F445588

General Info

Members Datasets Scaffolds Average Seq Length
445 275 395 351

Family's Representative Sequence

Representative Sequence 3300046679|Ga0495623_0002136|Ga0495623_0002136_8306_9460
Length 384
Sequence MKFAHAQAFVRRQPSLSILSLVRSVIGHVAPIALSYGALEIMLHDLPAIQKNVHWGYFDAALAPALIVESGDFVRAEAITHHAGDAPDLMMDDKVRALYDTIPESDRQPGVHLMTGPIFVKDAKPGDLLEVRYLQMIPRFNYGSNLAAHWGHLFTDFEKERVTIYELDQASNTAHALYAYDYPGKYLVPGKRTEVRDCCRELALEGIRVPVRPHLGTAGVAPDVAGRVSTVPPGAHGGNIDNWRIGAGSTMYYPVAVDGGLFSIGDPHVSQGDGEISGTAIEASLNVMFQIVLRRDFAFPSPLLETPDFWIVHGFDEDLDVATKNASRDMVLLLTEQQGLSRDDAYSLMSVAADFSVTQVVDGRQGIHCKIPRSIFPPKKKPRA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
4 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
5 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
6 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
7 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
8 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
9 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
10 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
11 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
12 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
13 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
14 2643221583 Caulobacter sp. Root655 Isolate Unclassified
15 2643221584 Caulobacter sp. Root656 Isolate Unclassified
16 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
17 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
18 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
19 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
20 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
21 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
22 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
23 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
24 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
25 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
26 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
27 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
28 2818991435 Caulobacter henricii 536 Isolate Unclassified
29 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
30 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
31 2842733646 Variovorax sp. R-72446 Isolate Unclassified
32 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
33 2849560528 Caulobacter zeae 410 Isolate Unclassified
34 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
35 2851153111 Caulobacter radicis 736 Isolate Unclassified
36 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
37 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
38 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
39 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
40 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
41 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
42 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
43 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
44 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
45 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
46 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
47 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
48 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
49 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
50 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
51 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
52 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
53 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
54 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
55 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
56 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
57 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
58 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
59 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
60 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
61 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
62 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
63 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
147 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
158 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
162 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
200 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
201 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
202 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
208 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
227 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
238 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
239 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
240 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
241 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
242 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
243 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
244 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
245 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
246 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
247 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
248 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
249 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
250 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
251 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
252 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
253 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
254 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
255 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
256 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
257 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
258 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
259 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
260 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
261 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
264 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
265 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
266 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
267 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
268 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
269 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
270 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
271 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
272 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
273 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
274 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
275 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.76
Metatranscriptomes 0
Isolates 11.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.49
Nodule 1.12
Rhizoplane 2.7
Rhizosphere 55.51
Stem 0
Stem Tuber 0
Unclassified 16.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3178000 2162886007 Bacteria 36079
2 JGI24739J22299_10005888 3300001989 Bacteria 4642
3 JGI24735J21928_10002669 3300002067 Bacteria 6165
4 JGI24738J21930_10003179 3300002075 Bacteria 4194
5 JGI25156J39149_1000462 3300002705 Bacteria 24626
6 JGI25165J46597_1000743 3300003214 Bacteria 25157
7 Ga0055533_1000072 3300003756 Bacteria 144571
8 Ga0055527_1000010 3300003760 Bacteria 380677
9 Ga0055535_1000010 3300003761 Bacteria 380677
10 Ga0055542_1000016 3300003762 Bacteria 380677
11 Ga0055529_1000012 3300003763 Bacteria 380677
12 Ga0055537_1005565 3300003773 Bacteria 3360
13 Ga0055528_1012470 3300003790 Bacteria 3293
14 Ga0055531_10001500 3300003794 Bacteria 17140
15 Ga0055531_10001617 3300003794 Bacteria 16338
16 Ga0065165_1000388 3300005262 Bacteria 71380
17 Ga0065704_10000204 3300005289 Bacteria 211587
18 Ga0070682_100117971 3300005337 Bacteria 1777
19 Ga0070669_100003645 3300005353 Bacteria 11103
20 Ga0070667_100091165 3300005367 Bacteria 2620
21 Ga0070665_100001383 3300005548 Bacteria 28589
22 Ga0070665_100063803 3300005548 Bacteria 3694
23 Ga0068864_100000257 3300005618 Bacteria 47415
24 Ga0068863_100000167 3300005841 Bacteria 70943
25 Ga0068858_100000198 3300005842 Bacteria 64645
26 Ga0068858_100202773 3300005842 Bacteria 1876
27 Ga0075368_10009749 3300006042 Bacteria 3461
28 Ga0075363_100013025 3300006048 Bacteria 4019
29 Ga0075364_10002414 3300006051 Bacteria 10469
30 Ga0075367_10020023 3300006178 Bacteria 3720
31 Ga0075369_10004735 3300006186 Bacteria 5049
32 Ga0075366_10017756 3300006195 Bacteria 4100
33 Ga0075366_10091818 3300006195 Bacteria 1819
34 Ga0075370_10009372 3300006353 Bacteria 5079
35 Ga0075370_10080838 3300006353 Bacteria 1868
36 Ga0099795_10033041 3300007788 Bacteria 1794
37 Ga0105250_10010246 3300009092 Bacteria 3908
38 Ga0105240_10184904 3300009093 Bacteria 2455
39 Ga0105247_10124876 3300009101 Bacteria 1671
40 Ga0105248_10058074 3300009177 Bacteria 4344
41 Ga0105248_10072307 3300009177 Bacteria 3876
42 Ga0105238_10036968 3300009551 Bacteria 4965
43 Ga0163162_10007506 3300013306 Bacteria 10617
44 Ga0157375_10016284 3300013308 Bacteria 6672
45 Ga0182008_10000057 3300014497 Bacteria 100700
46 Ga0157379_10009689 3300014968 Bacteria 8386
47 Ga0213872_10027062 3300021361 Bacteria 2633
48 Ga0209674_100011 3300025226 Bacteria 997175
49 Ga0209672_100002 3300025228 Bacteria 1733325
50 Ga0209147_100003 3300025229 Bacteria 1733325
51 Ga0209563_100511 3300025230 Bacteria 13177
52 Ga0207427_100818 3300025231 Bacteria 14041
53 Ga0209258_100042 3300025242 Bacteria 380729
54 Ga0209148_1000006 3300025254 Bacteria 1733325
55 Ga0209759_1000051 3300025256 Bacteria 214016
56 Ga0209233_1000033 3300025261 Bacteria 596094
57 Ga0209233_1000322 3300025261 Bacteria 51917
58 Ga0209565_1000466 3300025263 Bacteria 30502
59 Ga0209455_1000003 3300025272 Bacteria 1471893
60 Ga0209673_1020914 3300025273 Bacteria 2302
61 Ga0209675_1007194 3300025291 Bacteria 4313
62 Ga0209676_1000393 3300025292 Bacteria 79869
63 Ga0209564_1002405 3300025295 Bacteria 14932
64 Ga0209758_1003486 3300025297 Bacteria 14246
65 Ga0209758_1005270 3300025297 Bacteria 10109
66 Ga0209050_1000401 3300025298 Bacteria 81113
67 Ga0209050_1000784 3300025298 Bacteria 45231
68 Ga0209256_1000666 3300025299 Bacteria 46480
69 Ga0209256_1012151 3300025299 Bacteria 3340
70 Ga0209051_1020112 3300025303 Bacteria 2889
71 Ga0209257_1000373 3300025304 Bacteria 90001
72 Ga0209257_1000438 3300025304 Bacteria 79869
73 Ga0207696_1017327 3300025711 Bacteria 2388
74 Ga0207680_10013810 3300025903 Bacteria 4159
75 Ga0207647_10036647 3300025904 Bacteria 3115
76 Ga0207681_10004711 3300025923 Bacteria 8390
77 Ga0207694_10077531 3300025924 Bacteria 2604
78 Ga0207711_10000895 3300025941 Bacteria 28682
79 Ga0207711_10042436 3300025941 Bacteria 3876
80 Ga0207711_10276907 3300025941 Bacteria 1545
81 Ga0207640_10117822 3300025981 Bacteria 1896
82 Ga0207658_10023300 3300025986 Bacteria 4321
83 Ga0207703_10000189 3300026035 Bacteria 72189
84 Ga0207678_10242641 3300026067 Bacteria 1543
85 Ga0207641_10000120 3300026088 Bacteria 116070
86 Ga0207676_10000424 3300026095 Bacteria 35638
87 Ga0207683_10101053 3300026121 Bacteria 2575
88 Ga0207428_10174785 3300027907 Bacteria 1625
89 Ga0268266_10004564 3300028379 Bacteria 13233
90 Ga0265334_10041297 3300028573 Bacteria 1804
91 Ga0307517_10000160 3300028786 Bacteria 108370
92 Ga0307515_10029264 3300028794 Bacteria 9320
93 Ga0265338_10091239 3300028800 Bacteria 2518
94 Ga0307512_10049641 3300030522 Bacteria 3382
95 Ga0265340_10118638 3300031247 Bacteria 1218
96 Ga0265327_10000110 3300031251 Bacteria 181251
97 Ga0307509_10001242 3300031507 Bacteria 43229
98 Ga0307508_10000856 3300031616 Bacteria 35350
99 Ga0307516_10084789 3300031730 Bacteria 3007
100 Ga0307412_10000003 3300031911 Bacteria 659081
101 Ga0307414_10006745 3300032004 Bacteria 6421
102 Ga0307507_10005999 3300033179 Bacteria 19190
103 Ga0307510_10008528 3300033180 Bacteria 12222
104 Ga0395900_0132220 3300037418 Bacteria 2557
105 Ga0436364_0687087 3300037853 Bacteria 3038
106 Ga0436361_0414754 3300039447 Bacteria 8003
107 Ga0439435_0004737 3300042436 Bacteria 2950
108 Ga0466961_0007444 3300044693 Bacteria 6969
109 Ga0466959_0081025 3300045049 Bacteria 2339
110 Ga0466958_0033216 3300045836 Bacteria 3073
111 Ga0495627_000148 3300046453 Bacteria 84235
112 Ga0495627_000185 3300046453 Bacteria 69533
113 Ga0495603_0000860 3300046455 Bacteria 17378
114 Ga0495590_0003165 3300046457 Bacteria 6731
115 Ga0495590_0003378 3300046457 Bacteria 6528
116 Ga0495590_0004547 3300046457 Bacteria 5590
117 Ga0495590_0013534 3300046457 Bacteria 2996
118 Ga0495591_000037 3300046458 Bacteria 158323
119 Ga0495629_0000130 3300046459 Bacteria 65355
120 Ga0495629_0010325 3300046459 Bacteria 6801
121 Ga0495638_0000055 3300046460 Bacteria 196038
122 Ga0495638_0001445 3300046460 Bacteria 21488
123 Ga0495638_0001598 3300046460 Bacteria 20236
124 Ga0495638_0001768 3300046460 Bacteria 18926
125 Ga0495638_0007792 3300046460 Bacteria 7647
126 Ga0495638_0022652 3300046460 Bacteria 4121
127 Ga0495638_0023878 3300046460 Bacteria 3993
128 Ga0495638_0044840 3300046460 Bacteria 2784
129 Ga0495651_0026504 3300046462 Bacteria 4515
130 Ga0495653_0000287 3300046463 Bacteria 40916
131 Ga0495650_0000001 3300046471 Bacteria 1085492
132 Ga0495650_0000017 3300046471 Bacteria 542552
133 Ga0495650_0001117 3300046471 Bacteria 29317
134 Ga0495650_0004957 3300046471 Bacteria 8876
135 Ga0495650_0017389 3300046471 Bacteria 3606
136 Ga0495650_0030791 3300046471 Bacteria 2424
137 Ga0495580_0001717 3300046472 Bacteria 19250
138 Ga0495580_0022178 3300046472 Bacteria 4676
139 Ga0495605_0000871 3300046474 Bacteria 20887
140 Ga0495605_0009231 3300046474 Bacteria 5541
141 Ga0495605_0011049 3300046474 Bacteria 5045
142 Ga0495605_0011829 3300046474 Bacteria 4857
143 Ga0495605_0099692 3300046474 Bacteria 1337
144 Ga0495584_0069176 3300046491 Bacteria 1774
145 Ga0495585_0003904 3300046492 Bacteria 9891
146 Ga0495596_0000071 3300046500 Bacteria 75017
147 Ga0495596_0000886 3300046500 Bacteria 18064
148 Ga0495596_0000908 3300046500 Bacteria 17710
149 Ga0495607_0000335 3300046501 Bacteria 48836
150 Ga0495607_0018271 3300046501 Bacteria 4474
151 Ga0495583_0000029 3300046506 Bacteria 255536
152 Ga0495583_0000055 3300046506 Bacteria 201245
153 Ga0495583_0003872 3300046506 Bacteria 11087
154 Ga0495583_0018978 3300046506 Bacteria 3602
155 Ga0495606_0004419 3300046507 Bacteria 14063
156 Ga0495606_0004595 3300046507 Bacteria 13684
157 Ga0495606_0010219 3300046507 Bacteria 7822
158 Ga0495606_0012628 3300046507 Bacteria 6751
159 Ga0495606_0027470 3300046507 Bacteria 4035
160 Ga0495606_0085555 3300046507 Bacteria 1950
161 Ga0495610_0000034 3300046512 Bacteria 201408
162 Ga0495610_0000176 3300046512 Bacteria 71110
163 Ga0495610_0000239 3300046512 Bacteria 57860
164 Ga0495610_0000426 3300046512 Bacteria 43338
165 Ga0495610_0001395 3300046512 Bacteria 21444
166 Ga0495610_0022536 3300046512 Bacteria 3442
167 Ga0495616_0000464 3300046513 Bacteria 30834
168 Ga0495616_0021213 3300046513 Bacteria 3521
169 Ga0495620_0005689 3300046515 Bacteria 6939
170 Ga0495620_0015529 3300046515 Bacteria 3842
171 Ga0495620_0042472 3300046515 Bacteria 1986
172 Ga0495628_0006685 3300046516 Bacteria 10055
173 Ga0495628_0020455 3300046516 Bacteria 5457
174 Ga0495628_0048881 3300046516 Bacteria 3350
175 Ga0495630_0008763 3300046517 Bacteria 7266
176 Ga0495631_0028855 3300046518 Bacteria 2529
177 Ga0495631_0082820 3300046518 Bacteria 1383
178 Ga0495632_0000869 3300046519 Bacteria 26552
179 Ga0495632_0002061 3300046519 Bacteria 15785
180 Ga0495632_0018821 3300046519 Bacteria 3777
181 Ga0495637_0006746 3300046520 Bacteria 5746
182 Ga0495637_0009436 3300046520 Bacteria 4761
183 Ga0495643_0000039 3300046522 Bacteria 235175
184 Ga0495643_0002715 3300046522 Bacteria 13621
185 Ga0495643_0019197 3300046522 Bacteria 3958
186 Ga0495643_0048662 3300046522 Bacteria 2290
187 Ga0495643_0053869 3300046522 Bacteria 2155
188 Ga0495643_0085174 3300046522 Bacteria 1639
189 Ga0495648_0000029 3300046524 Bacteria 223499
190 Ga0495648_0000892 3300046524 Bacteria 31326
191 Ga0495648_0004028 3300046524 Bacteria 12688
192 Ga0495648_0027907 3300046524 Bacteria 3770
193 Ga0495648_0081601 3300046524 Bacteria 1838
194 Ga0495666_0024470 3300046526 Bacteria 2983
195 Ga0495642_0006094 3300046528 Bacteria 4630
196 Ga0495642_0020693 3300046528 Bacteria 2586
197 Ga0495642_0020815 3300046528 Bacteria 2579
198 Ga0495642_0039312 3300046528 Bacteria 1919
199 Ga0495652_0124833 3300046529 Bacteria 2047
200 Ga0495654_0000012 3300046530 Bacteria 328997
201 Ga0495609_0066661 3300046538 Bacteria 1586
202 Ga0495597_0000044 3300046542 Bacteria 106714
203 Ga0495597_0002203 3300046542 Bacteria 12785
204 Ga0495597_0039832 3300046542 Bacteria 2102
205 Ga0495597_0055221 3300046542 Bacteria 1742
206 Ga0495622_0002843 3300046557 Bacteria 8257
207 Ga0495668_0006669 3300046616 Bacteria 7518
208 Ga0495668_0008445 3300046616 Bacteria 6435
209 Ga0495625_0000011 3300046660 Bacteria 377120
210 Ga0495625_0000721 3300046660 Bacteria 46512
211 Ga0495625_0006967 3300046660 Bacteria 9968
212 Ga0495625_0051928 3300046660 Bacteria 2937
213 Ga0495625_0071887 3300046660 Bacteria 2427
214 Ga0495625_0087520 3300046660 Bacteria 2159
215 Ga0495625_0123718 3300046660 Bacteria 1757
216 Ga0495661_0032883 3300046665 Bacteria 3275
217 Ga0495623_0002136 3300046679 Bacteria 13201
218 Ga0495623_0060478 3300046679 Bacteria 2377
219 Ga0495646_0120999 3300046680 Bacteria 1481
220 Ga0495669_0009548 3300046684 Bacteria 4093
221 Ga0495613_0049695 3300046689 Bacteria 3094
222 Ga0495624_0004212 3300046690 Bacteria 10562
223 Ga0495624_0096249 3300046690 Bacteria 1824
224 Ga0495670_0003503 3300046691 Bacteria 7704
225 Ga0495671_0150716 3300046692 Bacteria 1132
226 Ga0495649_0001137 3300046694 Bacteria 20710
227 Ga0495649_0006512 3300046694 Bacteria 7266
228 Ga0495649_0040049 3300046694 Bacteria 2567
229 Ga0495649_0161362 3300046694 Bacteria 1175
230 Ga0495589_0008013 3300046794 Bacteria 5527
231 Ga0495589_0029133 3300046794 Bacteria 2783
232 Ga0495660_0000505 3300046810 Bacteria 32144
233 Ga0495660_0002223 3300046810 Bacteria 12490
234 Ga0495581_0107127 3300047315 Bacteria 1625
235 Ga0495604_0002993 3300047317 Bacteria 13529
236 Ga0495604_0088986 3300047317 Bacteria 2296
237 Ga0495674_0016323 3300047319 Bacteria 6923
238 Ga0495674_0019690 3300047319 Bacteria 6259
239 Ga0495674_0091187 3300047319 Bacteria 2603
240 Ga0495674_0125167 3300047319 Bacteria 2169
241 Ga0495672_0000032 3300047320 Bacteria 295356
242 Ga0495672_0000665 3300047320 Bacteria 38253
243 Ga0495672_0001928 3300047320 Bacteria 19617
244 Ga0495672_0020891 3300047320 Bacteria 4281
245 Ga0495672_0055234 3300047320 Bacteria 2318
246 Ga0495676_0214931 3300047321 Bacteria 1328
247 Ga0495683_0009624 3300047323 Bacteria 5144
248 Ga0495683_0009897 3300047323 Bacteria 5064
249 Ga0495683_0013242 3300047323 Bacteria 4319
250 Ga0495683_0040851 3300047323 Bacteria 2342
251 Ga0495683_0089878 3300047323 Bacteria 1489
252 Ga0495687_026904 3300047443 Bacteria 2699
253 Ga0495675_0006935 3300047444 Bacteria 6960
254 Ga0495675_0015147 3300047444 Bacteria 4874
255 Ga0495679_000048 3300047446 Bacteria 127785
256 Ga0495685_026278 3300047447 Bacteria 2003
257 Ga0495673_0000056 3300047469 Bacteria 245918
258 Ga0495673_0000990 3300047469 Bacteria 25377
259 Ga0495673_0001625 3300047469 Bacteria 17407
260 Ga0495673_0006011 3300047469 Bacteria 7215
261 Ga0495673_0017964 3300047469 Bacteria 3577
262 Ga0495673_0026312 3300047469 Bacteria 2783
263 Ga0495681_0000037 3300047470 Bacteria 122686
264 Ga0495686_0000119 3300047472 Bacteria 165244
265 Ga0495686_0001011 3300047472 Bacteria 34120
266 Ga0495686_0001667 3300047472 Bacteria 23087
267 Ga0495686_0028432 3300047472 Bacteria 3642
268 Ga0495686_0139185 3300047472 Bacteria 1433
269 Ga0495593_0013707 3300047673 Bacteria 4617
270 Ga0495602_0193064 3300048088 Bacteria 1559
271 Ga0495614_0018147 3300048089 Bacteria 3049
272 Ga0495615_0000043 3300048090 Bacteria 41928
273 Ga0495626_0002741 3300048091 Bacteria 11858
274 Ga0495626_0008781 3300048091 Bacteria 5500
275 Ga0495626_0014410 3300048091 Bacteria 4079
276 Ga0496102_0091763 3300048905 Bacteria 2812
277 Ga0496102_0164854 3300048905 Bacteria 2085
278 Ga0496104_0078515 3300048907 Bacteria 3145
279 Ga0496104_0121070 3300048907 Bacteria 2512
280 Ga0496105_0056936 3300048908 Bacteria 3227
281 Ga0496106_0066925 3300048909 Bacteria 2737
282 Ga0496107_0000858 3300048910 Bacteria 17848
283 Ga0496112_0072511 3300048915 Bacteria 3404
284 Ga0496113_0012824 3300048916 Bacteria 5649
285 Ga0496115_0166660 3300048918 Bacteria 1822
286 Ga0496116_0000149 3300048919 Bacteria 141841
287 Ga0496116_0002419 3300048919 Bacteria 19667
288 Ga0496116_0031724 3300048919 Bacteria 3777
289 Ga0496117_0005292 3300048920 Bacteria 13667
290 Ga0496117_0012649 3300048920 Bacteria 7416
291 Ga0496117_0019307 3300048920 Bacteria 5605
292 Ga0496117_0039978 3300048920 Bacteria 3456
293 Ga0496118_0005278 3300048921 Bacteria 14750
294 Ga0496118_0067520 3300048921 Bacteria 2602
295 Ga0496118_0073360 3300048921 Bacteria 2452
296 Ga0496118_0147099 3300048921 Bacteria 1482
297 Ga0496121_0000152 3300048924 Bacteria 150767
298 Ga0496121_0000625 3300048924 Bacteria 65948
299 Ga0496121_0000929 3300048924 Bacteria 52983
300 Ga0496121_0007918 3300048924 Bacteria 12707
301 Ga0496121_0172153 3300048924 Bacteria 1571
302 Ga0496122_0000080 3300048925 Bacteria 212397
303 Ga0496122_0003138 3300048925 Bacteria 22134
304 Ga0496122_0012284 3300048925 Bacteria 8555
305 Ga0496123_0000072 3300048926 Bacteria 198524
306 Ga0496123_0000650 3300048926 Bacteria 57830
307 Ga0496123_0002495 3300048926 Bacteria 22695
308 Ga0496124_0005279 3300048927 Bacteria 14616
309 Ga0496124_0006138 3300048927 Bacteria 13184
310 Ga0496124_0006233 3300048927 Bacteria 13066
311 Ga0496124_0013965 3300048927 Bacteria 7800
312 Ga0496124_0036184 3300048927 Bacteria 4310
313 Ga0496125_0009683 3300048928 Bacteria 9842
314 Ga0496125_0038722 3300048928 Bacteria 4119
315 Ga0496125_0088273 3300048928 Bacteria 2338
316 Ga0496126_0000261 3300048929 Bacteria 112027
317 Ga0496126_0000511 3300048929 Bacteria 75804
318 Ga0496126_0002285 3300048929 Bacteria 26409
319 Ga0496126_0002516 3300048929 Bacteria 24557
320 Ga0496126_0005876 3300048929 Bacteria 13843
321 Ga0496126_0032405 3300048929 Bacteria 4924
322 Ga0496126_0040556 3300048929 Bacteria 4315
323 Ga0495678_000191 3300049459 Bacteria 71862
324 Ga0495678_011288 3300049459 Bacteria 4285
325 Ga0495678_023386 3300049459 Bacteria 2686
326 Ga0495682_0023630 3300049460 Bacteria 2294
327 Ga0501034_0000128 3300049571 Bacteria 140568
328 Ga0501047_0304413 3300049581 Bacteria 1436
329 Ga0501238_000746 3300049671 Bacteria 3651
330 Ga0501238_010261 3300049671 Bacteria 1250
331 nmdc:mga00v17_2018_c1 3300050491 Bacteria 10467
332 nmdc:mga0k408_45332_c1 3300050493 Bacteria 2537
333 nmdc:mga0k408_95776_c1 3300050493 Bacteria 1747
334 nmdc:mga06z11_41973_c1 3300050494 Bacteria 2292
335 nmdc:mga04h51_72925_c1 3300050495 Bacteria 1203
336 nmdc:mga07m45_11412_c1 3300050496 Bacteria 4667
337 nmdc:mga0sz30_6367_c1 3300050516 Bacteria 4383
338 Ga0500635_0000601 3300053080 Bacteria 9482
339 Ga0500578_0000008 3300053086 Bacteria 223557
340 Ga0500643_000021 3300053087 Bacteria 284326
341 Ga0500643_014668 3300053087 Bacteria 2713
342 Ga0500643_021890 3300053087 Bacteria 2067
343 Ga0500644_0000028 3300053088 Bacteria 92405
344 Ga0500644_0003068 3300053088 Bacteria 4139
345 Ga0500647_0043958 3300053091 Bacteria 2144
346 Ga0500651_0004902 3300053093 Bacteria 7567
347 Ga0500641_0038057 3300053096 Bacteria 1931
348 Ga0500554_001021 3300053102 Bacteria 5448
349 Ga0500555_000125 3300053103 Bacteria 36635
350 Ga0500556_0001064 3300053104 Bacteria 14095
351 Ga0500562_003931 3300053108 Bacteria 3748
352 Ga0500562_004349 3300053108 Bacteria 3586
353 Ga0500569_002051 3300053109 Bacteria 3918
354 Ga0500594_0000270 3300053118 Bacteria 12028
355 Ga0500594_0012617 3300053118 Bacteria 1995
356 Ga0500595_004535 3300053119 Bacteria 6211
357 Ga0500595_011334 3300053119 Bacteria 3495
358 Ga0500608_000008 3300053122 Bacteria 97962
359 Ga0500614_002773 3300053123 Bacteria 3863
360 Ga0500614_023837 3300053123 Bacteria 1441
361 Ga0500618_000024 3300053125 Bacteria 152149
362 Ga0500642_0006451 3300053130 Bacteria 3863
363 Ga0500642_0031348 3300053130 Bacteria 2221
364 Ga0500655_000038 3300053133 Bacteria 37284
365 Ga0500658_0003074 3300053134 Bacteria 6380
366 Ga0500658_0022212 3300053134 Bacteria 2409
367 Ga0500559_0000015 3300053136 Bacteria 158494
368 Ga0500559_0001460 3300053136 Bacteria 13407
369 Ga0500559_0002029 3300053136 Bacteria 10835
370 Ga0500559_0004723 3300053136 Bacteria 6407
371 Ga0500559_0006673 3300053136 Bacteria 5189
372 Ga0500564_000007 3300053138 Bacteria 84097
373 Ga0500573_0021746 3300053140 Bacteria 3680
374 Ga0500588_0002020 3300053146 Bacteria 4028
375 Ga0500590_000463 3300053148 Bacteria 13814
376 Ga0500590_017625 3300053148 Bacteria 3691
377 Ga0500616_0024693 3300053153 Bacteria 3337
378 Ga0500619_024263 3300053154 Bacteria 1782
379 Ga0500622_0000201 3300053156 Bacteria 63318
380 Ga0500622_0002175 3300053156 Bacteria 14529
381 Ga0500622_0009972 3300053156 Bacteria 5239
382 Ga0500622_0041303 3300053156 Bacteria 2401
383 Ga0500624_000098 3300053157 Bacteria 42544
384 Ga0500624_000137 3300053157 Bacteria 31147
385 Ga0500627_0008829 3300053158 Bacteria 3600
386 Ga0500636_0002712 3300053177 Bacteria 9846
387 Ga0500636_0019989 3300053177 Bacteria 3961
388 Ga0500636_0130114 3300053177 Bacteria 1403
389 Ga0500637_0000055 3300053178 Bacteria 42526
390 Ga0500637_0036429 3300053178 Bacteria 2762
391 Ga0500570_000021 3300053724 Bacteria 41025
392 Ga0500645_003955 3300053730 Bacteria 5836
393 Ga0500645_009073 3300053730 Bacteria 3358
394 Ga0500645_042068 3300053730 Bacteria 1349
395 Ga0500596_000025 3300053735 Bacteria 20147

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046516 Ga0495628_0048881 Ga0495628_0048881_888_1841 317
2 3300046529 Ga0495652_0124833 Ga0495652_0124833_12_965 317
3 3300046679 Ga0495623_0060478 Ga0495623_0060478_559_1512 317
4 3300047319 Ga0495674_0125167 Ga0495674_0125167_363_1316 317
5 3300028794 Ga0307515_10029264 Ga0307515_100292643 319
6 3300046457 Ga0495590_0004547 Ga0495590_0004547_4266_5342 319
7 3300046460 Ga0495638_0001445 Ga0495638_0001445_12020_13096 319
8 3300046512 Ga0495610_0001395 Ga0495610_0001395_17341_18417 319
9 3300046616 Ga0495668_0008445 Ga0495668_0008445_3888_4964 319
10 3300047469 Ga0495673_0000990 Ga0495673_0000990_19315_20391 319
11 3300047472 Ga0495686_0001011 Ga0495686_0001011_30335_31411 319
12 3300049459 Ga0495678_000191 Ga0495678_000191_5907_6983 319
13 3300053086 Ga0500578_0000008 Ga0500578_0000008_83155_84231 319
14 3300053088 Ga0500644_0003068 Ga0500644_0003068_1322_2398 319
15 3300053108 Ga0500562_003931 Ga0500562_003931_1591_2667 319
16 3300053118 Ga0500594_0000270 Ga0500594_0000270_5722_6798 319
17 3300053138 Ga0500564_000007 Ga0500564_000007_12156_13232 319
18 3300053156 Ga0500622_0000201 Ga0500622_0000201_14439_15515 319
19 3300053087 Ga0500643_014668 Ga0500643_014668_1291_2367 320
20 3300053088 Ga0500644_0000028 Ga0500644_0000028_11941_13017 320
21 3300053109 Ga0500569_002051 Ga0500569_002051_1988_3070 323
22 3300046524 Ga0495648_0000029 Ga0495648_0000029_96640_97716 324
23 3300048905 Ga0496102_0164854 Ga0496102_0164854_668_1750 325
24 3300048919 Ga0496116_0031724 Ga0496116_0031724_1437_2519 325
25 3300025941 Ga0207711_10000895 Ga0207711_1000089527 326
26 3300048920 Ga0496117_0005292 Ga0496117_0005292_10234_11316 326
27 3300048921 Ga0496118_0005278 Ga0496118_0005278_6596_7678 326
28 3300048924 Ga0496121_0000152 Ga0496121_0000152_37844_38926 326
29 3300037853 Ga0436364_0687087 Ga0436364_0687087_822_1829 334
30 3300046515 Ga0495620_0042472 Ga0495620_0042472_402_1484 335
31 3300046542 Ga0495597_0002203 Ga0495597_0002203_1021_2103 335
32 iso_pu_bacteria 2513237150 2513953551 335
33 iso_pu_bacteria 644736347 644750370 335
34 3300046459 Ga0495629_0010325 Ga0495629_0010325_2600_3682 336
35 3300046522 Ga0495643_0053869 Ga0495643_0053869_551_1633 336
36 3300046557 Ga0495622_0002843 Ga0495622_0002843_633_1715 336
37 3300046690 Ga0495624_0096249 Ga0495624_0096249_81_1163 336
38 3300053093 Ga0500651_0004902 Ga0500651_0004902_5446_6528 336
39 3300053119 Ga0500595_004535 Ga0500595_004535_550_1632 336
40 3300053130 Ga0500642_0031348 Ga0500642_0031348_136_1218 336
41 3300053136 Ga0500559_0001460 Ga0500559_0001460_3679_4761 336
42 3300053154 Ga0500619_024263 Ga0500619_024263_656_1738 336
43 3300053177 Ga0500636_0130114 Ga0500636_0130114_123_1205 336
44 3300053178 Ga0500637_0036429 Ga0500637_0036429_656_1738 336
45 3300053735 Ga0500596_000025 Ga0500596_000025_13459_14541 336
46 3300053096 Ga0500641_0038057 Ga0500641_0038057_840_1901 337
47 iso_pu_bacteria 2513237166 2514052339 337
48 iso_pu_bacteria 2562617112 2563056610 337
49 iso_pu_bacteria 2711768613 2713481382 337
50 iso_pu_bacteria 2738541296 2738821421 337
51 iso_pu_bacteria 2738541298 2738833904 337
52 iso_pu_bacteria 2738541306 2738875107 337
53 iso_pu_bacteria 2738543002 2739187061 337
54 iso_pu_bacteria 2738543008 2739221705 337
55 iso_pu_bacteria 2904483920 2904485993 337
56 iso_pu_bacteria 2919527303 2919527338 337
57 iso_pu_bacteria 641736151 642425305 337
58 iso_pu_bacteria 642555112 642596879 337
59 3300025303 Ga0209051_1020112 Ga0209051_10201122 339
60 3300048905 Ga0496102_0091763 Ga0496102_0091763_1721_2746 339
61 3300048919 Ga0496116_0002419 Ga0496116_0002419_14965_15990 339
62 3300049571 Ga0501034_0000128 Ga0501034_0000128_10718_11743 339
63 3300044693 Ga0466961_0007444 Ga0466961_0007444_5073_6101 340
64 3300053136 Ga0500559_0002029 Ga0500559_0002029_8036_9112 340
65 3300001989 JGI24739J22299_10005888 JGI24739J22299_100058881 341
66 3300002067 JGI24735J21928_10002669 JGI24735J21928_100026693 341
67 3300002075 JGI24738J21930_10003179 JGI24738J21930_100031795 341
68 3300002705 JGI25156J39149_1000462 JGI25156J39149_100046214 341
69 3300003214 JGI25165J46597_1000743 JGI25165J46597_10007436 341
70 3300003756 Ga0055533_1000072 Ga0055533_1000072103 341
71 3300003760 Ga0055527_1000010 Ga0055527_1000010252 341
72 3300003761 Ga0055535_1000010 Ga0055535_1000010116 341
73 3300003762 Ga0055542_1000016 Ga0055542_1000016116 341
74 3300003763 Ga0055529_1000012 Ga0055529_1000012116 341
75 3300003794 Ga0055531_10001617 Ga0055531_100016178 341
76 3300005337 Ga0070682_100117971 Ga0070682_1001179711 341
77 3300005367 Ga0070667_100091165 Ga0070667_1000911652 341
78 3300009093 Ga0105240_10184904 Ga0105240_101849042 341
79 3300009177 Ga0105248_10058074 Ga0105248_100580741 341
80 3300013306 Ga0163162_10007506 Ga0163162_100075062 341
81 3300013308 Ga0157375_10016284 Ga0157375_100162847 341
82 3300025226 Ga0209674_100011 Ga0209674_100011254 341
83 3300025228 Ga0209672_100002 Ga0209672_100002246 341
84 3300025229 Ga0209147_100003 Ga0209147_100003246 341
85 3300025230 Ga0209563_100511 Ga0209563_10051112 341
86 3300025231 Ga0207427_100818 Ga0207427_1008182 341
87 3300025242 Ga0209258_100042 Ga0209258_100042114 341
88 3300025254 Ga0209148_1000006 Ga0209148_1000006246 341
89 3300025256 Ga0209759_1000051 Ga0209759_100005169 341
90 3300025261 Ga0209233_1000033 Ga0209233_1000033298 341
91 3300025272 Ga0209455_1000003 Ga0209455_1000003246 341
92 3300025295 Ga0209564_1002405 Ga0209564_10024052 341
93 3300025304 Ga0209257_1000373 Ga0209257_100037344 341
94 3300025903 Ga0207680_10013810 Ga0207680_100138104 341
95 3300025904 Ga0207647_10036647 Ga0207647_100366472 341
96 3300025941 Ga0207711_10276907 Ga0207711_102769071 341
97 3300025986 Ga0207658_10023300 Ga0207658_100233001 341
98 3300026067 Ga0207678_10242641 Ga0207678_102426411 341
99 3300026121 Ga0207683_10101053 Ga0207683_101010532 341
100 3300031911 Ga0307412_10000003 Ga0307412_10000003400 341
101 3300046455 Ga0495603_0000860 Ga0495603_0000860_13072_14103 341
102 3300046457 Ga0495590_0003165 Ga0495590_0003165_5588_6619 341
103 3300046457 Ga0495590_0003378 Ga0495590_0003378_1269_2300 341
104 3300046459 Ga0495629_0000130 Ga0495629_0000130_25856_26887 341
105 3300046460 Ga0495638_0007792 Ga0495638_0007792_3234_4265 341
106 3300046460 Ga0495638_0023878 Ga0495638_0023878_556_1587 341
107 3300046462 Ga0495651_0026504 Ga0495651_0026504_2956_3987 341
108 3300046463 Ga0495653_0000287 Ga0495653_0000287_2682_3713 341
109 3300046471 Ga0495650_0004957 Ga0495650_0004957_7224_8255 341
110 3300046471 Ga0495650_0017389 Ga0495650_0017389_1848_2879 341
111 3300046471 Ga0495650_0030791 Ga0495650_0030791_816_1847 341
112 3300046472 Ga0495580_0001717 Ga0495580_0001717_12033_13064 341
113 3300046472 Ga0495580_0022178 Ga0495580_0022178_516_1547 341
114 3300046474 Ga0495605_0009231 Ga0495605_0009231_2416_3447 341
115 3300046474 Ga0495605_0011049 Ga0495605_0011049_417_1448 341
116 3300046474 Ga0495605_0011829 Ga0495605_0011829_2691_3722 341
117 3300046474 Ga0495605_0099692 Ga0495605_0099692_213_1244 341
118 3300046491 Ga0495584_0069176 Ga0495584_0069176_185_1216 341
119 3300046492 Ga0495585_0003904 Ga0495585_0003904_7349_8380 341
120 3300046500 Ga0495596_0000886 Ga0495596_0000886_546_1577 341
121 3300046501 Ga0495607_0018271 Ga0495607_0018271_1675_2706 341
122 3300046506 Ga0495583_0003872 Ga0495583_0003872_9309_10340 341
123 3300046506 Ga0495583_0018978 Ga0495583_0018978_2416_3447 341
124 3300046507 Ga0495606_0004419 Ga0495606_0004419_1502_2533 341
125 3300046507 Ga0495606_0012628 Ga0495606_0012628_5568_6599 341
126 3300046507 Ga0495606_0085555 Ga0495606_0085555_550_1581 341
127 3300046512 Ga0495610_0000426 Ga0495610_0000426_1452_2483 341
128 3300046513 Ga0495616_0021213 Ga0495616_0021213_196_1227 341
129 3300046515 Ga0495620_0005689 Ga0495620_0005689_4746_5777 341
130 3300046516 Ga0495628_0006685 Ga0495628_0006685_6166_7197 341
131 3300046516 Ga0495628_0020455 Ga0495628_0020455_2971_4002 341
132 3300046517 Ga0495630_0008763 Ga0495630_0008763_2531_3562 341
133 3300046518 Ga0495631_0082820 Ga0495631_0082820_257_1288 341
134 3300046524 Ga0495648_0081601 Ga0495648_0081601_498_1529 341
135 3300046526 Ga0495666_0024470 Ga0495666_0024470_685_1716 341
136 3300046528 Ga0495642_0006094 Ga0495642_0006094_2985_4016 341
137 3300046528 Ga0495642_0020693 Ga0495642_0020693_395_1426 341
138 3300046528 Ga0495642_0020815 Ga0495642_0020815_549_1580 341
139 3300046528 Ga0495642_0039312 Ga0495642_0039312_387_1418 341
140 3300046542 Ga0495597_0039832 Ga0495597_0039832_201_1232 341
141 3300046660 Ga0495625_0051928 Ga0495625_0051928_818_1849 341
142 3300046665 Ga0495661_0032883 Ga0495661_0032883_1389_2420 341
143 3300046680 Ga0495646_0120999 Ga0495646_0120999_41_1072 341
144 3300046684 Ga0495669_0009548 Ga0495669_0009548_1437_2468 341
145 3300046689 Ga0495613_0049695 Ga0495613_0049695_816_1847 341
146 3300046690 Ga0495624_0004212 Ga0495624_0004212_5120_6151 341
147 3300046691 Ga0495670_0003503 Ga0495670_0003503_6412_7443 341
148 3300046692 Ga0495671_0150716 Ga0495671_0150716_12_1043 341
149 3300046694 Ga0495649_0006512 Ga0495649_0006512_318_1349 341
150 3300046694 Ga0495649_0040049 Ga0495649_0040049_17_1048 341
151 3300046694 Ga0495649_0161362 Ga0495649_0161362_22_1053 341
152 3300046794 Ga0495589_0008013 Ga0495589_0008013_568_1599 341
153 3300046794 Ga0495589_0029133 Ga0495589_0029133_605_1636 341
154 3300047317 Ga0495604_0088986 Ga0495604_0088986_575_1606 341
155 3300047319 Ga0495674_0016323 Ga0495674_0016323_5538_6569 341
156 3300047319 Ga0495674_0019690 Ga0495674_0019690_123_1154 341
157 3300047319 Ga0495674_0091187 Ga0495674_0091187_967_1998 341
158 3300047320 Ga0495672_0001928 Ga0495672_0001928_181_1212 341
159 3300047320 Ga0495672_0055234 Ga0495672_0055234_918_1949 341
160 3300047321 Ga0495676_0214931 Ga0495676_0214931_58_1089 341
161 3300047323 Ga0495683_0009897 Ga0495683_0009897_3574_4605 341
162 3300047323 Ga0495683_0013242 Ga0495683_0013242_2853_3884 341
163 3300047323 Ga0495683_0089878 Ga0495683_0089878_49_1080 341
164 3300047443 Ga0495687_026904 Ga0495687_026904_486_1517 341
165 3300047444 Ga0495675_0006935 Ga0495675_0006935_4820_5851 341
166 3300047446 Ga0495679_000048 Ga0495679_000048_31301_32332 341
167 3300047447 Ga0495685_026278 Ga0495685_026278_64_1095 341
168 3300047469 Ga0495673_0017964 Ga0495673_0017964_1120_2151 341
169 3300047469 Ga0495673_0026312 Ga0495673_0026312_389_1420 341
170 3300047673 Ga0495593_0013707 Ga0495593_0013707_1520_2551 341
171 3300048088 Ga0495602_0193064 Ga0495602_0193064_14_1045 341
172 3300048089 Ga0495614_0018147 Ga0495614_0018147_1103_2134 341
173 3300048091 Ga0495626_0008781 Ga0495626_0008781_4234_5265 341
174 3300048091 Ga0495626_0014410 Ga0495626_0014410_2235_3266 341
175 3300048907 Ga0496104_0078515 Ga0496104_0078515_239_1270 341
176 3300048907 Ga0496104_0121070 Ga0496104_0121070_61_1092 341
177 3300048908 Ga0496105_0056936 Ga0496105_0056936_122_1153 341
178 3300048909 Ga0496106_0066925 Ga0496106_0066925_1590_2621 341
179 3300048915 Ga0496112_0072511 Ga0496112_0072511_923_1954 341
180 3300048916 Ga0496113_0012824 Ga0496113_0012824_3530_4561 341
181 3300048918 Ga0496115_0166660 Ga0496115_0166660_192_1223 341
182 3300048920 Ga0496117_0012649 Ga0496117_0012649_1884_2915 341
183 3300048920 Ga0496117_0019307 Ga0496117_0019307_4372_5403 341
184 3300048921 Ga0496118_0067520 Ga0496118_0067520_1069_2100 341
185 3300048921 Ga0496118_0147099 Ga0496118_0147099_417_1448 341
186 3300048924 Ga0496121_0000929 Ga0496121_0000929_28337_29368 341
187 3300048924 Ga0496121_0172153 Ga0496121_0172153_115_1146 341
188 3300048929 Ga0496126_0000511 Ga0496126_0000511_69064_70095 341
189 3300048929 Ga0496126_0002285 Ga0496126_0002285_18638_19669 341
190 3300048929 Ga0496126_0002516 Ga0496126_0002516_23414_24445 341
191 3300048929 Ga0496126_0040556 Ga0496126_0040556_15_1046 341
192 3300049459 Ga0495678_011288 Ga0495678_011288_2584_3615 341
193 3300049459 Ga0495678_023386 Ga0495678_023386_1426_2457 341
194 3300046474 Ga0495605_0000871 Ga0495605_0000871_19258_20289 342
195 3300046501 Ga0495607_0000335 Ga0495607_0000335_22858_23889 342
196 3300046520 Ga0495637_0006746 Ga0495637_0006746_4362_5393 342
197 3300046542 Ga0495597_0000044 Ga0495597_0000044_25777_26808 342
198 3300046810 Ga0495660_0000505 Ga0495660_0000505_23074_24105 342
199 3300047320 Ga0495672_0020891 Ga0495672_0020891_2731_3762 342
200 3300053108 Ga0500562_004349 Ga0500562_004349_2392_3423 342
201 3300046507 Ga0495606_0010219 Ga0495606_0010219_5938_6975 345
202 3300046522 Ga0495643_0019197 Ga0495643_0019197_1386_2423 345
203 3300045836 Ga0466958_0033216 Ga0466958_0033216_444_1511 346
204 3300049460 Ga0495682_0023630 Ga0495682_0023630_1219_2265 348
205 3300053148 Ga0500590_017625 Ga0500590_017625_361_1452 348
206 3300045049 Ga0466959_0081025 Ga0466959_0081025_34_1089 351
207 iso_pu_bacteria 2849560528 2849564184 353
208 iso_pu_bacteria 2849573788 2849575524 353
209 iso_pu_bacteria 2851153111 2851155313 353
210 iso_pu_bacteria 2898329390 2898334111 353
211 iso_pu_bacteria 2510917020 2511124419 354
212 iso_pu_bacteria 2582581279 2585148585 354
213 iso_pu_bacteria 2582581280 2585153583 354
214 iso_pu_bacteria 2582581293 2585197387 354
215 iso_pu_bacteria 2585428106 2587916515 354
216 iso_pu_bacteria 2643221552 2643780195 354
217 iso_pu_bacteria 2643221583 2643926081 354
218 iso_pu_bacteria 2643221584 2643928607 354
219 iso_pu_bacteria 2818991435 2819536708 354
220 iso_pu_bacteria 2818991454 2819645869 354
221 iso_pu_bacteria 2884960567 2884963342 354
222 iso_pu_bacteria 2904434214 2904435880 354
223 iso_pu_bacteria 2508501125 2509132448 355
224 iso_pu_bacteria 2791355048 2792460336 355
225 iso_pu_bacteria 2843744320 2843745023 355
226 iso_pu_bacteria 2928503688 2928510112 355
227 iso_pu_bacteria 2945934425 2945936466 355
228 3300005548 Ga0070665_100001383 Ga0070665_10000138326 356
229 3300005548 Ga0070665_100063803 Ga0070665_1000638033 356
230 3300028379 Ga0268266_10004564 Ga0268266_100045644 356
231 3300037418 Ga0395900_0132220 Ga0395900_0132220_743_1816 356
232 3300046458 Ga0495591_000037 Ga0495591_000037_134616_135689 356
233 3300053119 Ga0500595_011334 Ga0500595_011334_1482_2711 356
234 3300005842 Ga0068858_100202773 Ga0068858_1002027731 357
235 3300028573 Ga0265334_10041297 Ga0265334_100412972 357
236 3300053091 Ga0500647_0043958 Ga0500647_0043958_1016_2104 357
237 3300053146 Ga0500588_0002020 Ga0500588_0002020_2614_3690 357
238 3300053156 Ga0500622_0002175 Ga0500622_0002175_11125_12198 357
239 iso_pu_bacteria 2842733646 2842738536 357
240 3300003773 Ga0055537_1005565 Ga0055537_10055654 358
241 3300003790 Ga0055528_1012470 Ga0055528_10124702 358
242 3300003794 Ga0055531_10001500 Ga0055531_1000150013 358
243 3300005262 Ga0065165_1000388 Ga0065165_100038861 358
244 3300005353 Ga0070669_100003645 Ga0070669_1000036458 358
245 3300006186 Ga0075369_10004735 Ga0075369_100047355 358
246 3300006195 Ga0075366_10091818 Ga0075366_100918182 358
247 3300006353 Ga0075370_10080838 Ga0075370_100808382 358
248 3300014497 Ga0182008_10000057 Ga0182008_1000005794 358
249 3300025261 Ga0209233_1000322 Ga0209233_100032211 358
250 3300025263 Ga0209565_1000466 Ga0209565_100046610 358
251 3300025273 Ga0209673_1020914 Ga0209673_10209143 358
252 3300025291 Ga0209675_1007194 Ga0209675_10071942 358
253 3300025292 Ga0209676_1000393 Ga0209676_100039355 358
254 3300025297 Ga0209758_1003486 Ga0209758_100348612 358
255 3300025297 Ga0209758_1005270 Ga0209758_10052709 358
256 3300025298 Ga0209050_1000401 Ga0209050_100040155 358
257 3300025299 Ga0209256_1000666 Ga0209256_100066633 358
258 3300025299 Ga0209256_1012151 Ga0209256_10121513 358
259 3300025304 Ga0209257_1000438 Ga0209257_100043855 358
260 3300025923 Ga0207681_10004711 Ga0207681_100047115 358
261 3300031247 Ga0265340_10118638 Ga0265340_101186381 358
262 3300042436 Ga0439435_0004737 Ga0439435_0004737_520_1596 358
263 3300046453 Ga0495627_000185 Ga0495627_000185_62377_63453 358
264 3300046460 Ga0495638_0000055 Ga0495638_0000055_27752_28828 358
265 3300046460 Ga0495638_0001598 Ga0495638_0001598_18878_19954 358
266 3300046460 Ga0495638_0001768 Ga0495638_0001768_4124_5200 358
267 3300046460 Ga0495638_0044840 Ga0495638_0044840_156_1232 358
268 3300046471 Ga0495650_0000017 Ga0495650_0000017_486915_487991 358
269 3300046506 Ga0495583_0000029 Ga0495583_0000029_110718_111794 358
270 3300046507 Ga0495606_0004595 Ga0495606_0004595_8576_9652 358
271 3300046512 Ga0495610_0000176 Ga0495610_0000176_56273_57349 358
272 3300046513 Ga0495616_0000464 Ga0495616_0000464_28367_29443 358
273 3300046519 Ga0495632_0002061 Ga0495632_0002061_12634_13710 358
274 3300046530 Ga0495654_0000012 Ga0495654_0000012_45484_46560 358
275 3300046616 Ga0495668_0006669 Ga0495668_0006669_3332_4408 358
276 3300046660 Ga0495625_0000011 Ga0495625_0000011_341357_342433 358
277 3300046660 Ga0495625_0000721 Ga0495625_0000721_38646_39722 358
278 3300046660 Ga0495625_0123718 Ga0495625_0123718_106_1182 358
279 3300046810 Ga0495660_0002223 Ga0495660_0002223_3225_4301 358
280 3300047320 Ga0495672_0000665 Ga0495672_0000665_6663_7739 358
281 3300047323 Ga0495683_0040851 Ga0495683_0040851_791_1867 358
282 3300047469 Ga0495673_0000056 Ga0495673_0000056_177868_178944 358
283 3300047469 Ga0495673_0001625 Ga0495673_0001625_12727_13803 358
284 3300047472 Ga0495686_0001667 Ga0495686_0001667_9586_10662 358
285 3300047472 Ga0495686_0028432 Ga0495686_0028432_1557_2633 358
286 3300048910 Ga0496107_0000858 Ga0496107_0000858_3005_4081 358
287 3300048924 Ga0496121_0000625 Ga0496121_0000625_33359_34435 358
288 3300048925 Ga0496122_0000080 Ga0496122_0000080_62717_63793 358
289 3300048926 Ga0496123_0000072 Ga0496123_0000072_148593_149669 358
290 3300048927 Ga0496124_0006138 Ga0496124_0006138_1171_2247 358
291 3300048927 Ga0496124_0036184 Ga0496124_0036184_3023_4099 358
292 3300048928 Ga0496125_0038722 Ga0496125_0038722_2926_4002 358
293 3300048929 Ga0496126_0005876 Ga0496126_0005876_7792_8874 358
294 3300048929 Ga0496126_0032405 Ga0496126_0032405_320_1396 358
295 3300049581 Ga0501047_0304413 Ga0501047_0304413_75_1157 358
296 3300049671 Ga0501238_000746 Ga0501238_000746_2043_3119 358
297 3300049671 Ga0501238_010261 Ga0501238_010261_71_1147 358
298 3300050493 nmdc:mga0k408_45332_c1 nmdc:mga0k408_45332_c1_1198_2274 358
299 3300050516 nmdc:mga0sz30_6367_c1 nmdc:mga0sz30_6367_c1_2738_3814 358
300 3300053102 Ga0500554_001021 Ga0500554_001021_684_1760 358
301 3300053104 Ga0500556_0001064 Ga0500556_0001064_11546_12622 358
302 3300053122 Ga0500608_000008 Ga0500608_000008_66133_67209 358
303 3300053123 Ga0500614_002773 Ga0500614_002773_82_1158 358
304 3300053125 Ga0500618_000024 Ga0500618_000024_47793_48869 358
305 3300053134 Ga0500658_0022212 Ga0500658_0022212_288_1364 358
306 3300053136 Ga0500559_0000015 Ga0500559_0000015_3220_4296 358
307 3300053136 Ga0500559_0004723 Ga0500559_0004723_1065_2141 358
308 3300053140 Ga0500573_0021746 Ga0500573_0021746_2389_3465 358
309 3300053153 Ga0500616_0024693 Ga0500616_0024693_349_1425 358
310 3300053156 Ga0500622_0041303 Ga0500622_0041303_557_1633 358
311 3300053158 Ga0500627_0008829 Ga0500627_0008829_1780_2856 358
312 3300053730 Ga0500645_003955 Ga0500645_003955_69_1145 358
313 3300007788 Ga0099795_10033041 Ga0099795_100330412 359
314 3300009551 Ga0105238_10036968 Ga0105238_100369685 359
315 3300025924 Ga0207694_10077531 Ga0207694_100775312 359
316 3300025981 Ga0207640_10117822 Ga0207640_101178222 359
317 3300046524 Ga0495648_0000892 Ga0495648_0000892_17705_18787 359
318 3300046679 Ga0495623_0002136 Ga0495623_0002136_8306_9460 359
319 3300047317 Ga0495604_0002993 Ga0495604_0002993_4034_5188 359
320 3300047444 Ga0495675_0015147 Ga0495675_0015147_139_1293 359
321 3300047472 Ga0495686_0139185 Ga0495686_0139185_200_1282 359
322 iso_pu_bacteria 2510917021 2511127070 359
323 iso_pu_bacteria 2599185354 2600201100 359
324 iso_pu_bacteria 2738541275 2738709556 359
325 iso_pu_bacteria 2738541301 2738847981 359
326 iso_pu_bacteria 2738541304 2738863710 359
327 iso_pu_bacteria 2738543022 2739296228 359
328 iso_pu_bacteria 2738543033 2739357906 359
329 iso_pu_bacteria 2885270888 2885270901 359
330 iso_pu_bacteria 2928100450 2928101111 359
331 iso_pu_bacteria 2928959182 2928960479 359
332 iso_pu_bacteria 2990703756 2990709628 359
333 iso_pu_bacteria 3000865235 3000865845 359
334 3300005618 Ga0068864_100000257 Ga0068864_10000025711 360
335 3300005841 Ga0068863_100000167 Ga0068863_10000016738 360
336 3300005842 Ga0068858_100000198 Ga0068858_10000019828 360
337 3300006042 Ga0075368_10009749 Ga0075368_100097491 360
338 3300006048 Ga0075363_100013025 Ga0075363_1000130254 360
339 3300006051 Ga0075364_10002414 Ga0075364_100024144 360
340 3300006178 Ga0075367_10020023 Ga0075367_100200234 360
341 3300006195 Ga0075366_10017756 Ga0075366_100177563 360
342 3300006353 Ga0075370_10009372 Ga0075370_100093722 360
343 3300009092 Ga0105250_10010246 Ga0105250_100102462 360
344 3300009101 Ga0105247_10124876 Ga0105247_101248762 360
345 3300009177 Ga0105248_10072307 Ga0105248_100723073 360
346 3300021361 Ga0213872_10027062 Ga0213872_100270621 360
347 3300025711 Ga0207696_1017327 Ga0207696_10173272 360
348 3300025941 Ga0207711_10042436 Ga0207711_100424363 360
349 3300026035 Ga0207703_10000189 Ga0207703_1000018935 360
350 3300026088 Ga0207641_10000120 Ga0207641_1000012067 360
351 3300026095 Ga0207676_10000424 Ga0207676_1000042435 360
352 3300028800 Ga0265338_10091239 Ga0265338_100912392 360
353 3300031251 Ga0265327_10000110 Ga0265327_10000110137 360
354 3300039447 Ga0436361_0414754 Ga0436361_0414754_352_1434 360
355 3300046471 Ga0495650_0000001 Ga0495650_0000001_3308_4390 360
356 3300047315 Ga0495581_0107127 Ga0495581_0107127_105_1187 360
357 3300047320 Ga0495672_0000032 Ga0495672_0000032_89650_90732 360
358 3300047323 Ga0495683_0009624 Ga0495683_0009624_2419_3501 360
359 3300050491 nmdc:mga00v17_2018_c1 nmdc:mga00v17_2018_c1_7239_8321 360
360 3300050493 nmdc:mga0k408_95776_c1 nmdc:mga0k408_95776_c1_331_1413 360
361 3300050494 nmdc:mga06z11_41973_c1 nmdc:mga06z11_41973_c1_486_1568 360
362 3300050495 nmdc:mga04h51_72925_c1 nmdc:mga04h51_72925_c1_57_1139 360
363 3300050496 nmdc:mga07m45_11412_c1 nmdc:mga07m45_11412_c1_2163_3245 360
364 3300053730 Ga0500645_042068 Ga0500645_042068_19_1104 360
365 iso_pu_bacteria 2818991438 2819550992 360
366 3300014968 Ga0157379_10009689 Ga0157379_100096892 362
367 3300028786 Ga0307517_10000160 Ga0307517_1000016074 362
368 3300030522 Ga0307512_10049641 Ga0307512_100496413 362
369 3300031507 Ga0307509_10001242 Ga0307509_1000124210 362
370 3300031616 Ga0307508_10000856 Ga0307508_100008565 362
371 3300031730 Ga0307516_10084789 Ga0307516_100847891 362
372 3300033179 Ga0307507_10005999 Ga0307507_100059994 362
373 3300033180 Ga0307510_10008528 Ga0307510_100085287 362
374 3300046457 Ga0495590_0013534 Ga0495590_0013534_191_1306 362
375 3300046506 Ga0495583_0000055 Ga0495583_0000055_176939_178027 362
376 3300046519 Ga0495632_0018821 Ga0495632_0018821_2514_3629 362
377 3300046524 Ga0495648_0027907 Ga0495648_0027907_2112_3200 362
378 3300046660 Ga0495625_0087520 Ga0495625_0087520_176_1291 362
379 3300046694 Ga0495649_0001137 Ga0495649_0001137_9330_10445 362
380 3300047469 Ga0495673_0006011 Ga0495673_0006011_1542_2630 362
381 3300053103 Ga0500555_000125 Ga0500555_000125_29234_30322 362
382 3300053118 Ga0500594_0012617 Ga0500594_0012617_113_1201 362
383 3300053134 Ga0500658_0003074 Ga0500658_0003074_2995_4110 362
384 3300053177 Ga0500636_0019989 Ga0500636_0019989_2781_3869 362
385 3300027907 Ga0207428_10174785 Ga0207428_101747852 363
386 3300032004 Ga0307414_10006745 Ga0307414_100067452 363
387 3300046453 Ga0495627_000148 Ga0495627_000148_28220_29311 363
388 3300046460 Ga0495638_0022652 Ga0495638_0022652_2330_3421 363
389 3300046471 Ga0495650_0001117 Ga0495650_0001117_29_1120 363
390 3300046500 Ga0495596_0000071 Ga0495596_0000071_180_1286 363
391 3300046512 Ga0495610_0000034 Ga0495610_0000034_161720_162811 363
392 3300046512 Ga0495610_0000239 Ga0495610_0000239_45429_46520 363
393 3300046515 Ga0495620_0015529 Ga0495620_0015529_2553_3644 363
394 3300046518 Ga0495631_0028855 Ga0495631_0028855_20_1111 363
395 3300046519 Ga0495632_0000869 Ga0495632_0000869_16504_17595 363
396 3300046520 Ga0495637_0009436 Ga0495637_0009436_587_1678 363
397 3300046522 Ga0495643_0000039 Ga0495643_0000039_175116_176216 363
398 3300046522 Ga0495643_0002715 Ga0495643_0002715_10787_11878 363
399 3300046522 Ga0495643_0085174 Ga0495643_0085174_131_1222 363
400 3300046524 Ga0495648_0004028 Ga0495648_0004028_11581_12672 363
401 3300046538 Ga0495609_0066661 Ga0495609_0066661_429_1520 363
402 3300046542 Ga0495597_0055221 Ga0495597_0055221_234_1325 363
403 3300046660 Ga0495625_0006967 Ga0495625_0006967_465_1571 363
404 3300046660 Ga0495625_0071887 Ga0495625_0071887_166_1257 363
405 3300047470 Ga0495681_0000037 Ga0495681_0000037_110005_111096 363
406 3300047472 Ga0495686_0000119 Ga0495686_0000119_112334_113425 363
407 3300048090 Ga0495615_0000043 Ga0495615_0000043_18053_19144 363
408 3300048925 Ga0496122_0012284 Ga0496122_0012284_5499_6590 363
409 3300048926 Ga0496123_0000650 Ga0496123_0000650_34266_35357 363
410 3300048927 Ga0496124_0006233 Ga0496124_0006233_9210_10301 363
411 3300048928 Ga0496125_0088273 Ga0496125_0088273_854_1945 363
412 3300053080 Ga0500635_0000601 Ga0500635_0000601_168_1268 363
413 3300053087 Ga0500643_000021 Ga0500643_000021_206485_207576 363
414 3300053123 Ga0500614_023837 Ga0500614_023837_282_1373 363
415 3300053130 Ga0500642_0006451 Ga0500642_0006451_1072_2163 363
416 3300053133 Ga0500655_000038 Ga0500655_000038_29017_30108 363
417 3300053136 Ga0500559_0006673 Ga0500559_0006673_3660_4760 363
418 3300053148 Ga0500590_000463 Ga0500590_000463_9340_10431 363
419 3300053156 Ga0500622_0009972 Ga0500622_0009972_3488_4579 363
420 3300053157 Ga0500624_000098 Ga0500624_000098_19513_20604 363
421 3300053178 Ga0500637_0000055 Ga0500637_0000055_19513_20604 363
422 3300053724 Ga0500570_000021 Ga0500570_000021_15194_16285 363
423 iso_pu_bacteria 8054302542 8054304495 363
424 2162886007 SwRhRL2b_contig_3178000 SwRhRL2b_0745.00000570 364
425 3300005289 Ga0065704_10000204 Ga0065704_1000020467 364
426 3300025298 Ga0209050_1000784 Ga0209050_100078438 364
427 3300046500 Ga0495596_0000908 Ga0495596_0000908_7668_8765 364
428 3300046507 Ga0495606_0027470 Ga0495606_0027470_909_2006 364
429 3300046512 Ga0495610_0022536 Ga0495610_0022536_820_1917 364
430 3300046522 Ga0495643_0048662 Ga0495643_0048662_716_1813 364
431 3300048091 Ga0495626_0002741 Ga0495626_0002741_2915_4012 364
432 3300048919 Ga0496116_0000149 Ga0496116_0000149_127657_128754 364
433 3300048920 Ga0496117_0039978 Ga0496117_0039978_1463_2560 364
434 3300048921 Ga0496118_0073360 Ga0496118_0073360_445_1542 364
435 3300048924 Ga0496121_0007918 Ga0496121_0007918_4604_5701 364
436 3300048925 Ga0496122_0003138 Ga0496122_0003138_12917_14014 364
437 3300048926 Ga0496123_0002495 Ga0496123_0002495_15643_16740 364
438 3300048927 Ga0496124_0005279 Ga0496124_0005279_12164_13261 364
439 3300048927 Ga0496124_0013965 Ga0496124_0013965_220_1317 364
440 3300048928 Ga0496125_0009683 Ga0496125_0009683_4228_5325 364
441 3300048929 Ga0496126_0000261 Ga0496126_0000261_12820_13917 364
442 3300053087 Ga0500643_021890 Ga0500643_021890_68_1162 364
443 3300053157 Ga0500624_000137 Ga0500624_000137_11743_12837 364
444 3300053177 Ga0500636_0002712 Ga0500636_0002712_1120_2214 364
445 3300053730 Ga0500645_009073 Ga0500645_009073_1930_3024 364

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03069

FmdA_AmdA

Acetamidase/Formamidase family

224

377

0.88

PF03069

FmdA_AmdA

Acetamidase/Formamidase family

46

226

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f4l-assembly1.cif.gz_A crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9139 21 355
2f4l-assembly1.cif.gz_B crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9125 20 355
2f4l-assembly2.cif.gz_D crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9106 21 355
2f4l-assembly1.cif.gz_A crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9076 21 355
2f4l-assembly2.cif.gz_D crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9075 21 355
ID Description Score Start End Superfamily
2f4lB01 Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains 0.9154 21 274 2.60.120.580
2f4lB01 Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains 0.9033 21 274 2.60.120.580
af_Q2FUZ8_472_626_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.856 296 329 3.40.50.80
af_A4IDQ0_1283_1476_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.8453 296 329 3.40.50.80
2f4lD03 Alpha Beta;Roll;Endonuclease I-creI;Acetamidase/Formamidase-like domains 0.8399 274 355 3.10.28.20
ID Description Score Start End GO Terms
AF-A0A3M6Q2I3-F1-model_v4 deleted 0.9817 12 357
AF-A0A259P8W8-F1-model_v4 Formamidase 0.9796 20 273 GO:0016811
AF-A0A519F4L9-F1-model_v4 Formamidase 0.9772 20 358 GO:0016811
AF-A0A2T2X964-F1-model_v4 Formamidase 0.9745 20 355 GO:0016811
AF-A0A5E4WXM7-F1-model_v4 Formamidase 0.9731 20 359 GO:0016811

Feature Viewer

pLDDT pTM Quality
89.15 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map