F445593

General Info

Members Datasets Scaffolds Average Seq Length
445 195 890 205

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0129811|Ga0496104_0129811_305_1039
Length 244
Sequence VQIPVSKLLFSNVRAPESNLKTSGSRKRASLGAGKEGQKMIAYRSFTGGIFETNCYALEAPEGWMLFDAPEGACDWLVKQKIELRLLLLTHGHVDHIQDVAQIKQHFRCPIGVHKESAPMISESGFFREFGFQFEIELVEPDLLIEATPSRDFLGLDFEVLDVPGHCPGSLCFFSRENELLVGGDVLFAGGVGRWDLPGGDGELLFAGIREKLYSLGENVVVLPGHGPSTTIGAERRSNPFVRP

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
157 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
195 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 5.39
Rhizosphere 91.01
Stem 0
Stem Tuber 0
Unclassified 28.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0129811 3300048907 Bacteria 2421
2 SwRhRL2b_contig_2569698 2162886007 Bacteria 1626
3 CNXas_1000001 3300000545 Bacteria 91563
4 JGI25404J52841_10003450 3300003659 Bacteria 3127
5 Ga0065704_10129472 3300005289 Bacteria 1625
6 Ga0065704_10150200 3300005289 Bacteria 1435
7 Ga0065712_10023662 3300005290 Bacteria 1954
8 Ga0065712_10153070 3300005290 Bacteria 1355
9 Ga0065715_10005879 3300005293 Bacteria 3791
10 Ga0065707_10103821 3300005295 Bacteria 2728
11 Ga0070658_10124569 3300005327 Bacteria 2144
12 Ga0070676_10009591 3300005328 Bacteria 5228
13 Ga0070676_10034005 3300005328 Unclassified 2925
14 Ga0070690_100058126 3300005330 Bacteria 2483
15 Ga0070670_100003753 3300005331 Bacteria 12645
16 Ga0070670_100190283 3300005331 Unclassified 1783
17 Ga0070666_10009391 3300005335 Bacteria 6095
18 Ga0070666_10023780 3300005335 Bacteria 3989
19 Ga0070666_10033207 3300005335 Bacteria 3413
20 Ga0068868_100004120 3300005338 Bacteria 10160
21 Ga0068868_100033428 3300005338 Bacteria 3964
22 Ga0068868_100153046 3300005338 Bacteria 1900
23 Ga0068868_100544694 3300005338 Bacteria 1022
24 Ga0070660_100100032 3300005339 Unclassified 2296
25 Ga0070661_100661093 3300005344 Bacteria 849
26 Ga0070668_100038328 3300005347 Bacteria 3662
27 Ga0070668_100294397 3300005347 Bacteria 1359
28 Ga0070669_100017508 3300005353 Bacteria 5111
29 Ga0070675_100005532 3300005354 Bacteria 9669
30 Ga0070675_100035921 3300005354 Bacteria 4029
31 Ga0070675_100054965 3300005354 Bacteria 3276
32 Ga0070675_100057069 3300005354 Bacteria 3218
33 Ga0070675_100134793 3300005354 Unclassified 2107
34 Ga0070671_100009795 3300005355 Bacteria 7691
35 Ga0070671_100014906 3300005355 Bacteria 6279
36 Ga0070671_100029261 3300005355 Bacteria 4542
37 Ga0070671_100049908 3300005355 Unclassified 3481
38 Ga0070671_100052164 3300005355 Unclassified 3401
39 Ga0070674_100005636 3300005356 Bacteria 7253
40 Ga0070674_100008615 3300005356 Bacteria 6079
41 Ga0070673_100014669 3300005364 Bacteria 5471
42 Ga0070673_100245174 3300005364 Unclassified 1559
43 Ga0070688_100035760 3300005365 Bacteria 3018
44 Ga0070688_100267832 3300005365 Bacteria 1223
45 Ga0070659_100084470 3300005366 Bacteria 2538
46 Ga0070667_100002937 3300005367 Bacteria 14657
47 Ga0070667_100008354 3300005367 Bacteria 8582
48 Ga0070667_100014028 3300005367 Bacteria 6623
49 Ga0070667_100082133 3300005367 Bacteria 2758
50 Ga0070703_10056338 3300005406 Bacteria 1272
51 Ga0070709_10141702 3300005434 Bacteria 1652
52 Ga0070709_10438965 3300005434 Bacteria 981
53 Ga0070714_100092109 3300005435 Unclassified 2656
54 Ga0070714_100158269 3300005435 Unclassified 2047
55 Ga0070714_100182081 3300005435 Unclassified 1912
56 Ga0070714_100230427 3300005435 Bacteria 1706
57 Ga0070714_101299189 3300005435 Bacteria 710
58 Ga0070713_100021863 3300005436 Bacteria 4931
59 Ga0070713_100033050 3300005436 Bacteria 4140
60 Ga0070713_100442587 3300005436 Bacteria 1219
61 Ga0070710_10030749 3300005437 Bacteria 2891
62 Ga0070711_100069136 3300005439 Bacteria 2484
63 Ga0070708_100018949 3300005445 Bacteria 5768
64 Ga0070708_100033639 3300005445 Unclassified 4454
65 Ga0070708_100042803 3300005445 Unclassified 3977
66 Ga0070708_100060311 3300005445 Bacteria 3385
67 Ga0070708_100112919 3300005445 Unclassified 2499
68 Ga0070708_100116272 3300005445 Unclassified 2463
69 Ga0070708_100274127 3300005445 Unclassified 1587
70 Ga0070708_100282824 3300005445 Bacteria 1561
71 Ga0070663_100737167 3300005455 Unclassified 840
72 Ga0070678_100070935 3300005456 Bacteria 2607
73 Ga0070662_100021483 3300005457 Unclassified 4407
74 Ga0070662_100038937 3300005457 Bacteria 3380
75 Ga0070662_100041333 3300005457 Unclassified 3288
76 Ga0070662_100042960 3300005457 Bacteria 3231
77 Ga0070662_100086268 3300005457 Unclassified 2348
78 Ga0068867_100047317 3300005459 Unclassified 3162
79 Ga0068867_100426936 3300005459 Bacteria 1124
80 Ga0070685_10020804 3300005466 Bacteria 3556
81 Ga0070706_100000060 3300005467 Bacteria 131097
82 Ga0070706_100018014 3300005467 Bacteria 6514
83 Ga0070706_100223490 3300005467 Bacteria 1758
84 Ga0070706_100318436 3300005467 Bacteria 1451
85 Ga0070706_100370931 3300005467 Bacteria 1333
86 Ga0070707_100002186 3300005468 Bacteria 18695
87 Ga0070707_100002340 3300005468 Bacteria 18075
88 Ga0070707_100017313 3300005468 Bacteria 6774
89 Ga0070707_100020280 3300005468 Bacteria 6269
90 Ga0070707_100028906 3300005468 Bacteria 5276
91 Ga0070707_100049593 3300005468 Bacteria 4024
92 Ga0070707_100050305 3300005468 Bacteria 3994
93 Ga0070707_100279496 3300005468 Bacteria 1622
94 Ga0070707_100418331 3300005468 Bacteria 1301
95 Ga0070707_100421201 3300005468 Unclassified 1296
96 Ga0070698_100000476 3300005471 Bacteria 42469
97 Ga0070698_100012108 3300005471 Bacteria 9142
98 Ga0070698_100047736 3300005471 Unclassified 4376
99 Ga0070698_100228622 3300005471 Bacteria 1793
100 Ga0070699_100010528 3300005518 Bacteria 8001
101 Ga0070699_100056038 3300005518 Bacteria 3413
102 Ga0070699_100074764 3300005518 Bacteria 2948
103 Ga0070699_100163852 3300005518 Bacteria 1969
104 Ga0070699_100376681 3300005518 Bacteria 1281
105 Ga0070699_100529589 3300005518 Unclassified 1072
106 Ga0070697_100001934 3300005536 Bacteria 15848
107 Ga0070697_100020168 3300005536 Bacteria 5270
108 Ga0070697_100025323 3300005536 Unclassified 4732
109 Ga0070697_100025526 3300005536 Bacteria 4714
110 Ga0070697_100043509 3300005536 Bacteria 3637
111 Ga0070697_100090086 3300005536 Bacteria 2535
112 Ga0070697_100106098 3300005536 Unclassified 2337
113 Ga0070697_100343974 3300005536 Unclassified 1287
114 Ga0070697_100378133 3300005536 Bacteria 1226
115 Ga0070697_100501239 3300005536 Bacteria 1061
116 Ga0070672_100036943 3300005543 Bacteria 3724
117 Ga0070672_100511792 3300005543 Unclassified 1039
118 Ga0070696_100036828 3300005546 Bacteria 3374
119 Ga0070693_100101327 3300005547 Bacteria 1755
120 Ga0070665_100019116 3300005548 Bacteria 6873
121 Ga0070665_100094275 3300005548 Bacteria 2998
122 Ga0070665_100144240 3300005548 Unclassified 2385
123 Ga0070704_100097606 3300005549 Bacteria 2205
124 Ga0070704_100276905 3300005549 Bacteria 1388
125 Ga0070664_100201795 3300005564 Bacteria 1775
126 Ga0070664_100935239 3300005564 Unclassified 813
127 Ga0068852_100659608 3300005616 Bacteria 1054
128 Ga0068861_100127380 3300005719 Unclassified 2062
129 Ga0068861_100641177 3300005719 Bacteria 980
130 Ga0068870_10612128 3300005840 Bacteria 741
131 Ga0068858_100280025 3300005842 Unclassified 1588
132 Ga0068858_100654677 3300005842 Bacteria 1021
133 Ga0068860_100000351 3300005843 Bacteria 61888
134 Ga0068860_100156184 3300005843 Unclassified 2198
135 Ga0068860_100412515 3300005843 Bacteria 1338
136 Ga0068862_100002998 3300005844 Bacteria 14724
137 Ga0068862_100086266 3300005844 Bacteria 2729
138 Ga0068862_101380516 3300005844 Unclassified 707
139 Ga0081455_10326036 3300005937 Bacteria 1092
140 Ga0081540_1003850 3300005983 Bacteria 11721
141 Ga0081539_10000153 3300005985 Bacteria 159919
142 Ga0081539_10001102 3300005985 Bacteria 49012
143 Ga0070717_10005697 3300006028 Bacteria 9108
144 Ga0070717_10036557 3300006028 Unclassified 3983
145 Ga0070717_10159105 3300006028 Unclassified 1958
146 Ga0070717_10313686 3300006028 Bacteria 1396
147 Ga0070716_100125949 3300006173 Bacteria 1611
148 Ga0070716_100305413 3300006173 Unclassified 1109
149 Ga0070712_100005102 3300006175 Bacteria 8128
150 Ga0070712_100024246 3300006175 Unclassified 4017
151 Ga0070712_100071784 3300006175 Unclassified 2478
152 Ga0097621_100008433 3300006237 Bacteria 7424
153 Ga0097621_100030270 3300006237 Bacteria 4284
154 Ga0068871_100029521 3300006358 Unclassified 4307
155 Ga0075434_100921755 3300006871 Bacteria 888
156 Ga0068865_100004150 3300006881 Bacteria 8712
157 Ga0068865_100028061 3300006881 Bacteria 3725
158 Ga0068865_100135620 3300006881 Unclassified 1849
159 Ga0075436_100213062 3300006914 Unclassified 1370
160 Ga0105240_10157296 3300009093 Unclassified 2702
161 Ga0105240_10775684 3300009093 Bacteria 1040
162 Ga0105240_11251626 3300009093 Unclassified 784
163 Ga0111539_10468537 3300009094 Unclassified 1467
164 Ga0105245_10037397 3300009098 Bacteria 4315
165 Ga0105245_10246000 3300009098 Bacteria 1736
166 Ga0105245_10535288 3300009098 Bacteria 1192
167 Ga0105245_11792824 3300009098 Unclassified 666
168 Ga0105247_10090447 3300009101 Bacteria 1942
169 Ga0105242_10032394 3300009176 Bacteria 4179
170 Ga0105237_10195304 3300009545 Bacteria 2023
171 Ga0105249_10058166 3300009553 Bacteria 3543
172 Ga0099796_10048732 3300010159 Unclassified 1462
173 Ga0105239_10038312 3300010375 Bacteria 5253
174 Ga0105239_10305996 3300010375 Bacteria 1790
175 Ga0105239_10508172 3300010375 Bacteria 1370
176 Ga0157374_10023982 3300013296 Bacteria 5464
177 Ga0157374_10056288 3300013296 Bacteria 3670
178 Ga0157374_10114424 3300013296 Bacteria 2597
179 Ga0157374_10157580 3300013296 Bacteria 2210
180 Ga0157374_10627860 3300013296 Unclassified 1085
181 Ga0157374_10701790 3300013296 Bacteria 1025
182 Ga0157378_10002888 3300013297 Bacteria 15296
183 Ga0157378_10014245 3300013297 Bacteria 6961
184 Ga0157378_10023188 3300013297 Bacteria 5463
185 Ga0157378_10068357 3300013297 Unclassified 3186
186 Ga0157378_10077084 3300013297 Bacteria 3005
187 Ga0157378_10112804 3300013297 Bacteria 2494
188 Ga0157378_10124476 3300013297 Bacteria 2380
189 Ga0157378_10127865 3300013297 Bacteria 2349
190 Ga0157378_10403698 3300013297 Bacteria 1347
191 Ga0157378_10421413 3300013297 Bacteria 1319
192 Ga0163162_10006418 3300013306 Bacteria 11390
193 Ga0163162_10017378 3300013306 Bacteria 7035
194 Ga0163162_10025732 3300013306 Bacteria 5818
195 Ga0163162_10026439 3300013306 Bacteria 5734
196 Ga0163162_10040390 3300013306 Unclassified 4665
197 Ga0163162_10241622 3300013306 Unclassified 1937
198 Ga0163162_10259580 3300013306 Bacteria 1869
199 Ga0157372_10017614 3300013307 Bacteria 7667
200 Ga0157372_10030278 3300013307 Bacteria 5920
201 Ga0157372_10223971 3300013307 Bacteria 2180
202 Ga0157372_10225652 3300013307 Bacteria 2172
203 Ga0157372_10244112 3300013307 Unclassified 2084
204 Ga0157375_10003579 3300013308 Bacteria 13486
205 Ga0157375_10013450 3300013308 Bacteria 7284
206 Ga0157375_10105796 3300013308 Unclassified 2905
207 Ga0157375_10388390 3300013308 Unclassified 1562
208 Ga0157375_10491083 3300013308 Unclassified 1392
209 Ga0157375_10930144 3300013308 Unclassified 1012
210 Ga0157379_10227178 3300014968 Bacteria 1691
211 Ga0157376_10010952 3300014969 Bacteria 6663
212 Ga0157376_10071076 3300014969 Unclassified 2956
213 Ga0163161_10008149 3300017792 Bacteria 7247
214 Ga0163161_10704283 3300017792 Unclassified 841
215 Ga0213872_10003195 3300021361 Bacteria 9180
216 Ga0213872_10015966 3300021361 Unclassified 3488
217 Ga0213872_10081761 3300021361 Bacteria 1451
218 Ga0213872_10087985 3300021361 Bacteria 1391
219 Ga0213872_10099888 3300021361 Bacteria 1294
220 Ga0213874_10069167 3300021377 Unclassified 1122
221 Ga0213876_10002382 3300021384 Bacteria 11068
222 Ga0213876_10050456 3300021384 Unclassified 2198
223 Ga0213875_10040740 3300021388 Bacteria 2187
224 Ga0213875_10170132 3300021388 Unclassified 1023
225 Ga0207666_1014062 3300025271 Bacteria 1128
226 Ga0207673_1004706 3300025290 Bacteria 1641
227 Ga0207697_10000365 3300025315 Bacteria 25299
228 Ga0207697_10000494 3300025315 Bacteria 22177
229 Ga0207697_10001561 3300025315 Bacteria 12372
230 Ga0207697_10005044 3300025315 Bacteria 6188
231 Ga0207653_10054434 3300025885 Bacteria 1338
232 Ga0207692_10171566 3300025898 Unclassified 1257
233 Ga0207688_10016084 3300025901 Unclassified 4056
234 Ga0207688_10105271 3300025901 Bacteria 1633
235 Ga0207680_10024311 3300025903 Unclassified 3323
236 Ga0207680_10035827 3300025903 Unclassified 2853
237 Ga0207680_10077298 3300025903 Unclassified 2082
238 Ga0207699_10011524 3300025906 Bacteria 4469
239 Ga0207645_10000980 3300025907 Bacteria 23596
240 Ga0207645_10001938 3300025907 Bacteria 16702
241 Ga0207645_10018357 3300025907 Bacteria 4603
242 Ga0207645_10023454 3300025907 Bacteria 4011
243 Ga0207684_10000118 3300025910 Bacteria 145120
244 Ga0207684_10003119 3300025910 Bacteria 16342
245 Ga0207684_10003162 3300025910 Bacteria 16199
246 Ga0207684_10019318 3300025910 Bacteria 5829
247 Ga0207684_10029791 3300025910 Bacteria 4646
248 Ga0207684_10134135 3300025910 Bacteria 2126
249 Ga0207684_10144901 3300025910 Bacteria 2043
250 Ga0207684_10457337 3300025910 Bacteria 1096
251 Ga0207684_10461008 3300025910 Bacteria 1091
252 Ga0207684_10590988 3300025910 Unclassified 948
253 Ga0207695_10000222 3300025913 Bacteria 152313
254 Ga0207671_10338588 3300025914 Bacteria 1192
255 Ga0207671_10690585 3300025914 Unclassified 812
256 Ga0207693_10000865 3300025915 Bacteria 27049
257 Ga0207693_10014788 3300025915 Bacteria 6269
258 Ga0207693_10035906 3300025915 Unclassified 3907
259 Ga0207693_10107041 3300025915 Bacteria 2193
260 Ga0207693_10596433 3300025915 Bacteria 860
261 Ga0207663_10024698 3300025916 Unclassified 3464
262 Ga0207663_10085719 3300025916 Bacteria 2075
263 Ga0207662_10096108 3300025918 Bacteria 1830
264 Ga0207657_10057859 3300025919 Unclassified 3339
265 Ga0207657_10080182 3300025919 Unclassified 2744
266 Ga0207646_10002983 3300025922 Bacteria 19550
267 Ga0207646_10003129 3300025922 Bacteria 18977
268 Ga0207646_10020847 3300025922 Bacteria 6065
269 Ga0207646_10028080 3300025922 Bacteria 5126
270 Ga0207646_10031098 3300025922 Unclassified 4834
271 Ga0207646_10037584 3300025922 Unclassified 4365
272 Ga0207646_10062866 3300025922 Bacteria 3314
273 Ga0207646_10132182 3300025922 Unclassified 2247
274 Ga0207646_10226410 3300025922 Bacteria 1689
275 Ga0207646_10300017 3300025922 Bacteria 1451
276 Ga0207646_10343393 3300025922 Bacteria 1349
277 Ga0207646_10511122 3300025922 Bacteria 1082
278 Ga0207681_10132311 3300025923 Bacteria 1846
279 Ga0207681_10199835 3300025923 Bacteria 1534
280 Ga0207650_10007444 3300025925 Bacteria 7462
281 Ga0207650_10582127 3300025925 Unclassified 940
282 Ga0207659_10010456 3300025926 Bacteria 5834
283 Ga0207659_10095851 3300025926 Bacteria 2226
284 Ga0207659_10105176 3300025926 Bacteria 2135
285 Ga0207700_10012329 3300025928 Bacteria 5506
286 Ga0207700_10131839 3300025928 Bacteria 2042
287 Ga0207700_10227667 3300025928 Bacteria 1583
288 Ga0207664_10018677 3300025929 Bacteria 5110
289 Ga0207664_10537310 3300025929 Bacteria 1048
290 Ga0207644_10007007 3300025931 Bacteria 7338
291 Ga0207644_10009054 3300025931 Bacteria 6527
292 Ga0207644_10068799 3300025931 Unclassified 2584
293 Ga0207644_10622520 3300025931 Bacteria 897
294 Ga0207706_10016130 3300025933 Bacteria 6750
295 Ga0207706_10042815 3300025933 Bacteria 4013
296 Ga0207706_10212034 3300025933 Bacteria 1697
297 Ga0207686_10087610 3300025934 Unclassified 2048
298 Ga0207670_10192999 3300025936 Bacteria 1542
299 Ga0207669_10004948 3300025937 Bacteria 5929
300 Ga0207669_10005610 3300025937 Bacteria 5650
301 Ga0207669_10070256 3300025937 Bacteria 2194
302 Ga0207704_10205577 3300025938 Bacteria 1445
303 Ga0207665_10020018 3300025939 Bacteria 4396
304 Ga0207665_10092905 3300025939 Bacteria 2094
305 Ga0207665_10102787 3300025939 Unclassified 1998
306 Ga0207665_10267550 3300025939 Bacteria 1268
307 Ga0207665_10420832 3300025939 Bacteria 1020
308 Ga0207691_10000134 3300025940 Bacteria 67672
309 Ga0207691_10000402 3300025940 Bacteria 43303
310 Ga0207691_10022754 3300025940 Bacteria 5908
311 Ga0207661_10151576 3300025944 Bacteria 2005
312 Ga0207679_10177049 3300025945 Unclassified 1761
313 Ga0207651_10053837 3300025960 Bacteria 2753
314 Ga0207651_10260911 3300025960 Unclassified 1422
315 Ga0207651_10271253 3300025960 Bacteria 1397
316 Ga0207712_10188564 3300025961 Bacteria 1626
317 Ga0207668_10007557 3300025972 Bacteria 6466
318 Ga0207668_10076844 3300025972 Bacteria 2405
319 Ga0207668_10091479 3300025972 Bacteria 2236
320 Ga0207658_10004653 3300025986 Bacteria 9516
321 Ga0207658_10046068 3300025986 Bacteria 3182
322 Ga0207658_10302229 3300025986 Bacteria 1379
323 Ga0207677_10002297 3300026023 Bacteria 10047
324 Ga0207677_10030520 3300026023 Bacteria 3442
325 Ga0207677_10038810 3300026023 Bacteria 3125
326 Ga0207677_10207961 3300026023 Unclassified 1560
327 Ga0207677_10723350 3300026023 Unclassified 885
328 Ga0207703_10332262 3300026035 Unclassified 1395
329 Ga0207678_10501663 3300026067 Bacteria 1058
330 Ga0207702_10116551 3300026078 Unclassified 2384
331 Ga0207648_10014604 3300026089 Bacteria 7251
332 Ga0207648_10086203 3300026089 Unclassified 2740
333 Ga0207648_10433602 3300026089 Bacteria 1195
334 Ga0207675_100258981 3300026118 Bacteria 1685
335 Ga0207683_10005420 3300026121 Bacteria 10931
336 Ga0207683_10058852 3300026121 Unclassified 3374
337 Ga0207683_10281773 3300026121 Bacteria 1519
338 Ga0209974_10048738 3300027876 Bacteria 1421
339 Ga0268266_10010400 3300028379 Bacteria 8133
340 Ga0268266_10029319 3300028379 Unclassified 4679
341 Ga0268266_10338312 3300028379 Bacteria 1412
342 Ga0268264_10000749 3300028381 Bacteria 36626
343 Ga0268264_10758571 3300028381 Bacteria 967
344 Ga0373944_0011955 3300035089 Unclassified 2387
345 Ga0373923_0065067 3300035111 Bacteria 1556
346 Ga0373945_0070783 3300035116 Unclassified 1320
347 Ga0373957_0120338 3300035120 Bacteria 1062
348 Ga0373943_0167508 3300035170 Bacteria 1200
349 Ga0373955_0003401 3300035172 Bacteria 6995
350 Ga0373961_0045761 3300035241 Unclassified 1280
351 Ga0316574_0335056 3300035398 Unclassified 959
352 Ga0373931_0273286 3300035691 Unclassified 1035
353 Ga0373927_0119448 3300035695 Unclassified 1720
354 Ga0373947_0016646 3300035725 Bacteria 4224
355 Ga0373947_0038467 3300035725 Bacteria 2842
356 Ga0373947_0471656 3300035725 Unclassified 851
357 Ga0373947_0494739 3300035725 Unclassified 831
358 Ga0373947_0551280 3300035725 Unclassified 785
359 Ga0373937_0037648 3300036401 Unclassified 4408
360 Ga0373925_0112920 3300037068 Unclassified 2101
361 Ga0395900_0006323 3300037418 Bacteria 12348
362 Ga0395900_1088144 3300037418 Unclassified 717
363 Ga0395898_0079685 3300037466 Bacteria 3159
364 Ga0395898_0558832 3300037466 Bacteria 1087
365 Ga0395905_0026611 3300037471 Bacteria 5454
366 Ga0436364_0617306 3300037853 Bacteria 7690
367 Ga0436364_1165275 3300037853 Bacteria 2305
368 Ga0436364_1352704 3300037853 Bacteria 1395
369 Ga0395901_0000503 3300038443 Bacteria 45231
370 Ga0436365_0422633 3300039437 Bacteria 6246
371 Ga0436365_0647129 3300039437 Bacteria 2092
372 Ga0436365_1173635 3300039437 Bacteria 45592
373 Ga0436365_1739700 3300039437 Bacteria 5291
374 Ga0436360_0090331 3300039438 Bacteria 3448
375 Ga0436360_0190792 3300039438 Unclassified 1466
376 Ga0436360_0318952 3300039438 Bacteria 2377
377 Ga0436360_0802982 3300039438 Unclassified 3944
378 Ga0436360_1207060 3300039438 Bacteria 1214
379 Ga0436361_0004636 3300039447 Bacteria 2005
380 Ga0436361_0340544 3300039447 Bacteria 2279
381 Ga0436361_0356531 3300039447 Unclassified 874
382 Ga0436361_0893359 3300039447 Bacteria 1453
383 Ga0436361_0979006 3300039447 Bacteria 5200
384 Ga0436361_1044139 3300039447 Unclassified 3127
385 Ga0436361_1126290 3300039447 Bacteria 2658
386 Ga0436361_1191902 3300039447 Unclassified 1511
387 Ga0436363_0824908 3300039450 Bacteria 1278
388 Ga0436363_1332947 3300039450 Bacteria 11761
389 Ga0436362_0161128 3300039453 Unclassified 2253
390 Ga0436362_0164538 3300039453 Bacteria 1143
391 Ga0436362_1218981 3300039453 Bacteria 1024
392 Ga0436362_1291800 3300039453 Unclassified 2263
393 Ga0439455_0008457 3300042012 Bacteria 2207
394 Ga0439440_0008471 3300042993 Bacteria 2112
395 Ga0451576_0170036 3300045051 Bacteria 2275
396 Ga0451576_0184703 3300045051 Bacteria 2177
397 Ga0495629_0323578 3300046459 Unclassified 1054
398 Ga0495651_0010739 3300046462 Bacteria 7041
399 Ga0495580_0047699 3300046472 Unclassified 3036
400 Ga0495607_0052405 3300046501 Bacteria 2364
401 Ga0495628_0046535 3300046516 Bacteria 3445
402 Ga0495630_0032498 3300046517 Unclassified 3889
403 Ga0495643_0000208 3300046522 Bacteria 90476
404 Ga0495652_0079613 3300046529 Unclassified 2708
405 Ga0495598_0010191 3300046537 Unclassified 2246
406 Ga0495645_0170609 3300046543 Unclassified 1498
407 Ga0495658_0034604 3300046683 Bacteria 2773
408 Ga0495658_0164969 3300046683 Unclassified 1368
409 Ga0495613_0196736 3300046689 Bacteria 1423
410 Ga0495674_0509073 3300047319 Bacteria 962
411 Ga0495683_0279001 3300047323 Bacteria 724
412 Ga0495675_0014594 3300047444 Unclassified 4967
413 Ga0495684_0095211 3300047471 Bacteria 2254
414 Ga0496100_0034249 3300048903 Unclassified 3185
415 Ga0496101_0014364 3300048904 Bacteria 5319
416 Ga0496102_0366946 3300048905 Bacteria 1355
417 Ga0496103_0045979 3300048906 Unclassified 2694
418 Ga0496104_0098601 3300048907 Unclassified 2797
419 Ga0496104_0312248 3300048907 Unclassified 1485
420 Ga0496105_0324756 3300048908 Bacteria 1233
421 Ga0496106_0012305 3300048909 Bacteria 6314
422 Ga0496106_0857498 3300048909 Unclassified 719
423 Ga0496107_0009139 3300048910 Bacteria 6870
424 Ga0496108_0123581 3300048911 Bacteria 2221
425 Ga0496109_0215984 3300048912 Unclassified 1803
426 Ga0496109_0694055 3300048912 Bacteria 955
427 Ga0496109_0943058 3300048912 Unclassified 801
428 Ga0496110_0067171 3300048913 Unclassified 3173
429 Ga0496110_0110140 3300048913 Bacteria 2474
430 Ga0496111_0317940 3300048914 Bacteria 1153
431 Ga0496112_0055677 3300048915 Bacteria 3890
432 Ga0496112_0149631 3300048915 Bacteria 2302
433 Ga0496113_0101741 3300048916 Bacteria 2228
434 Ga0496115_0000563 3300048918 Bacteria 28787
435 Ga0496115_0012393 3300048918 Bacteria 6415
436 Ga0496115_0034243 3300048918 Bacteria 4014
437 nmdc:mga08y16_172770_c1 3300050511 Bacteria 2244
438 nmdc:mga0n895_359182_c1 3300050512 Bacteria 1475
439 nmdc:mga08x19_227886_c1 3300050514 Unclassified 1282
440 nmdc:mga08x19_63174_c1 3300050514 Bacteria 2402
441 nmdc:mga0a205_174001_c1 3300050515 Bacteria 1075
442 Ga0495601_0304283 3300053077 Bacteria 1038
443 Ga0495601_0438725 3300053077 Unclassified 845
444 Ga0500555_000003 3300053103 Bacteria 392994
445 Ga0500645_005782 3300053730 Bacteria 4500
446 Ga0496104_0129811
447 SwRhRL2b_contig_2569698
448 CNXas_1000001
449 JGI25404J52841_10003450
450 Ga0065704_10129472
451 Ga0065704_10150200
452 Ga0065712_10023662
453 Ga0065712_10153070
454 Ga0065715_10005879
455 Ga0065707_10103821
456 Ga0070658_10124569
457 Ga0070676_10009591
458 Ga0070676_10034005
459 Ga0070690_100058126
460 Ga0070670_100003753
461 Ga0070670_100190283
462 Ga0070666_10009391
463 Ga0070666_10023780
464 Ga0070666_10033207
465 Ga0068868_100004120
466 Ga0068868_100033428
467 Ga0068868_100153046
468 Ga0068868_100544694
469 Ga0070660_100100032
470 Ga0070661_100661093
471 Ga0070668_100038328
472 Ga0070668_100294397
473 Ga0070669_100017508
474 Ga0070675_100005532
475 Ga0070675_100035921
476 Ga0070675_100054965
477 Ga0070675_100057069
478 Ga0070675_100134793
479 Ga0070671_100009795
480 Ga0070671_100014906
481 Ga0070671_100029261
482 Ga0070671_100049908
483 Ga0070671_100052164
484 Ga0070674_100005636
485 Ga0070674_100008615
486 Ga0070673_100014669
487 Ga0070673_100245174
488 Ga0070688_100035760
489 Ga0070688_100267832
490 Ga0070659_100084470
491 Ga0070667_100002937
492 Ga0070667_100008354
493 Ga0070667_100014028
494 Ga0070667_100082133
495 Ga0070703_10056338
496 Ga0070709_10141702
497 Ga0070709_10438965
498 Ga0070714_100092109
499 Ga0070714_100158269
500 Ga0070714_100182081
501 Ga0070714_100230427
502 Ga0070714_101299189
503 Ga0070713_100021863
504 Ga0070713_100033050
505 Ga0070713_100442587
506 Ga0070710_10030749
507 Ga0070711_100069136
508 Ga0070708_100018949
509 Ga0070708_100033639
510 Ga0070708_100042803
511 Ga0070708_100060311
512 Ga0070708_100112919
513 Ga0070708_100116272
514 Ga0070708_100274127
515 Ga0070708_100282824
516 Ga0070663_100737167
517 Ga0070678_100070935
518 Ga0070662_100021483
519 Ga0070662_100038937
520 Ga0070662_100041333
521 Ga0070662_100042960
522 Ga0070662_100086268
523 Ga0068867_100047317
524 Ga0068867_100426936
525 Ga0070685_10020804
526 Ga0070706_100000060
527 Ga0070706_100018014
528 Ga0070706_100223490
529 Ga0070706_100318436
530 Ga0070706_100370931
531 Ga0070707_100002186
532 Ga0070707_100002340
533 Ga0070707_100017313
534 Ga0070707_100020280
535 Ga0070707_100028906
536 Ga0070707_100049593
537 Ga0070707_100050305
538 Ga0070707_100279496
539 Ga0070707_100418331
540 Ga0070707_100421201
541 Ga0070698_100000476
542 Ga0070698_100012108
543 Ga0070698_100047736
544 Ga0070698_100228622
545 Ga0070699_100010528
546 Ga0070699_100056038
547 Ga0070699_100074764
548 Ga0070699_100163852
549 Ga0070699_100376681
550 Ga0070699_100529589
551 Ga0070697_100001934
552 Ga0070697_100020168
553 Ga0070697_100025323
554 Ga0070697_100025526
555 Ga0070697_100043509
556 Ga0070697_100090086
557 Ga0070697_100106098
558 Ga0070697_100343974
559 Ga0070697_100378133
560 Ga0070697_100501239
561 Ga0070672_100036943
562 Ga0070672_100511792
563 Ga0070696_100036828
564 Ga0070693_100101327
565 Ga0070665_100019116
566 Ga0070665_100094275
567 Ga0070665_100144240
568 Ga0070704_100097606
569 Ga0070704_100276905
570 Ga0070664_100201795
571 Ga0070664_100935239
572 Ga0068852_100659608
573 Ga0068861_100127380
574 Ga0068861_100641177
575 Ga0068870_10612128
576 Ga0068858_100280025
577 Ga0068858_100654677
578 Ga0068860_100000351
579 Ga0068860_100156184
580 Ga0068860_100412515
581 Ga0068862_100002998
582 Ga0068862_100086266
583 Ga0068862_101380516
584 Ga0081455_10326036
585 Ga0081540_1003850
586 Ga0081539_10000153
587 Ga0081539_10001102
588 Ga0070717_10005697
589 Ga0070717_10036557
590 Ga0070717_10159105
591 Ga0070717_10313686
592 Ga0070716_100125949
593 Ga0070716_100305413
594 Ga0070712_100005102
595 Ga0070712_100024246
596 Ga0070712_100071784
597 Ga0097621_100008433
598 Ga0097621_100030270
599 Ga0068871_100029521
600 Ga0075434_100921755
601 Ga0068865_100004150
602 Ga0068865_100028061
603 Ga0068865_100135620
604 Ga0075436_100213062
605 Ga0105240_10157296
606 Ga0105240_10775684
607 Ga0105240_11251626
608 Ga0111539_10468537
609 Ga0105245_10037397
610 Ga0105245_10246000
611 Ga0105245_10535288
612 Ga0105245_11792824
613 Ga0105247_10090447
614 Ga0105242_10032394
615 Ga0105237_10195304
616 Ga0105249_10058166
617 Ga0099796_10048732
618 Ga0105239_10038312
619 Ga0105239_10305996
620 Ga0105239_10508172
621 Ga0157374_10023982
622 Ga0157374_10056288
623 Ga0157374_10114424
624 Ga0157374_10157580
625 Ga0157374_10627860
626 Ga0157374_10701790
627 Ga0157378_10002888
628 Ga0157378_10014245
629 Ga0157378_10023188
630 Ga0157378_10068357
631 Ga0157378_10077084
632 Ga0157378_10112804
633 Ga0157378_10124476
634 Ga0157378_10127865
635 Ga0157378_10403698
636 Ga0157378_10421413
637 Ga0163162_10006418
638 Ga0163162_10017378
639 Ga0163162_10025732
640 Ga0163162_10026439
641 Ga0163162_10040390
642 Ga0163162_10241622
643 Ga0163162_10259580
644 Ga0157372_10017614
645 Ga0157372_10030278
646 Ga0157372_10223971
647 Ga0157372_10225652
648 Ga0157372_10244112
649 Ga0157375_10003579
650 Ga0157375_10013450
651 Ga0157375_10105796
652 Ga0157375_10388390
653 Ga0157375_10491083
654 Ga0157375_10930144
655 Ga0157379_10227178
656 Ga0157376_10010952
657 Ga0157376_10071076
658 Ga0163161_10008149
659 Ga0163161_10704283
660 Ga0213872_10003195
661 Ga0213872_10015966
662 Ga0213872_10081761
663 Ga0213872_10087985
664 Ga0213872_10099888
665 Ga0213874_10069167
666 Ga0213876_10002382
667 Ga0213876_10050456
668 Ga0213875_10040740
669 Ga0213875_10170132
670 Ga0207666_1014062
671 Ga0207673_1004706
672 Ga0207697_10000365
673 Ga0207697_10000494
674 Ga0207697_10001561
675 Ga0207697_10005044
676 Ga0207653_10054434
677 Ga0207692_10171566
678 Ga0207688_10016084
679 Ga0207688_10105271
680 Ga0207680_10024311
681 Ga0207680_10035827
682 Ga0207680_10077298
683 Ga0207699_10011524
684 Ga0207645_10000980
685 Ga0207645_10001938
686 Ga0207645_10018357
687 Ga0207645_10023454
688 Ga0207684_10000118
689 Ga0207684_10003119
690 Ga0207684_10003162
691 Ga0207684_10019318
692 Ga0207684_10029791
693 Ga0207684_10134135
694 Ga0207684_10144901
695 Ga0207684_10457337
696 Ga0207684_10461008
697 Ga0207684_10590988
698 Ga0207695_10000222
699 Ga0207671_10338588
700 Ga0207671_10690585
701 Ga0207693_10000865
702 Ga0207693_10014788
703 Ga0207693_10035906
704 Ga0207693_10107041
705 Ga0207693_10596433
706 Ga0207663_10024698
707 Ga0207663_10085719
708 Ga0207662_10096108
709 Ga0207657_10057859
710 Ga0207657_10080182
711 Ga0207646_10002983
712 Ga0207646_10003129
713 Ga0207646_10020847
714 Ga0207646_10028080
715 Ga0207646_10031098
716 Ga0207646_10037584
717 Ga0207646_10062866
718 Ga0207646_10132182
719 Ga0207646_10226410
720 Ga0207646_10300017
721 Ga0207646_10343393
722 Ga0207646_10511122
723 Ga0207681_10132311
724 Ga0207681_10199835
725 Ga0207650_10007444
726 Ga0207650_10582127
727 Ga0207659_10010456
728 Ga0207659_10095851
729 Ga0207659_10105176
730 Ga0207700_10012329
731 Ga0207700_10131839
732 Ga0207700_10227667
733 Ga0207664_10018677
734 Ga0207664_10537310
735 Ga0207644_10007007
736 Ga0207644_10009054
737 Ga0207644_10068799
738 Ga0207644_10622520
739 Ga0207706_10016130
740 Ga0207706_10042815
741 Ga0207706_10212034
742 Ga0207686_10087610
743 Ga0207670_10192999
744 Ga0207669_10004948
745 Ga0207669_10005610
746 Ga0207669_10070256
747 Ga0207704_10205577
748 Ga0207665_10020018
749 Ga0207665_10092905
750 Ga0207665_10102787
751 Ga0207665_10267550
752 Ga0207665_10420832
753 Ga0207691_10000134
754 Ga0207691_10000402
755 Ga0207691_10022754
756 Ga0207661_10151576
757 Ga0207679_10177049
758 Ga0207651_10053837
759 Ga0207651_10260911
760 Ga0207651_10271253
761 Ga0207712_10188564
762 Ga0207668_10007557
763 Ga0207668_10076844
764 Ga0207668_10091479
765 Ga0207658_10004653
766 Ga0207658_10046068
767 Ga0207658_10302229
768 Ga0207677_10002297
769 Ga0207677_10030520
770 Ga0207677_10038810
771 Ga0207677_10207961
772 Ga0207677_10723350
773 Ga0207703_10332262
774 Ga0207678_10501663
775 Ga0207702_10116551
776 Ga0207648_10014604
777 Ga0207648_10086203
778 Ga0207648_10433602
779 Ga0207675_100258981
780 Ga0207683_10005420
781 Ga0207683_10058852
782 Ga0207683_10281773
783 Ga0209974_10048738
784 Ga0268266_10010400
785 Ga0268266_10029319
786 Ga0268266_10338312
787 Ga0268264_10000749
788 Ga0268264_10758571
789 Ga0373944_0011955
790 Ga0373923_0065067
791 Ga0373945_0070783
792 Ga0373957_0120338
793 Ga0373943_0167508
794 Ga0373955_0003401
795 Ga0373961_0045761
796 Ga0316574_0335056
797 Ga0373931_0273286
798 Ga0373927_0119448
799 Ga0373947_0016646
800 Ga0373947_0038467
801 Ga0373947_0471656
802 Ga0373947_0494739
803 Ga0373947_0551280
804 Ga0373937_0037648
805 Ga0373925_0112920
806 Ga0395900_0006323
807 Ga0395900_1088144
808 Ga0395898_0079685
809 Ga0395898_0558832
810 Ga0395905_0026611
811 Ga0436364_0617306
812 Ga0436364_1165275
813 Ga0436364_1352704
814 Ga0395901_0000503
815 Ga0436365_0422633
816 Ga0436365_0647129
817 Ga0436365_1173635
818 Ga0436365_1739700
819 Ga0436360_0090331
820 Ga0436360_0190792
821 Ga0436360_0318952
822 Ga0436360_0802982
823 Ga0436360_1207060
824 Ga0436361_0004636
825 Ga0436361_0340544
826 Ga0436361_0356531
827 Ga0436361_0893359
828 Ga0436361_0979006
829 Ga0436361_1044139
830 Ga0436361_1126290
831 Ga0436361_1191902
832 Ga0436363_0824908
833 Ga0436363_1332947
834 Ga0436362_0161128
835 Ga0436362_0164538
836 Ga0436362_1218981
837 Ga0436362_1291800
838 Ga0439455_0008457
839 Ga0439440_0008471
840 Ga0451576_0170036
841 Ga0451576_0184703
842 Ga0495629_0323578
843 Ga0495651_0010739
844 Ga0495580_0047699
845 Ga0495607_0052405
846 Ga0495628_0046535
847 Ga0495630_0032498
848 Ga0495643_0000208
849 Ga0495652_0079613
850 Ga0495598_0010191
851 Ga0495645_0170609
852 Ga0495658_0034604
853 Ga0495658_0164969
854 Ga0495613_0196736
855 Ga0495674_0509073
856 Ga0495683_0279001
857 Ga0495675_0014594
858 Ga0495684_0095211
859 Ga0496100_0034249
860 Ga0496101_0014364
861 Ga0496102_0366946
862 Ga0496103_0045979
863 Ga0496104_0098601
864 Ga0496104_0312248
865 Ga0496105_0324756
866 Ga0496106_0012305
867 Ga0496106_0857498
868 Ga0496107_0009139
869 Ga0496108_0123581
870 Ga0496109_0215984
871 Ga0496109_0694055
872 Ga0496109_0943058
873 Ga0496110_0067171
874 Ga0496110_0110140
875 Ga0496111_0317940
876 Ga0496112_0055677
877 Ga0496112_0149631
878 Ga0496113_0101741
879 Ga0496115_0000563
880 Ga0496115_0012393
881 Ga0496115_0034243
882 nmdc:mga08y16_172770_c1
883 nmdc:mga0n895_359182_c1
884 nmdc:mga08x19_227886_c1
885 nmdc:mga08x19_63174_c1
886 nmdc:mga0a205_174001_c1
887 Ga0495601_0304283
888 Ga0495601_0438725
889 Ga0500555_000003
890 Ga0500645_005782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

48

226

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ev5-assembly1.cif.gz_A crystal structure of bleg-1 b3 metallo-beta-lactamase 0.8887 2 195
7ev5-assembly1.cif.gz_A crystal structure of bleg-1 b3 metallo-beta-lactamase 0.8761 2 195
2xf4-assembly1.cif.gz_A-2 crystal structure of salmonella enterica serovar typhimurium ycbl 0.856 1 196
7l0b-assembly1.cif.gz_A crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme 0.8553 2 196
7l0b-assembly3.cif.gz_C crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme 0.8537 2 196
ID Description Score Start End Superfamily
2xf4A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.856 1 196 3.60.15.10
af_Q2FY29_1_207_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8535 1 195 3.60.15.10
2xf4A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.852 1 196 3.60.15.10
af_Q2FY29_1_207_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8453 1 195 3.60.15.10
af_A0A0R0KZP1_7_202_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8414 93 195 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A2V5R7V5-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9857 44 196 GO:0016787
AF-A0A1Y3NKQ9-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9819 111 196 GO:0016787
AF-A0A2V5R7V5-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9794 44 196 GO:0016787
AF-A0A2V6C1Z6-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9733 99 196 GO:0016787
AF-A3ZW37-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9692 98 195 GO:0016787

Map