3300044735 Ga0466968_0016132 Ga0466968_0016132_750_2165 405
384 3300044765 Ga0466970_0008585 Ga0466970_0008585_1186_2601 405
385 3300044842 Ga0466957_0001231 Ga0466957_0001231_6031_7446 405
386 3300045049 Ga0466959_0039793 Ga0466959_0039793_645_2060 405
387 3300045049 Ga0466959_0120759 Ga0466959_0120759_146_1561 405
388 3300045836 Ga0466958_0000370 Ga0466958_0000370_14274_15689 405
389 3300045976 Ga0466967_0027334 Ga0466967_0027334_2747_4168 405
390 3300046525 Ga0495663_0000708 Ga0495663_0000708_5366_6793 405
391 3300046539 Ga0495621_0001243 Ga0495621_0001243_4480_5907 405
392 3300046539 Ga0495621_0002986 Ga0495621_0002986_2881_4296 405
393 3300046558 Ga0495633_0019376 Ga0495633_0019376_343_1758 405
394 3300046558 Ga0495633_0032524 Ga0495633_0032524_687_2114 405
395 3300046684 Ga0495669_0000713 Ga0495669_0000713_5751_7178 405
396 3300046684 Ga0495669_0001304 Ga0495669_0001304_8054_9481 405
397 3300046684 Ga0495669_0022624 Ga0495669_0022624_943_2358 405
398 3300046691 Ga0495670_0001844 Ga0495670_0001844_3384_4799 405
399 3300046691 Ga0495670_0002214 Ga0495670_0002214_516_1943 405
400 3300046691 Ga0495670_0004865 Ga0495670_0004865_3629_5044 405
401 3300048904 Ga0496101_0216758 Ga0496101_0216758_28_1443 405
402 3300048906 Ga0496103_0113248 Ga0496103_0113248_94_1509 405
403 3300048909 Ga0496106_0078072 Ga0496106_0078072_41_1456 405
404 3300048911 Ga0496108_0048686 Ga0496108_0048686_1635_3050 405
405 3300048912 Ga0496109_0007463 Ga0496109_0007463_3407_4822 405
406 3300048913 Ga0496110_0003992 Ga0496110_0003992_2228_3655 405
407 3300048913 Ga0496110_0016884 Ga0496110_0016884_4461_5876 405
408 3300048914 Ga0496111_0004410 Ga0496111_0004410_1425_2840 405
409 3300048915 Ga0496112_0001135 Ga0496112_0001135_6397_7812 405
410 3300048915 Ga0496112_0031488 Ga0496112_0031488_2898_4313 405
411 3300048916 Ga0496113_0142504 Ga0496113_0142504_34_1449 405
412 3300048917 Ga0496114_0000033 Ga0496114_0000033_90044_91459 405
413 3300048917 Ga0496114_0035034 Ga0496114_0035034_2632_4047 405
414 3300050513 nmdc:mga0rr50_198134_c1 nmdc:mga0rr50_198134_c1_171_1586 405
415 3300050515 nmdc:mga0a205_9003_c1 nmdc:mga0a205_9003_c1_254_1669 405
416 3300061719 Ga0466962_0002189 Ga0466962_0002189_2517_3932 405
417 3300061719 Ga0466962_0072583 Ga0466962_0072583_76_1491 405
418 3300005339 Ga0070660_100076307 Ga0070660_1000763072 407
419 3300005355 Ga0070671_100000424 Ga0070671_1000004247 407
420 3300005366 Ga0070659_100002289 Ga0070659_10000228911 407
421 3300005985 Ga0081539_10025412 Ga0081539_100254122 407
422 3300013104 Ga0157370_10030192 Ga0157370_100301923 407
423 3300013307 Ga0157372_10289390 Ga0157372_102893902 407
424 3300025931 Ga0207644_10010794 Ga0207644_100107944 407
425 3300025932 Ga0207690_10002194 Ga0207690_100021944 407
426 3300031995 Ga0307409_100011192 Ga0307409_1000111922 407
427 3300032126 Ga0307415_100048552 Ga0307415_1000485522 407
428 3300037312 Ga0395899_0002234 Ga0395899_0002234_7785_9206 407
429 3300037418 Ga0395900_0006343 Ga0395900_0006343_8216_9637 407
430 3300037471 Ga0395905_0006411 Ga0395905_0006411_7713_9134 407
431 3300038443 Ga0395901_0005164 Ga0395901_0005164_3543_4964 407
432 3300001979 JGI24740J21852_10004665 JGI24740J21852_100046655 409
433 3300005329 Ga0070683_100030632 Ga0070683_1000306322 409
434 3300005339 Ga0070660_100022353 Ga0070660_1000223534 409
435 3300005455 Ga0070663_100013273 Ga0070663_1000132732 409
436 3300005458 Ga0070681_10032985 Ga0070681_100329854 409
437 3300005535 Ga0070684_100012962 Ga0070684_1000129624 409
438 3300005563 Ga0068855_100012260 Ga0068855_1000122602 409
439 3300005614 Ga0068856_100033010 Ga0068856_1000330102 409
440 3300025904 Ga0207647_10022887 Ga0207647_100228872 409
441 3300025919 Ga0207657_10000797 Ga0207657_100007974 409
442 3300025944 Ga0207661_10059943 Ga0207661_100599432 409
443 3300025949 Ga0207667_10045253 Ga0207667_100452532 409
444 3300026067 Ga0207678_10002432 Ga0207678_1000243215 409
445 3300026078 Ga0207702_10159986 Ga0207702_101599862 409

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02875

Mur_ligase_C

Mur ligase, glutamate ligase domain

313

437

0.93

PF08245

Mur_ligase_M

Mur ligase middle domain

97

291

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1e8c-assembly1.cif.gz_A structure of mure the udp-n-acetylmuramyl tripeptide synthetase from e. coli 0.8198 1 398
1e8c-assembly1.cif.gz_A structure of mure the udp-n-acetylmuramyl tripeptide synthetase from e. coli 0.8053 1 398
4c12-assembly1.cif.gz_A x-ray crystal structure of staphylococcus aureus mure with udp-murnac- ala-glu-lys and adp 0.8049 10 398
2xja-assembly1.cif.gz_A structure of mure from m.tuberculosis with dipeptide and adp 0.8019 1 398
2xja-assembly3.cif.gz_C structure of mure from m.tuberculosis with dipeptide and adp 0.7989 1 398
ID Description Score Start End Superfamily
4c13A02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.8897 85 320 3.40.1190.10
4c13A02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.8827 85 320 3.40.1190.10
1e8cA02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.8771 85 319 3.40.1190.10
1e8cA02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.8735 85 319 3.40.1190.10
af_P71834_35_262_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8732 249 280 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A529VRL8-F1-model_v4 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9633 178 295 GO:0005524
GO:0009058
GO:0016881
AF-A0A529VRL8-F1-model_v4 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9476 178 295 GO:0005524
GO:0009058
GO:0016881
AF-A0A3S1Q2K8-F1-model_v4 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9432 95 248 GO:0005524
GO:0009058
GO:0016881
AF-Q5D5I5-F1-model_v4 deleted 0.9361 162 292
AF-A0A0A0CWN4-F1-model_v4 UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9325 66 336 GO:0005524
GO:0009058
GO:0016881

Feature Viewer

pLDDT pTM Quality
80.18 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map