F445626

General Info

Members Datasets Scaffolds Average Seq Length
445 233 890 134

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_1136866|Ga0501082_1136866_251_655
Length 134
Sequence MDSAEIHLDTARRRIVDVTGDAADFCRDRGDGLLHVFLPHATAGLAVIETGAGSDDDLLAALGDLLPKDDRWRHRHGSPGHGRSHVMPALIPPYASVPVLGGRLALGTWQSICLVDLNVDNDVREVRFSFLVGA

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
127 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
141 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
142 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
169 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
172 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 6.07
Rhizosphere 93.48
Stem 0
Stem Tuber 0
Unclassified 8.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_1136866 3300060353 Bacteria 683
2 Ga0070690_100229216 3300005330 Bacteria 1305
3 Ga0070680_100583035 3300005336 Unclassified 959
4 Ga0068868_100013277 3300005338 Bacteria 6036
5 Ga0068868_100166289 3300005338 Bacteria 1824
6 Ga0068868_100458305 3300005338 Bacteria 1110
7 Ga0068868_101246389 3300005338 Unclassified 689
8 Ga0070689_100571269 3300005340 Unclassified 976
9 Ga0070689_101478401 3300005340 Bacteria 615
10 Ga0070691_10046546 3300005341 Bacteria 2061
11 Ga0070691_10055373 3300005341 Bacteria 1900
12 Ga0070691_10078429 3300005341 Unclassified 1613
13 Ga0070692_11122166 3300005345 Bacteria 556
14 Ga0070668_101268176 3300005347 Bacteria 669
15 Ga0070675_100230993 3300005354 Bacteria 1614
16 Ga0070671_100011264 3300005355 Bacteria 7185
17 Ga0070674_100011807 3300005356 Bacteria 5333
18 Ga0070673_100237877 3300005364 Bacteria 1582
19 Ga0070673_100682140 3300005364 Bacteria 942
20 Ga0070659_100715344 3300005366 Bacteria 867
21 Ga0070703_10126566 3300005406 Unclassified 933
22 Ga0070710_10199967 3300005437 Bacteria 1261
23 Ga0070701_10022178 3300005438 Bacteria 3041
24 Ga0070711_100001030 3300005439 Bacteria 14823
25 Ga0070705_100781491 3300005440 Bacteria 758
26 Ga0070700_100027390 3300005441 Bacteria 3378
27 Ga0070700_100122687 3300005441 Bacteria 1743
28 Ga0070700_100409847 3300005441 Bacteria 1021
29 Ga0070694_100051266 3300005444 Unclassified 2785
30 Ga0070694_100630915 3300005444 Unclassified 866
31 Ga0070708_100087897 3300005445 Bacteria 2825
32 Ga0070663_100676168 3300005455 Bacteria 875
33 Ga0070663_101126235 3300005455 Bacteria 687
34 Ga0070678_100035725 3300005456 Bacteria 3473
35 Ga0070678_100186888 3300005456 Bacteria 1700
36 Ga0068867_100001651 3300005459 Bacteria 15512
37 Ga0068867_100156474 3300005459 Bacteria 1794
38 Ga0070706_100083220 3300005467 Bacteria 2964
39 Ga0070707_100110309 3300005468 Bacteria 2668
40 Ga0070698_100007499 3300005471 Bacteria 11803
41 Ga0070699_100074868 3300005518 Unclassified 2946
42 Ga0070699_102009003 3300005518 Bacteria 528
43 Ga0070679_100657303 3300005530 Bacteria 991
44 Ga0070684_100224829 3300005535 Bacteria 1713
45 Ga0070697_100465061 3300005536 Bacteria 1103
46 Ga0070697_100604614 3300005536 Unclassified 964
47 Ga0070672_100297727 3300005543 Bacteria 1367
48 Ga0070686_100049401 3300005544 Bacteria 2669
49 Ga0070686_100151308 3300005544 Bacteria 1625
50 Ga0070686_100655452 3300005544 Bacteria 833
51 Ga0070686_101088028 3300005544 Bacteria 660
52 Ga0070695_100010191 3300005545 Bacteria 5607
53 Ga0070696_100001811 3300005546 Bacteria 14028
54 Ga0070693_100480487 3300005547 Bacteria 878
55 Ga0070704_100033394 3300005549 Bacteria 3478
56 Ga0070704_100304649 3300005549 Bacteria 1329
57 Ga0070704_100561819 3300005549 Bacteria 998
58 Ga0070704_100581443 3300005549 Bacteria 982
59 Ga0070664_100637412 3300005564 Bacteria 990
60 Ga0068854_100746694 3300005578 Bacteria 848
61 Ga0070702_100021821 3300005615 Bacteria 3377
62 Ga0070702_100303640 3300005615 Unclassified 1105
63 Ga0068864_100063303 3300005618 Bacteria 3205
64 Ga0068866_10005516 3300005718 Bacteria 5227
65 Ga0068866_10005751 3300005718 Bacteria 5139
66 Ga0068851_10055426 3300005834 Bacteria 2020
67 Ga0068858_100063612 3300005842 Bacteria 3414
68 Ga0068860_100224162 3300005843 Bacteria 1826
69 Ga0068860_101576874 3300005843 Bacteria 678
70 Ga0081539_10016295 3300005985 Bacteria 5322
71 Ga0081539_10084231 3300005985 Unclassified 1662
72 Ga0075364_11119044 3300006051 Bacteria 534
73 Ga0070715_10231218 3300006163 Unclassified 956
74 Ga0070712_100009446 3300006175 Bacteria 6146
75 Ga0097621_100104786 3300006237 Bacteria 2383
76 Ga0068871_100133182 3300006358 Bacteria 2109
77 Ga0075428_100018995 3300006844 Bacteria 7602
78 Ga0075430_100000779 3300006846 Bacteria 24656
79 Ga0075431_100002621 3300006847 Bacteria 17398
80 Ga0075429_100002364 3300006880 Bacteria 15877
81 Ga0068865_100147899 3300006881 Bacteria 1779
82 Ga0105245_10090225 3300009098 Bacteria 2819
83 Ga0105245_10106589 3300009098 Bacteria 2600
84 Ga0105245_10638077 3300009098 Bacteria 1094
85 Ga0105245_11431430 3300009098 Bacteria 741
86 Ga0105245_11775961 3300009098 Bacteria 669
87 Ga0105245_12404975 3300009098 Bacteria 580
88 Ga0105245_12888054 3300009098 Unclassified 533
89 Ga0105247_10085682 3300009101 Bacteria 1993
90 Ga0114129_10098933 3300009147 Bacteria 4037
91 Ga0114129_10167645 3300009147 Bacteria 2996
92 Ga0114129_10237505 3300009147 Bacteria 2451
93 Ga0114129_10884829 3300009147 Bacteria 1133
94 Ga0105243_10001605 3300009148 Bacteria 19707
95 Ga0105243_10002990 3300009148 Bacteria 13973
96 Ga0105241_10240551 3300009174 Bacteria 1530
97 Ga0105242_10004970 3300009176 Bacteria 10287
98 Ga0105242_10006968 3300009176 Bacteria 8724
99 Ga0105242_10050220 3300009176 Bacteria 3395
100 Ga0105242_10346697 3300009176 Bacteria 1370
101 Ga0105248_10004895 3300009177 Bacteria 14798
102 Ga0105248_10083568 3300009177 Bacteria 3591
103 Ga0105237_11920818 3300009545 Bacteria 600
104 Ga0105249_10178696 3300009553 Bacteria 2063
105 Ga0105249_10874300 3300009553 Bacteria 965
106 Ga0105239_12418529 3300010375 Bacteria 612
107 Ga0105246_10219346 3300011119 Bacteria 1490
108 Ga0105246_10305966 3300011119 Bacteria 1285
109 Ga0105246_10841828 3300011119 Bacteria 817
110 Ga0157374_10046438 3300013296 Bacteria 4021
111 Ga0157378_10008471 3300013297 Bacteria 8958
112 Ga0157378_10013351 3300013297 Bacteria 7180
113 Ga0157378_10196002 3300013297 Bacteria 1908
114 Ga0163162_10039915 3300013306 Bacteria 4692
115 Ga0163162_12147002 3300013306 Bacteria 641
116 Ga0157375_10023494 3300013308 Bacteria 5691
117 Ga0157375_10115880 3300013308 Unclassified 2783
118 Ga0157375_10217940 3300013308 Bacteria 2066
119 Ga0163163_10040707 3300014325 Bacteria 4539
120 Ga0163163_10105282 3300014325 Bacteria 2847
121 Ga0163163_10551146 3300014325 Bacteria 1215
122 Ga0157380_10092659 3300014326 Unclassified 2497
123 Ga0157380_10673200 3300014326 Bacteria 1036
124 Ga0157377_10525029 3300014745 Bacteria 832
125 Ga0157379_10093536 3300014968 Bacteria 2697
126 Ga0157376_10021541 3300014969 Bacteria 5008
127 Ga0157376_10292689 3300014969 Bacteria 1538
128 Ga0157376_10992551 3300014969 Bacteria 862
129 Ga0163161_11197072 3300017792 Bacteria 657
130 Ga0207653_10093506 3300025885 Bacteria 1056
131 Ga0207642_10017708 3300025899 Bacteria 2717
132 Ga0207688_10281140 3300025901 Unclassified 1014
133 Ga0207685_10667942 3300025905 Bacteria 563
134 Ga0207645_10036455 3300025907 Bacteria 3157
135 Ga0207643_10335766 3300025908 Unclassified 946
136 Ga0207693_10000321 3300025915 Bacteria 44332
137 Ga0207662_10386128 3300025918 Bacteria 947
138 Ga0207646_10034429 3300025922 Bacteria 4577
139 Ga0207687_10009705 3300025927 Bacteria 6296
140 Ga0207687_10124664 3300025927 Bacteria 1932
141 Ga0207687_10218986 3300025927 Bacteria 1498
142 Ga0207644_10069580 3300025931 Bacteria 2570
143 Ga0207644_10709962 3300025931 Bacteria 839
144 Ga0207686_10003391 3300025934 Bacteria 8558
145 Ga0207686_10034348 3300025934 Unclassified 3035
146 Ga0207686_10222373 3300025934 Bacteria 1364
147 Ga0207709_10004611 3300025935 Bacteria 7928
148 Ga0207709_10077956 3300025935 Bacteria 2126
149 Ga0207669_10497339 3300025937 Unclassified 975
150 Ga0207704_10075563 3300025938 Bacteria 2155
151 Ga0207691_10203345 3300025940 Bacteria 1723
152 Ga0207711_10124301 3300025941 Bacteria 2306
153 Ga0207712_10732439 3300025961 Bacteria 865
154 Ga0207668_11368964 3300025972 Bacteria 638
155 Ga0207640_10267732 3300025981 Bacteria 1335
156 Ga0207677_10002315 3300026023 Bacteria 10008
157 Ga0207677_10634495 3300026023 Unclassified 941
158 Ga0207703_10067354 3300026035 Bacteria 2947
159 Ga0207708_10013500 3300026075 Bacteria 6107
160 Ga0207708_10016895 3300026075 Bacteria 5494
161 Ga0207708_10500106 3300026075 Bacteria 1019
162 Ga0207708_10569713 3300026075 Bacteria 957
163 Ga0207641_12295739 3300026088 Bacteria 539
164 Ga0207648_10001337 3300026089 Bacteria 27375
165 Ga0207648_10036956 3300026089 Bacteria 4302
166 Ga0207676_10010581 3300026095 Bacteria 6576
167 Ga0207675_100050098 3300026118 Bacteria 3897
168 Ga0207675_100116736 3300026118 Unclassified 2522
169 Ga0207683_10036102 3300026121 Bacteria 4301
170 Ga0207428_10494547 3300027907 Bacteria 889
171 Ga0307416_100056652 3300032002 Bacteria 3165
172 Ga0307416_100430853 3300032002 Bacteria 1366
173 Ga0307415_100012750 3300032126 Bacteria 4874
174 Ga0307415_101764579 3300032126 Unclassified 598
175 Ga0307507_10103549 3300033179 Bacteria 2368
176 Ga0373944_0011296 3300035089 Unclassified 2444
177 Ga0373923_0025876 3300035111 Unclassified 2330
178 Ga0373936_0000625 3300035113 Bacteria 12227
179 Ga0373945_0003665 3300035116 Bacteria 4844
180 Ga0373945_0108232 3300035116 Bacteria 1094
181 Ga0373943_0011628 3300035170 Bacteria 3960
182 Ga0373943_0162351 3300035170 Bacteria 1217
183 Ga0373943_0282118 3300035170 Bacteria 939
184 Ga0373946_0000314 3300035171 Bacteria 15730
185 Ga0373946_0443300 3300035171 Bacteria 660
186 Ga0373955_0225552 3300035172 Bacteria 1120
187 Ga0373961_0185985 3300035241 Bacteria 726
188 Ga0373924_0290759 3300035410 Bacteria 725
189 Ga0373935_0009467 3300035692 Bacteria 5827
190 Ga0373935_0561844 3300035692 Bacteria 832
191 Ga0373927_0065345 3300035695 Bacteria 2353
192 Ga0373927_0214053 3300035695 Bacteria 1266
193 Ga0373927_0810815 3300035695 Unclassified 618
194 Ga0373947_0005383 3300035725 Bacteria 7466
195 Ga0373947_0210084 3300035725 Bacteria 1276
196 Ga0373947_0938710 3300035725 Bacteria 590
197 Ga0373925_0006821 3300037068 Bacteria 8364
198 Ga0373925_0013390 3300037068 Bacteria 5935
199 Ga0395899_0351254 3300037312 Bacteria 986
200 Ga0395900_0172033 3300037418 Bacteria 2204
201 Ga0395901_0124621 3300038443 Bacteria 2707
202 Ga0439461_0182733 3300041410 Bacteria 556
203 Ga0439466_0061257 3300041411 Bacteria 1212
204 Ga0466958_0438667 3300045836 Bacteria 845
205 Ga0495603_0021716 3300046455 Unclassified 3887
206 Ga0495603_0024463 3300046455 Bacteria 3652
207 Ga0495603_0142225 3300046455 Bacteria 1395
208 Ga0495603_0843408 3300046455 Bacteria 522
209 Ga0495629_0000359 3300046459 Bacteria 38615
210 Ga0495629_0023956 3300046459 Bacteria 4347
211 Ga0495629_0200752 3300046459 Unclassified 1379
212 Ga0495641_0008364 3300046461 Bacteria 6324
213 Ga0495641_0041953 3300046461 Bacteria 2123
214 Ga0495653_0046052 3300046463 Bacteria 3378
215 Ga0495580_0160261 3300046472 Bacteria 1557
216 Ga0495580_0190825 3300046472 Bacteria 1413
217 Ga0495582_0004344 3300046473 Bacteria 7972
218 Ga0495582_0006392 3300046473 Bacteria 6549
219 Ga0495582_0293737 3300046473 Bacteria 934
220 Ga0495639_0000580 3300046475 Bacteria 17010
221 Ga0495639_0014618 3300046475 Bacteria 3400
222 Ga0495596_0234403 3300046500 Bacteria 713
223 Ga0495596_0453702 3300046500 Bacteria 500
224 Ga0495607_0228279 3300046501 Bacteria 907
225 Ga0495607_0442929 3300046501 Bacteria 584
226 Ga0495630_0002414 3300046517 Bacteria 12971
227 Ga0495630_0054773 3300046517 Bacteria 2988
228 Ga0495631_0046059 3300046518 Bacteria 1919
229 Ga0495644_0006124 3300046523 Bacteria 4676
230 Ga0495644_0105113 3300046523 Bacteria 1069
231 Ga0495663_0027024 3300046525 Bacteria 1682
232 Ga0495666_0017238 3300046526 Unclassified 3597
233 Ga0495665_0011512 3300046531 Bacteria 4788
234 Ga0495640_0003064 3300046533 Bacteria 13455
235 Ga0495586_0018893 3300046535 Bacteria 3668
236 Ga0495586_0213289 3300046535 Bacteria 1096
237 Ga0495586_0735489 3300046535 Bacteria 569
238 Ga0495609_0008189 3300046538 Bacteria 5132
239 Ga0495621_0114966 3300046539 Bacteria 1035
240 Ga0495656_0002727 3300046615 Bacteria 5900
241 Ga0495656_0012502 3300046615 Unclassified 3134
242 Ga0495634_0003786 3300046642 Bacteria 12018
243 Ga0495611_0148162 3300046648 Bacteria 1096
244 Ga0495635_0032709 3300046663 Bacteria 3607
245 Ga0495659_0001324 3300046664 Bacteria 8503
246 Ga0495661_0234298 3300046665 Bacteria 945
247 Ga0495588_0006535 3300046674 Bacteria 5259
248 Ga0495588_0018279 3300046674 Bacteria 3415
249 Ga0495588_0121273 3300046674 Unclassified 1378
250 Ga0495588_0191918 3300046674 Bacteria 1079
251 Ga0495647_0000891 3300046681 Bacteria 8939
252 Ga0495647_0039945 3300046681 Bacteria 1781
253 Ga0495647_0060034 3300046681 Bacteria 1498
254 Ga0495658_0000203 3300046683 Bacteria 34481
255 Ga0495658_0010903 3300046683 Bacteria 4554
256 Ga0495658_0124838 3300046683 Unclassified 1561
257 Ga0495669_0097675 3300046684 Bacteria 1362
258 Ga0495613_0002075 3300046689 Bacteria 15235
259 Ga0495613_0003023 3300046689 Bacteria 12579
260 Ga0495624_0003098 3300046690 Bacteria 12440
261 Ga0495624_0067441 3300046690 Bacteria 2232
262 Ga0495670_0036789 3300046691 Bacteria 2439
263 Ga0495670_0046575 3300046691 Bacteria 2166
264 Ga0495589_0030819 3300046794 Unclassified 2701
265 Ga0495581_0000958 3300047315 Bacteria 15507
266 Ga0495581_0005909 3300047315 Bacteria 7098
267 Ga0495581_0199212 3300047315 Bacteria 1171
268 Ga0495636_0011048 3300047318 Bacteria 3573
269 Ga0495674_0001629 3300047319 Bacteria 22039
270 Ga0495676_0076703 3300047321 Unclassified 2551
271 Ga0495676_0118381 3300047321 Bacteria 1931
272 Ga0495676_0178099 3300047321 Bacteria 1492
273 Ga0495676_0216756 3300047321 Bacteria 1321
274 Ga0495676_0833620 3300047321 Bacteria 593
275 Ga0495680_0004143 3300047322 Bacteria 13938
276 Ga0495677_0011136 3300047445 Bacteria 3292
277 Ga0495677_0278426 3300047445 Bacteria 656
278 Ga0495679_038837 3300047446 Bacteria 1489
279 Ga0495685_088415 3300047447 Bacteria 1028
280 Ga0495593_0000392 3300047673 Bacteria 24309
281 Ga0495593_0473238 3300047673 Bacteria 627
282 Ga0495614_0035574 3300048089 Bacteria 2140
283 Ga0495614_0226210 3300048089 Bacteria 851
284 Ga0495615_0125509 3300048090 Bacteria 746
285 Ga0496100_0005850 3300048903 Bacteria 6656
286 Ga0496100_0015987 3300048903 Bacteria 4395
287 Ga0496100_1234876 3300048903 Unclassified 590
288 Ga0496101_0014817 3300048904 Bacteria 5245
289 Ga0496101_0701037 3300048904 Bacteria 799
290 Ga0496102_0003976 3300048905 Bacteria 12526
291 Ga0496103_0023111 3300048906 Bacteria 3748
292 Ga0496103_0084594 3300048906 Bacteria 1998
293 Ga0496104_0140994 3300048907 Bacteria 2315
294 Ga0496105_0207637 3300048908 Bacteria 1597
295 Ga0496106_0011619 3300048909 Bacteria 6508
296 Ga0496106_0067447 3300048909 Bacteria 2727
297 Ga0496107_0001729 3300048910 Bacteria 13714
298 Ga0496107_0019367 3300048910 Bacteria 4801
299 Ga0496107_1362599 3300048910 Bacteria 506
300 Ga0496108_0002641 3300048911 Bacteria 14363
301 Ga0496108_0018566 3300048911 Bacteria 5696
302 Ga0496109_0046816 3300048912 Bacteria 3929
303 Ga0496110_0000875 3300048913 Bacteria 21202
304 Ga0496110_1049002 3300048913 Unclassified 723
305 Ga0496111_0000324 3300048914 Bacteria 23752
306 Ga0496112_0010025 3300048915 Bacteria 8576
307 Ga0496113_0024479 3300048916 Bacteria 4291
308 Ga0496113_0273388 3300048916 Bacteria 1350
309 Ga0496113_0553382 3300048916 Bacteria 923
310 Ga0496114_0004144 3300048917 Bacteria 11216
311 Ga0496115_0210251 3300048918 Bacteria 1607
312 Ga0501031_0167953 3300049568 Bacteria 1433
313 Ga0501031_0178985 3300049568 Bacteria 1385
314 Ga0501031_0481967 3300049568 Bacteria 800
315 Ga0501031_0659901 3300049568 Bacteria 672
316 Ga0501032_0287226 3300049569 Bacteria 1064
317 Ga0501033_0047227 3300049570 Bacteria 3201
318 Ga0501033_0068721 3300049570 Bacteria 2604
319 Ga0501033_0353639 3300049570 Bacteria 1029
320 Ga0501034_0096219 3300049571 Bacteria 2957
321 Ga0501036_0021208 3300049572 Bacteria 5457
322 Ga0501036_0031329 3300049572 Bacteria 4494
323 Ga0501036_0603091 3300049572 Bacteria 911
324 Ga0501036_0639573 3300049572 Bacteria 881
325 Ga0501037_0245604 3300049573 Bacteria 1253
326 Ga0501038_0029482 3300049574 Bacteria 4861
327 Ga0501038_0337182 3300049574 Bacteria 1176
328 Ga0501039_0006019 3300049575 Bacteria 9203
329 Ga0501039_0006707 3300049575 Bacteria 8756
330 Ga0501039_0040009 3300049575 Bacteria 3619
331 Ga0501039_1382774 3300049575 Unclassified 542
332 Ga0501040_0003097 3300049576 Bacteria 10782
333 Ga0501040_0012602 3300049576 Bacteria 5544
334 Ga0501040_0145883 3300049576 Bacteria 1668
335 Ga0501040_0204210 3300049576 Bacteria 1403
336 Ga0501040_0356205 3300049576 Unclassified 1048
337 Ga0501040_0579121 3300049576 Bacteria 810
338 Ga0501041_0003974 3300049577 Bacteria 8530
339 Ga0501041_0023334 3300049577 Bacteria 3710
340 Ga0501041_0026904 3300049577 Bacteria 3464
341 Ga0501041_0065695 3300049577 Bacteria 2223
342 Ga0501041_0170571 3300049577 Bacteria 1361
343 Ga0501041_0349917 3300049577 Bacteria 934
344 Ga0501042_0018060 3300049578 Bacteria 4878
345 Ga0501042_0164773 3300049578 Bacteria 1599
346 Ga0501042_0276977 3300049578 Bacteria 1211
347 Ga0501042_0421208 3300049578 Bacteria 967
348 Ga0501042_0434322 3300049578 Bacteria 952
349 Ga0501042_1215695 3300049578 Bacteria 549
350 Ga0501043_0034447 3300049579 Bacteria 3982
351 Ga0501043_0102724 3300049579 Bacteria 2246
352 Ga0501043_0271976 3300049579 Bacteria 1300
353 Ga0501046_0013182 3300049580 Bacteria 7011
354 Ga0501046_0025310 3300049580 Bacteria 4858
355 Ga0501046_0076404 3300049580 Bacteria 2594
356 Ga0501046_0184600 3300049580 Bacteria 1558
357 Ga0501048_0044132 3300049582 Bacteria 3189
358 Ga0501048_0323481 3300049582 Bacteria 1099
359 Ga0501067_0103185 3300049583 Bacteria 1584
360 Ga0501067_0554220 3300049583 Bacteria 644
361 Ga0501068_0013703 3300049584 Bacteria 4617
362 Ga0501068_0018342 3300049584 Bacteria 4052
363 Ga0501068_0426001 3300049584 Bacteria 857
364 Ga0501069_0030385 3300049585 Bacteria 2966
365 Ga0501070_0107281 3300049586 Bacteria 2308
366 Ga0501070_0753487 3300049586 Bacteria 767
367 Ga0501071_0003568 3300049587 Bacteria 9740
368 Ga0501071_0005767 3300049587 Bacteria 7994
369 Ga0501071_0006284 3300049587 Bacteria 7708
370 Ga0501071_0751574 3300049587 Bacteria 751
371 Ga0501071_0807587 3300049587 Bacteria 723
372 Ga0501072_0003812 3300049588 Bacteria 11379
373 Ga0501072_0010427 3300049588 Bacteria 7080
374 Ga0501072_0076236 3300049588 Bacteria 2653
375 Ga0501072_0637075 3300049588 Bacteria 839
376 Ga0501073_0006642 3300049589 Bacteria 8613
377 Ga0501073_0869645 3300049589 Bacteria 621
378 Ga0501074_0018280 3300049590 Bacteria 5093
379 Ga0501074_0046421 3300049590 Bacteria 3141
380 Ga0501074_0066308 3300049590 Bacteria 2596
381 Ga0501074_0235615 3300049590 Bacteria 1303
382 Ga0501074_0744071 3300049590 Bacteria 691
383 Ga0501075_0002821 3300049591 Bacteria 11651
384 Ga0501075_0009749 3300049591 Bacteria 6729
385 Ga0501075_0338360 3300049591 Bacteria 1147
386 Ga0501075_0425993 3300049591 Bacteria 1012
387 Ga0501075_0609188 3300049591 Bacteria 833
388 Ga0501075_0888604 3300049591 Bacteria 678
389 Ga0501076_0009354 3300049592 Bacteria 7234
390 Ga0501076_0009482 3300049592 Bacteria 7191
391 Ga0501076_0012912 3300049592 Bacteria 6252
392 Ga0501076_0111796 3300049592 Bacteria 2208
393 Ga0501076_0215894 3300049592 Bacteria 1568
394 Ga0501076_0284016 3300049592 Bacteria 1356
395 Ga0501076_1620326 3300049592 Bacteria 531
396 Ga0501077_0006135 3300049593 Bacteria 7339
397 Ga0501079_0010138 3300049741 Bacteria 7153
398 Ga0501079_0011845 3300049741 Bacteria 6656
399 Ga0501079_0017142 3300049741 Bacteria 5531
400 Ga0501079_0226084 3300049741 Bacteria 1462
401 Ga0501080_0079870 3300049742 Bacteria 3041
402 Ga0501080_0268452 3300049742 Bacteria 1553
403 Ga0501081_0003761 3300049743 Bacteria 9715
404 Ga0501081_0010277 3300049743 Bacteria 6109
405 Ga0501081_0103461 3300049743 Bacteria 2015
406 Ga0501081_0357367 3300049743 Bacteria 1077
407 Ga0501081_0393411 3300049743 Bacteria 1025
408 Ga0501081_1548409 3300049743 Bacteria 504
409 Ga0501083_0023659 3300049744 Bacteria 4259
410 Ga0501083_0043383 3300049744 Bacteria 3047
411 Ga0501083_0307494 3300049744 Bacteria 1031
412 Ga0501035_0048152 3300049822 Bacteria 3823
413 Ga0501035_0316762 3300049822 Bacteria 1311
414 Ga0501044_0613182 3300049823 Bacteria 980
415 Ga0501044_0755851 3300049823 Bacteria 854
416 Ga0501045_0008274 3300049824 Bacteria 7243
417 Ga0501045_0009706 3300049824 Bacteria 6732
418 nmdc:mga05p37_139462_c1 3300050507 Bacteria 2971
419 nmdc:mga05p37_180394_c1 3300050507 Bacteria 2569
420 nmdc:mga05p37_279839_c1 3300050507 Bacteria 1990
421 nmdc:mga09592_1727181_c1 3300050508 Unclassified 504
422 nmdc:mga09592_17620_c1 3300050508 Bacteria 5853
423 nmdc:mga0qj67_28850_c1 3300050509 Bacteria 4308
424 nmdc:mga0qj67_572069_c1 3300050509 Bacteria 905
425 nmdc:mga06r32_26373_c1 3300050510 Bacteria 5417
426 nmdc:mga08y16_259521_c1 3300050511 Bacteria 1795
427 nmdc:mga0n895_1830979_c1 3300050512 Bacteria 567
428 Ga0495601_0229456 3300053077 Bacteria 1213
429 Ga0495655_0070993 3300053083 Bacteria 974
430 Ga0495619_0015504 3300053085 Bacteria 4821
431 Ga0501084_0007695 3300054114 Bacteria 8877
432 Ga0501084_0008840 3300054114 Bacteria 8337
433 Ga0501084_0009273 3300054114 Bacteria 8140
434 Ga0501084_0346892 3300054114 Bacteria 1254
435 Ga0501084_0357434 3300054114 Bacteria 1234
436 Ga0590074_071852 3300059423 Bacteria 653
437 Ga0590075_041179 3300059424 Bacteria 1181
438 Ga0501082_0009031 3300060353 Bacteria 8597
439 Ga0501082_0025265 3300060353 Bacteria 5118
440 Ga0501082_0194623 3300060353 Bacteria 1763
441 Ga0501082_1704268 3300060353 Bacteria 550
442 Ga0530510_0012069 3300061734 Bacteria 6061
443 Ga0530510_0037365 3300061734 Bacteria 3501
444 Ga0530510_0121894 3300061734 Bacteria 1914
445 Ga0530510_0237485 3300061734 Bacteria 1356
446 Ga0501082_1136866
447 Ga0070690_100229216
448 Ga0070680_100583035
449 Ga0068868_100013277
450 Ga0068868_100166289
451 Ga0068868_100458305
452 Ga0068868_101246389
453 Ga0070689_100571269
454 Ga0070689_101478401
455 Ga0070691_10046546
456 Ga0070691_10055373
457 Ga0070691_10078429
458 Ga0070692_11122166
459 Ga0070668_101268176
460 Ga0070675_100230993
461 Ga0070671_100011264
462 Ga0070674_100011807
463 Ga0070673_100237877
464 Ga0070673_100682140
465 Ga0070659_100715344
466 Ga0070703_10126566
467 Ga0070710_10199967
468 Ga0070701_10022178
469 Ga0070711_100001030
470 Ga0070705_100781491
471 Ga0070700_100027390
472 Ga0070700_100122687
473 Ga0070700_100409847
474 Ga0070694_100051266
475 Ga0070694_100630915
476 Ga0070708_100087897
477 Ga0070663_100676168
478 Ga0070663_101126235
479 Ga0070678_100035725
480 Ga0070678_100186888
481 Ga0068867_100001651
482 Ga0068867_100156474
483 Ga0070706_100083220
484 Ga0070707_100110309
485 Ga0070698_100007499
486 Ga0070699_100074868
487 Ga0070699_102009003
488 Ga0070679_100657303
489 Ga0070684_100224829
490 Ga0070697_100465061
491 Ga0070697_100604614
492 Ga0070672_100297727
493 Ga0070686_100049401
494 Ga0070686_100151308
495 Ga0070686_100655452
496 Ga0070686_101088028
497 Ga0070695_100010191
498 Ga0070696_100001811
499 Ga0070693_100480487
500 Ga0070704_100033394
501 Ga0070704_100304649
502 Ga0070704_100561819
503 Ga0070704_100581443
504 Ga0070664_100637412
505 Ga0068854_100746694
506 Ga0070702_100021821
507 Ga0070702_100303640
508 Ga0068864_100063303
509 Ga0068866_10005516
510 Ga0068866_10005751
511 Ga0068851_10055426
512 Ga0068858_100063612
513 Ga0068860_100224162
514 Ga0068860_101576874
515 Ga0081539_10016295
516 Ga0081539_10084231
517 Ga0075364_11119044
518 Ga0070715_10231218
519 Ga0070712_100009446
520 Ga0097621_100104786
521 Ga0068871_100133182
522 Ga0075428_100018995
523 Ga0075430_100000779
524 Ga0075431_100002621
525 Ga0075429_100002364
526 Ga0068865_100147899
527 Ga0105245_10090225
528 Ga0105245_10106589
529 Ga0105245_10638077
530 Ga0105245_11431430
531 Ga0105245_11775961
532 Ga0105245_12404975
533 Ga0105245_12888054
534 Ga0105247_10085682
535 Ga0114129_10098933
536 Ga0114129_10167645
537 Ga0114129_10237505
538 Ga0114129_10884829
539 Ga0105243_10001605
540 Ga0105243_10002990
541 Ga0105241_10240551
542 Ga0105242_10004970
543 Ga0105242_10006968
544 Ga0105242_10050220
545 Ga0105242_10346697
546 Ga0105248_10004895
547 Ga0105248_10083568
548 Ga0105237_11920818
549 Ga0105249_10178696
550 Ga0105249_10874300
551 Ga0105239_12418529
552 Ga0105246_10219346
553 Ga0105246_10305966
554 Ga0105246_10841828
555 Ga0157374_10046438
556 Ga0157378_10008471
557 Ga0157378_10013351
558 Ga0157378_10196002
559 Ga0163162_10039915
560 Ga0163162_12147002
561 Ga0157375_10023494
562 Ga0157375_10115880
563 Ga0157375_10217940
564 Ga0163163_10040707
565 Ga0163163_10105282
566 Ga0163163_10551146
567 Ga0157380_10092659
568 Ga0157380_10673200
569 Ga0157377_10525029
570 Ga0157379_10093536
571 Ga0157376_10021541
572 Ga0157376_10292689
573 Ga0157376_10992551
574 Ga0163161_11197072
575 Ga0207653_10093506
576 Ga0207642_10017708
577 Ga0207688_10281140
578 Ga0207685_10667942
579 Ga0207645_10036455
580 Ga0207643_10335766
581 Ga0207693_10000321
582 Ga0207662_10386128
583 Ga0207646_10034429
584 Ga0207687_10009705
585 Ga0207687_10124664
586 Ga0207687_10218986
587 Ga0207644_10069580
588 Ga0207644_10709962
589 Ga0207686_10003391
590 Ga0207686_10034348
591 Ga0207686_10222373
592 Ga0207709_10004611
593 Ga0207709_10077956
594 Ga0207669_10497339
595 Ga0207704_10075563
596 Ga0207691_10203345
597 Ga0207711_10124301
598 Ga0207712_10732439
599 Ga0207668_11368964
600 Ga0207640_10267732
601 Ga0207677_10002315
602 Ga0207677_10634495
603 Ga0207703_10067354
604 Ga0207708_10013500
605 Ga0207708_10016895
606 Ga0207708_10500106
607 Ga0207708_10569713
608 Ga0207641_12295739
609 Ga0207648_10001337
610 Ga0207648_10036956
611 Ga0207676_10010581
612 Ga0207675_100050098
613 Ga0207675_100116736
614 Ga0207683_10036102
615 Ga0207428_10494547
616 Ga0307416_100056652
617 Ga0307416_100430853
618 Ga0307415_100012750
619 Ga0307415_101764579
620 Ga0307507_10103549
621 Ga0373944_0011296
622 Ga0373923_0025876
623 Ga0373936_0000625
624 Ga0373945_0003665
625 Ga0373945_0108232
626 Ga0373943_0011628
627 Ga0373943_0162351
628 Ga0373943_0282118
629 Ga0373946_0000314
630 Ga0373946_0443300
631 Ga0373955_0225552
632 Ga0373961_0185985
633 Ga0373924_0290759
634 Ga0373935_0009467
635 Ga0373935_0561844
636 Ga0373927_0065345
637 Ga0373927_0214053
638 Ga0373927_0810815
639 Ga0373947_0005383
640 Ga0373947_0210084
641 Ga0373947_0938710
642 Ga0373925_0006821
643 Ga0373925_0013390
644 Ga0395899_0351254
645 Ga0395900_0172033
646 Ga0395901_0124621
647 Ga0439461_0182733
648 Ga0439466_0061257
649 Ga0466958_0438667
650 Ga0495603_0021716
651 Ga0495603_0024463
652 Ga0495603_0142225
653 Ga0495603_0843408
654 Ga0495629_0000359
655 Ga0495629_0023956
656 Ga0495629_0200752
657 Ga0495641_0008364
658 Ga0495641_0041953
659 Ga0495653_0046052
660 Ga0495580_0160261
661 Ga0495580_0190825
662 Ga0495582_0004344
663 Ga0495582_0006392
664 Ga0495582_0293737
665 Ga0495639_0000580
666 Ga0495639_0014618
667 Ga0495596_0234403
668 Ga0495596_0453702
669 Ga0495607_0228279
670 Ga0495607_0442929
671 Ga0495630_0002414
672 Ga0495630_0054773
673 Ga0495631_0046059
674 Ga0495644_0006124
675 Ga0495644_0105113
676 Ga0495663_0027024
677 Ga0495666_0017238
678 Ga0495665_0011512
679 Ga0495640_0003064
680 Ga0495586_0018893
681 Ga0495586_0213289
682 Ga0495586_0735489
683 Ga0495609_0008189
684 Ga0495621_0114966
685 Ga0495656_0002727
686 Ga0495656_0012502
687 Ga0495634_0003786
688 Ga0495611_0148162
689 Ga0495635_0032709
690 Ga0495659_0001324
691 Ga0495661_0234298
692 Ga0495588_0006535
693 Ga0495588_0018279
694 Ga0495588_0121273
695 Ga0495588_0191918
696 Ga0495647_0000891
697 Ga0495647_0039945
698 Ga0495647_0060034
699 Ga0495658_0000203
700 Ga0495658_0010903
701 Ga0495658_0124838
702 Ga0495669_0097675
703 Ga0495613_0002075
704 Ga0495613_0003023
705 Ga0495624_0003098
706 Ga0495624_0067441
707 Ga0495670_0036789
708 Ga0495670_0046575
709 Ga0495589_0030819
710 Ga0495581_0000958
711 Ga0495581_0005909
712 Ga0495581_0199212
713 Ga0495636_0011048
714 Ga0495674_0001629
715 Ga0495676_0076703
716 Ga0495676_0118381
717 Ga0495676_0178099
718 Ga0495676_0216756
719 Ga0495676_0833620
720 Ga0495680_0004143
721 Ga0495677_0011136
722 Ga0495677_0278426
723 Ga0495679_038837
724 Ga0495685_088415
725 Ga0495593_0000392
726 Ga0495593_0473238
727 Ga0495614_0035574
728 Ga0495614_0226210
729 Ga0495615_0125509
730 Ga0496100_0005850
731 Ga0496100_0015987
732 Ga0496100_1234876
733 Ga0496101_0014817
734 Ga0496101_0701037
735 Ga0496102_0003976
736 Ga0496103_0023111
737 Ga0496103_0084594
738 Ga0496104_0140994
739 Ga0496105_0207637
740 Ga0496106_0011619
741 Ga0496106_0067447
742 Ga0496107_0001729
743 Ga0496107_0019367
744 Ga0496107_1362599
745 Ga0496108_0002641
746 Ga0496108_0018566
747 Ga0496109_0046816
748 Ga0496110_0000875
749 Ga0496110_1049002
750 Ga0496111_0000324
751 Ga0496112_0010025
752 Ga0496113_0024479
753 Ga0496113_0273388
754 Ga0496113_0553382
755 Ga0496114_0004144
756 Ga0496115_0210251
757 Ga0501031_0167953
758 Ga0501031_0178985
759 Ga0501031_0481967
760 Ga0501031_0659901
761 Ga0501032_0287226
762 Ga0501033_0047227
763 Ga0501033_0068721
764 Ga0501033_0353639
765 Ga0501034_0096219
766 Ga0501036_0021208
767 Ga0501036_0031329
768 Ga0501036_0603091
769 Ga0501036_0639573
770 Ga0501037_0245604
771 Ga0501038_0029482
772 Ga0501038_0337182
773 Ga0501039_0006019
774 Ga0501039_0006707
775 Ga0501039_0040009
776 Ga0501039_1382774
777 Ga0501040_0003097
778 Ga0501040_0012602
779 Ga0501040_0145883
780 Ga0501040_0204210
781 Ga0501040_0356205
782 Ga0501040_0579121
783 Ga0501041_0003974
784 Ga0501041_0023334
785 Ga0501041_0026904
786 Ga0501041_0065695
787 Ga0501041_0170571
788 Ga0501041_0349917
789 Ga0501042_0018060
790 Ga0501042_0164773
791 Ga0501042_0276977
792 Ga0501042_0421208
793 Ga0501042_0434322
794 Ga0501042_1215695
795 Ga0501043_0034447
796 Ga0501043_0102724
797 Ga0501043_0271976
798 Ga0501046_0013182
799 Ga0501046_0025310
800 Ga0501046_0076404
801 Ga0501046_0184600
802 Ga0501048_0044132
803 Ga0501048_0323481
804 Ga0501067_0103185
805 Ga0501067_0554220
806 Ga0501068_0013703
807 Ga0501068_0018342
808 Ga0501068_0426001
809 Ga0501069_0030385
810 Ga0501070_0107281
811 Ga0501070_0753487
812 Ga0501071_0003568
813 Ga0501071_0005767
814 Ga0501071_0006284
815 Ga0501071_0751574
816 Ga0501071_0807587
817 Ga0501072_0003812
818 Ga0501072_0010427
819 Ga0501072_0076236
820 Ga0501072_0637075
821 Ga0501073_0006642
822 Ga0501073_0869645
823 Ga0501074_0018280
824 Ga0501074_0046421
825 Ga0501074_0066308
826 Ga0501074_0235615
827 Ga0501074_0744071
828 Ga0501075_0002821
829 Ga0501075_0009749
830 Ga0501075_0338360
831 Ga0501075_0425993
832 Ga0501075_0609188
833 Ga0501075_0888604
834 Ga0501076_0009354
835 Ga0501076_0009482
836 Ga0501076_0012912
837 Ga0501076_0111796
838 Ga0501076_0215894
839 Ga0501076_0284016
840 Ga0501076_1620326
841 Ga0501077_0006135
842 Ga0501079_0010138
843 Ga0501079_0011845
844 Ga0501079_0017142
845 Ga0501079_0226084
846 Ga0501080_0079870
847 Ga0501080_0268452
848 Ga0501081_0003761
849 Ga0501081_0010277
850 Ga0501081_0103461
851 Ga0501081_0357367
852 Ga0501081_0393411
853 Ga0501081_1548409
854 Ga0501083_0023659
855 Ga0501083_0043383
856 Ga0501083_0307494
857 Ga0501035_0048152
858 Ga0501035_0316762
859 Ga0501044_0613182
860 Ga0501044_0755851
861 Ga0501045_0008274
862 Ga0501045_0009706
863 nmdc:mga05p37_139462_c1
864 nmdc:mga05p37_180394_c1
865 nmdc:mga05p37_279839_c1
866 nmdc:mga09592_1727181_c1
867 nmdc:mga09592_17620_c1
868 nmdc:mga0qj67_28850_c1
869 nmdc:mga0qj67_572069_c1
870 nmdc:mga06r32_26373_c1
871 nmdc:mga08y16_259521_c1
872 nmdc:mga0n895_1830979_c1
873 Ga0495601_0229456
874 Ga0495655_0070993
875 Ga0495619_0015504
876 Ga0501084_0007695
877 Ga0501084_0008840
878 Ga0501084_0009273
879 Ga0501084_0346892
880 Ga0501084_0357434
881 Ga0590074_071852
882 Ga0590075_041179
883 Ga0501082_0009031
884 Ga0501082_0025265
885 Ga0501082_0194623
886 Ga0501082_1704268
887 Ga0530510_0012069
888 Ga0530510_0037365
889 Ga0530510_0121894
890 Ga0530510_0237485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

17

130

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.9014 2 134
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.9002 4 132
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.8999 3 134
2p6h-assembly1.cif.gz_A crystal structure of hypothetical protein ape1520 from aeropyrum pernix k1 0.8957 1 134
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.8887 2 134
ID Description Score Start End Superfamily
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9726 1 132 2.60.120.460
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9583 1 132 2.60.120.460
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9097 2 132 2.60.120.460
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9087 2 134 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8984 3 134 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A5C8JLL2-F1-model_v4 YjbQ family protein 0.9794 1 134
AF-A0A5S4ZI95-F1-model_v4 deleted 0.978 16 134
AF-A0A4R4LTD4-F1-model_v4 deleted 0.9776 16 134
AF-A0A840PCT9-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.977 1 134
AF-A0A7J9ZLL6-F1-model_v4 YjbQ family protein 0.9766 1 134

Map