F445511

General Info

Members Datasets Scaffolds Average Seq Length
445 204 436 426

Family's Representative Sequence

Representative Sequence 3300025315|Ga0207697_10013778|Ga0207697_100137782
Length 512
Sequence MKAAAIAGMVLTVFVPGFGQESPDLLFHTQTPLDISIHLSIKQIKKSNGDSSWISDKLYYHNITGQNDSIKVDLKSRGHFRLNDCYYPPLWIKIDKEAAKGTVFDGNKKLKLVLPCYNHKGHDALVSKEYLCYKLCEMITPYAFRTRLVNVDLTEQREKQNRNFKLKGILIEDLDKDDQAAVLAEMIESALAYPEESAGRLMSRELIAVPEHMSVGDLIDYLRENADLASEFWEVFIVDAHHRPLGTCKLSWILRTPRSVALTDVMKRDQTLIPVAMDQEEVALRFQKYALISAAVVDESGRLVGQITVDDIVHIIQEEAGEDVLLLSGAGDGDINEPIQLTIRTRLWWLVVNLGTAILAAAVVGGFEAEISKLAVLAVLMGIISGMGGNAGTQTLAVVVRALATNQLTSSNTVRMVRRELVIALANGVVLALITGGGTILIYGNVPLGLVMGAAMIINNIVAGLSGILVPIGLEKARIDPAVSSAVFVTMATDVMGFFSFLGLASLAGAIK

Samples

Sample ID Description Type Environment
1 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
2 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
3 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
4 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
5 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
6 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
7 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
8 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
9 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
154 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
155 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
156 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
164 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
191 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
192 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
195 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
196 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
197 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
198 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
199 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
203 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 0
Isolates 2.02

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 4.94
Nodule 0
Rhizoplane 3.15
Rhizosphere 85.84
Stem 0
Stem Tuber 0
Unclassified 5.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1000008 3300001976 Bacteria 23142
2 JGI24752J21851_1000844 3300001976 Bacteria 4158
3 JGI24740J21852_10002881 3300001979 Bacteria 7689
4 JGI24739J22299_10008009 3300001989 Bacteria 3952
5 JGI24739J22299_10017365 3300001989 Bacteria 2596
6 JGI24739J22299_10029993 3300001989 Bacteria 1887
7 JGI24737J22298_10025732 3300001990 Bacteria 1860
8 JGI24735J21928_10001909 3300002067 Bacteria 7307
9 JGI24735J21928_10003064 3300002067 Bacteria 5731
10 JGI24735J21928_10017389 3300002067 Bacteria 2225
11 JGI24735J21928_10022942 3300002067 Bacteria 1895
12 JGI24748J21848_1000140 3300002074 Bacteria 12239
13 JGI24738J21930_10009804 3300002075 Bacteria 2148
14 JGI24749J21850_1000160 3300002076 Bacteria 10786
15 JGI24744J21845_10002029 3300002077 Bacteria 4102
16 JGI24034J26672_10000024 3300002239 Bacteria 114754
17 JGI24751J29686_10000377 3300002459 Bacteria 15086
18 Ga0065704_10073574 3300005289 Bacteria 7001
19 Ga0065707_10098385 3300005295 Bacteria 3090
20 Ga0070658_10000107 3300005327 Bacteria 73895
21 Ga0070658_10015486 3300005327 Bacteria 6100
22 Ga0070658_10031166 3300005327 Bacteria 4281
23 Ga0070676_10000889 3300005328 Bacteria 14761
24 Ga0070676_10060943 3300005328 Bacteria 2242
25 Ga0070683_100001635 3300005329 Bacteria 17347
26 Ga0070683_100006411 3300005329 Bacteria 9866
27 Ga0070690_100000016 3300005330 Bacteria 85515
28 Ga0070670_100000006 3300005331 Bacteria 319420
29 Ga0070670_100000215 3300005331 Bacteria 53387
30 Ga0070670_100024378 3300005331 Bacteria 5202
31 Ga0070670_100060931 3300005331 Bacteria 3240
32 Ga0068869_100000428 3300005334 Bacteria 22992
33 Ga0070666_10000011 3300005335 Bacteria 261736
34 Ga0070666_10001184 3300005335 Bacteria 15784
35 Ga0070666_10002894 3300005335 Bacteria 10363
36 Ga0070666_10022520 3300005335 Bacteria 4091
37 Ga0070666_10047574 3300005335 Bacteria 2880
38 Ga0070680_100008676 3300005336 Bacteria 7792
39 Ga0068868_100000387 3300005338 Bacteria 29954
40 Ga0070660_100000861 3300005339 Bacteria 20243
41 Ga0070660_100003311 3300005339 Bacteria 11072
42 Ga0070660_100011318 3300005339 Bacteria 6332
43 Ga0070689_100090408 3300005340 Bacteria 2412
44 Ga0070661_100000101 3300005344 Bacteria 70279
45 Ga0070661_100005038 3300005344 Bacteria 9110
46 Ga0070661_100032037 3300005344 Bacteria 3803
47 Ga0070661_100104790 3300005344 Bacteria 2107
48 Ga0070661_100134337 3300005344 Bacteria 1860
49 Ga0070668_100000723 3300005347 Bacteria 22613
50 Ga0070668_100012208 3300005347 Bacteria 6399
51 Ga0070668_100020711 3300005347 Bacteria 4966
52 Ga0070668_100094567 3300005347 Bacteria 2359
53 Ga0070669_100000009 3300005353 Bacteria 224683
54 Ga0070669_100000036 3300005353 Bacteria 137564
55 Ga0070669_100005271 3300005353 Bacteria 9333
56 Ga0070669_100106047 3300005353 Bacteria 2127
57 Ga0070675_100001982 3300005354 Bacteria 15173
58 Ga0070671_100000273 3300005355 Bacteria 34866
59 Ga0070671_100001226 3300005355 Bacteria 19207
60 Ga0070671_100008884 3300005355 Bacteria 8062
61 Ga0070671_100014143 3300005355 Bacteria 6445
62 Ga0070671_100022048 3300005355 Bacteria 5203
63 Ga0070671_100035202 3300005355 Bacteria 4148
64 Ga0070673_100000015 3300005364 Bacteria 118064
65 Ga0070688_100014762 3300005365 Bacteria 4431
66 Ga0070659_100000045 3300005366 Bacteria 101520
67 Ga0070659_100005279 3300005366 Bacteria 9272
68 Ga0070659_100011408 3300005366 Bacteria 6573
69 Ga0070659_100014000 3300005366 Bacteria 5986
70 Ga0070667_100000311 3300005367 Bacteria 54491
71 Ga0070667_100000398 3300005367 Bacteria 46959
72 Ga0070667_100005000 3300005367 Bacteria 11097
73 Ga0070667_100006820 3300005367 Bacteria 9486
74 Ga0070667_100072503 3300005367 Bacteria 2935
75 Ga0070667_100139636 3300005367 Bacteria 2121
76 Ga0070663_100000549 3300005455 Bacteria 19942
77 Ga0070663_100021237 3300005455 Bacteria 4314
78 Ga0070663_100074740 3300005455 Bacteria 2475
79 Ga0070678_100010776 3300005456 Bacteria 5603
80 Ga0070662_100000036 3300005457 Bacteria 77190
81 Ga0070662_100092497 3300005457 Bacteria 2273
82 Ga0070662_100116951 3300005457 Bacteria 2039
83 Ga0070681_10004074 3300005458 Bacteria 13800
84 Ga0070681_10043394 3300005458 Bacteria 4505
85 Ga0068867_100000030 3300005459 Bacteria 86560
86 Ga0070685_10000186 3300005466 Bacteria 41567
87 Ga0070679_100011120 3300005530 Bacteria 8568
88 Ga0070679_100097087 3300005530 Bacteria 2934
89 Ga0068853_100000059 3300005539 Bacteria 78301
90 Ga0068853_100188528 3300005539 Bacteria 1873
91 Ga0070672_100026452 3300005543 Bacteria 4318
92 Ga0070686_100000001 3300005544 Bacteria 515830
93 Ga0070693_100000361 3300005547 Bacteria 20637
94 Ga0070665_100000004 3300005548 Bacteria 785500
95 Ga0070665_100000271 3300005548 Bacteria 84713
96 Ga0070665_100001608 3300005548 Bacteria 26014
97 Ga0070665_100004200 3300005548 Bacteria 15157
98 Ga0070665_100022725 3300005548 Bacteria 6313
99 Ga0068855_100003767 3300005563 Bacteria 18537
100 Ga0068855_100158173 3300005563 Bacteria 2573
101 Ga0070664_100000027 3300005564 Bacteria 90881
102 Ga0068857_100008971 3300005577 Bacteria 8665
103 Ga0068857_100028506 3300005577 Bacteria 4927
104 Ga0068857_100068219 3300005577 Bacteria 3166
105 Ga0068857_100096655 3300005577 Bacteria 2647
106 Ga0068857_100188269 3300005577 Bacteria 1879
107 Ga0068854_100013247 3300005578 Bacteria 5405
108 Ga0068854_100037677 3300005578 Bacteria 3395
109 Ga0068856_100000705 3300005614 Bacteria 36291
110 Ga0068852_100000447 3300005616 Bacteria 27185
111 Ga0068852_100002112 3300005616 Bacteria 13601
112 Ga0068852_100134852 3300005616 Bacteria 2279
113 Ga0068859_100005061 3300005617 Bacteria 13383
114 Ga0068859_100038388 3300005617 Bacteria 4805
115 Ga0068859_100112394 3300005617 Bacteria 2787
116 Ga0068864_100000014 3300005618 Bacteria 308927
117 Ga0068864_100000080 3300005618 Bacteria 102508
118 Ga0068864_100004182 3300005618 Bacteria 11862
119 Ga0068864_100018087 3300005618 Bacteria 5882
120 Ga0068861_100012312 3300005719 Bacteria 5966
121 Ga0068861_100016867 3300005719 Bacteria 5175
122 Ga0068863_100000010 3300005841 Bacteria 237758
123 Ga0068863_100000072 3300005841 Bacteria 113996
124 Ga0068863_100000087 3300005841 Bacteria 102508
125 Ga0068863_100014865 3300005841 Bacteria 7478
126 Ga0068863_100017347 3300005841 Bacteria 6903
127 Ga0068863_100029870 3300005841 Bacteria 5205
128 Ga0068858_100000360 3300005842 Bacteria 48023
129 Ga0068858_100000957 3300005842 Bacteria 29868
130 Ga0068858_100002472 3300005842 Bacteria 18656
131 Ga0068858_100014145 3300005842 Bacteria 7525
132 Ga0068858_100032391 3300005842 Bacteria 4855
133 Ga0068860_100000030 3300005843 Bacteria 256364
134 Ga0068860_100000125 3300005843 Bacteria 123363
135 Ga0068860_100000143 3300005843 Bacteria 116787
136 Ga0068860_100000549 3300005843 Bacteria 45722
137 Ga0068860_100021172 3300005843 Bacteria 6299
138 Ga0068862_100000007 3300005844 Bacteria 313933
139 Ga0068862_100000101 3300005844 Bacteria 102508
140 Ga0068862_100013378 3300005844 Bacteria 6790
141 Ga0068862_100023858 3300005844 Bacteria 5128
142 Ga0075362_10000119 3300006177 Bacteria 22052
143 Ga0075369_10000252 3300006186 Bacteria 15880
144 Ga0097621_100026649 3300006237 Bacteria 4537
145 Ga0075370_10012464 3300006353 Bacteria 4494
146 Ga0068865_100000021 3300006881 Bacteria 103137
147 Ga0097620_100005061 3300006931 Bacteria 13383
148 Ga0097620_100038386 3300006931 Bacteria 4805
149 Ga0097620_100112395 3300006931 Bacteria 2787
150 Ga0105251_10000248 3300009011 Bacteria 54567
151 Ga0105251_10008535 3300009011 Bacteria 6147
152 Ga0105251_10058264 3300009011 Bacteria 1824
153 Ga0111539_10019386 3300009094 Bacteria 8397
154 Ga0105245_10003301 3300009098 Bacteria 14485
155 Ga0105247_10027929 3300009101 Bacteria 3413
156 Ga0114129_10143741 3300009147 Bacteria 3268
157 Ga0105243_10001112 3300009148 Bacteria 24427
158 Ga0105242_10005683 3300009176 Bacteria 9626
159 Ga0105248_10000029 3300009177 Bacteria 223366
160 Ga0105248_10000113 3300009177 Bacteria 91128
161 Ga0105248_10001451 3300009177 Bacteria 26388
162 Ga0105248_10006393 3300009177 Bacteria 12926
163 Ga0105248_10027406 3300009177 Bacteria 6343
164 Ga0105238_10268999 3300009551 Bacteria 1685
165 Ga0105238_10295444 3300009551 Bacteria 1603
166 Ga0105249_10000016 3300009553 Bacteria 278643
167 Ga0105249_10000024 3300009553 Bacteria 232947
168 Ga0105246_10041602 3300011119 Bacteria 3107
169 Ga0157373_10094737 3300013100 Bacteria 2102
170 Ga0157373_10099842 3300013100 Bacteria 2043
171 Ga0157371_10002958 3300013102 Bacteria 15800
172 Ga0157371_10036919 3300013102 Bacteria 3499
173 Ga0157370_10032073 3300013104 Bacteria 5133
174 Ga0157374_10007766 3300013296 Bacteria 9154
175 Ga0157374_10031240 3300013296 Bacteria 4840
176 Ga0157378_10002783 3300013297 Bacteria 15589
177 Ga0163162_10010762 3300013306 Bacteria 8899
178 Ga0163162_10057426 3300013306 Bacteria 3920
179 Ga0157372_10016878 3300013307 Bacteria 7837
180 Ga0157372_10036698 3300013307 Bacteria 5403
181 Ga0157372_10061574 3300013307 Bacteria 4203
182 Ga0157372_10068612 3300013307 Bacteria 3987
183 Ga0157375_10001073 3300013308 Bacteria 23687
184 Ga0163163_10000187 3300014325 Bacteria 63661
185 Ga0157380_10000042 3300014326 Bacteria 75921
186 Ga0157380_10001265 3300014326 Bacteria 16405
187 Ga0157379_10029547 3300014968 Bacteria 4873
188 Ga0157376_10000078 3300014969 Bacteria 72879
189 Ga0183363_1003 3300015690 Bacteria 421263
190 Ga0163161_10000044 3300017792 Bacteria 132739
191 Ga0207697_10013778 3300025315 Bacteria 3368
192 Ga0207656_10001958 3300025321 Bacteria 6850
193 Ga0207656_10010388 3300025321 Bacteria 3486
194 Ga0207680_10000008 3300025903 Bacteria 518177
195 Ga0207680_10004748 3300025903 Bacteria 6467
196 Ga0207647_10000283 3300025904 Bacteria 41512
197 Ga0207647_10008918 3300025904 Bacteria 7152
198 Ga0207647_10017381 3300025904 Bacteria 4889
199 Ga0207647_10073173 3300025904 Bacteria 2066
200 Ga0207645_10064066 3300025907 Bacteria 2349
201 Ga0207705_10000025 3300025909 Bacteria 259826
202 Ga0207705_10000086 3300025909 Bacteria 116132
203 Ga0207705_10006870 3300025909 Bacteria 8412
204 Ga0207705_10007151 3300025909 Bacteria 8227
205 Ga0207705_10010242 3300025909 Bacteria 6821
206 Ga0207705_10041994 3300025909 Bacteria 3282
207 Ga0207654_10000709 3300025911 Bacteria 18611
208 Ga0207695_10009470 3300025913 Bacteria 12052
209 Ga0207695_10269495 3300025913 Bacteria 1598
210 Ga0207671_10001568 3300025914 Bacteria 26104
211 Ga0207660_10032472 3300025917 Bacteria 3603
212 Ga0207660_10070277 3300025917 Bacteria 2544
213 Ga0207657_10000133 3300025919 Bacteria 75282
214 Ga0207657_10001177 3300025919 Bacteria 27752
215 Ga0207657_10010382 3300025919 Bacteria 9294
216 Ga0207657_10014227 3300025919 Bacteria 7777
217 Ga0207657_10031486 3300025919 Bacteria 4803
218 Ga0207657_10048983 3300025919 Bacteria 3685
219 Ga0207657_10058499 3300025919 Bacteria 3316
220 Ga0207649_10000378 3300025920 Bacteria 33311
221 Ga0207649_10005706 3300025920 Bacteria 6740
222 Ga0207649_10006434 3300025920 Bacteria 6379
223 Ga0207649_10101744 3300025920 Bacteria 1903
224 Ga0207681_10000001 3300025923 Bacteria 1105841
225 Ga0207681_10000020 3300025923 Bacteria 240498
226 Ga0207681_10001210 3300025923 Bacteria 16603
227 Ga0207694_10202820 3300025924 Bacteria 1614
228 Ga0207650_10000023 3300025925 Bacteria 308148
229 Ga0207650_10000261 3300025925 Bacteria 56610
230 Ga0207650_10009207 3300025925 Bacteria 6749
231 Ga0207650_10018726 3300025925 Bacteria 4862
232 Ga0207644_10000283 3300025931 Bacteria 33445
233 Ga0207644_10000892 3300025931 Bacteria 18859
234 Ga0207644_10002420 3300025931 Bacteria 12027
235 Ga0207644_10003251 3300025931 Bacteria 10484
236 Ga0207644_10014177 3300025931 Bacteria 5331
237 Ga0207644_10015617 3300025931 Bacteria 5100
238 Ga0207690_10000080 3300025932 Bacteria 82082
239 Ga0207690_10017349 3300025932 Bacteria 4393
240 Ga0207690_10058016 3300025932 Bacteria 2617
241 Ga0207690_10062589 3300025932 Bacteria 2534
242 Ga0207706_10000159 3300025933 Bacteria 75284
243 Ga0207706_10002278 3300025933 Bacteria 18727
244 Ga0207706_10003996 3300025933 Bacteria 13970
245 Ga0207706_10062733 3300025933 Bacteria 3272
246 Ga0207691_10032535 3300025940 Bacteria 4862
247 Ga0207711_10000004 3300025941 Bacteria 870636
248 Ga0207711_10002421 3300025941 Bacteria 16657
249 Ga0207711_10003526 3300025941 Bacteria 13544
250 Ga0207711_10007201 3300025941 Bacteria 9322
251 Ga0207711_10042545 3300025941 Bacteria 3871
252 Ga0207711_10043955 3300025941 Bacteria 3812
253 Ga0207661_10001549 3300025944 Bacteria 15638
254 Ga0207661_10005873 3300025944 Bacteria 8664
255 Ga0207679_10000155 3300025945 Bacteria 56504
256 Ga0207679_10004012 3300025945 Bacteria 9140
257 Ga0207679_10219414 3300025945 Bacteria 1599
258 Ga0207667_10000035 3300025949 Bacteria 301056
259 Ga0207667_10033960 3300025949 Bacteria 5481
260 Ga0207667_10048055 3300025949 Bacteria 4513
261 Ga0207712_10000009 3300025961 Bacteria 518177
262 Ga0207712_10000034 3300025961 Bacteria 202320
263 Ga0207668_10000395 3300025972 Bacteria 27651
264 Ga0207668_10037813 3300025972 Bacteria 3234
265 Ga0207668_10074211 3300025972 Bacteria 2441
266 Ga0207640_10012922 3300025981 Bacteria 4771
267 Ga0207640_10017769 3300025981 Bacteria 4167
268 Ga0207658_10000026 3300025986 Bacteria 178292
269 Ga0207658_10000165 3300025986 Bacteria 70667
270 Ga0207658_10000239 3300025986 Bacteria 57662
271 Ga0207658_10000305 3300025986 Bacteria 50588
272 Ga0207658_10003476 3300025986 Bacteria 11138
273 Ga0207658_10005292 3300025986 Bacteria 8873
274 Ga0207658_10005442 3300025986 Bacteria 8730
275 Ga0207658_10005452 3300025986 Bacteria 8726
276 Ga0207658_10040844 3300025986 Bacteria 3356
277 Ga0207703_10000845 3300026035 Bacteria 30089
278 Ga0207703_10002142 3300026035 Bacteria 17354
279 Ga0207703_10027988 3300026035 Bacteria 4438
280 Ga0207639_10000137 3300026041 Bacteria 54378
281 Ga0207639_10002722 3300026041 Bacteria 11856
282 Ga0207678_10000973 3300026067 Bacteria 26103
283 Ga0207678_10003440 3300026067 Bacteria 14260
284 Ga0207678_10004764 3300026067 Bacteria 12179
285 Ga0207678_10006022 3300026067 Bacteria 10787
286 Ga0207678_10010321 3300026067 Bacteria 8197
287 Ga0207678_10045950 3300026067 Bacteria 3776
288 Ga0207702_10000246 3300026078 Bacteria 63201
289 Ga0207702_10001125 3300026078 Bacteria 27311
290 Ga0207702_10009858 3300026078 Bacteria 8006
291 Ga0207641_10000010 3300026088 Bacteria 402193
292 Ga0207641_10000084 3300026088 Bacteria 133555
293 Ga0207641_10000171 3300026088 Bacteria 90550
294 Ga0207641_10000346 3300026088 Bacteria 55535
295 Ga0207641_10001953 3300026088 Bacteria 19772
296 Ga0207641_10003799 3300026088 Bacteria 13248
297 Ga0207641_10011478 3300026088 Bacteria 7272
298 Ga0207641_10024082 3300026088 Bacteria 5017
299 Ga0207676_10000017 3300026095 Bacteria 308709
300 Ga0207676_10000036 3300026095 Bacteria 198447
301 Ga0207676_10001337 3300026095 Bacteria 18342
302 Ga0207676_10004874 3300026095 Bacteria 9500
303 Ga0207674_10007324 3300026116 Bacteria 12852
304 Ga0207674_10034257 3300026116 Bacteria 5311
305 Ga0207674_10034831 3300026116 Bacteria 5258
306 Ga0207674_10045713 3300026116 Bacteria 4501
307 Ga0207674_10046080 3300026116 Bacteria 4480
308 Ga0207674_10052916 3300026116 Bacteria 4139
309 Ga0207674_10083254 3300026116 Bacteria 3199
310 Ga0207675_100000280 3300026118 Bacteria 48895
311 Ga0207675_100003112 3300026118 Bacteria 16274
312 Ga0207683_10006249 3300026121 Bacteria 10212
313 Ga0207683_10015444 3300026121 Bacteria 6504
314 Ga0207698_10000746 3300026142 Bacteria 18863
315 Ga0207698_10001565 3300026142 Bacteria 13341
316 Ga0207698_10024421 3300026142 Bacteria 4242
317 Ga0207698_10044975 3300026142 Bacteria 3322
318 Ga0207698_10239365 3300026142 Bacteria 1653
319 Ga0207428_10086012 3300027907 Bacteria 2447
320 Ga0268266_10000009 3300028379 Bacteria 1097737
321 Ga0268266_10000479 3300028379 Bacteria 57570
322 Ga0268266_10004041 3300028379 Bacteria 14177
323 Ga0268265_10000002 3300028380 Bacteria 1035381
324 Ga0268265_10000059 3300028380 Bacteria 152531
325 Ga0268265_10000785 3300028380 Bacteria 30390
326 Ga0268265_10001950 3300028380 Bacteria 16391
327 Ga0268265_10005518 3300028380 Bacteria 8631
328 Ga0268265_10013764 3300028380 Bacteria 5506
329 Ga0268265_10070011 3300028380 Bacteria 2726
330 Ga0268264_10000003 3300028381 Bacteria 1141976
331 Ga0268264_10000076 3300028381 Bacteria 255518
332 Ga0268264_10000166 3300028381 Bacteria 146960
333 Ga0268264_10000291 3300028381 Bacteria 84105
334 Ga0268264_10008884 3300028381 Bacteria 8332
335 Ga0307513_10109130 3300031456 Bacteria 2766
336 Ga0307408_100100473 3300031548 Bacteria 2203
337 Ga0307405_10059825 3300031731 Bacteria 2402
338 Ga0307413_10061153 3300031824 Bacteria 2322
339 Ga0307406_10037688 3300031901 Bacteria 2988
340 Ga0307412_10023870 3300031911 Bacteria 3769
341 Ga0307416_100040491 3300032002 Bacteria 3620
342 Ga0395899_0011726 3300037312 Bacteria 6709
343 Ga0395899_0056365 3300037312 Bacteria 2904
344 Ga0395899_0060893 3300037312 Bacteria 2780
345 Ga0395900_0009432 3300037418 Bacteria 10004
346 Ga0395900_0070642 3300037418 Bacteria 3589
347 Ga0395900_0188296 3300037418 Bacteria 2094
348 Ga0395898_0007043 3300037466 Bacteria 11950
349 Ga0395898_0048807 3300037466 Bacteria 4149
350 Ga0395898_0059511 3300037466 Bacteria 3715
351 Ga0395898_0232858 3300037466 Bacteria 1757
352 Ga0395898_0287531 3300037466 Bacteria 1568
353 Ga0395905_0011414 3300037471 Bacteria 8584
354 Ga0395905_0034213 3300037471 Bacteria 4771
355 Ga0395905_0056760 3300037471 Bacteria 3662
356 Ga0395901_0006129 3300038443 Bacteria 12182
357 Ga0395901_0028486 3300038443 Bacteria 5743
358 Ga0395901_0107009 3300038443 Bacteria 2935
359 Ga0439448_0000284 3300042005 Bacteria 11120
360 Ga0439455_0003871 3300042012 Bacteria 2910
361 Ga0450905_000216 3300042142 Bacteria 6652
362 Ga0450889_000027 3300042144 Bacteria 12498
363 Ga0439458_0000334 3300042157 Bacteria 11790
364 Ga0439458_0003981 3300042157 Bacteria 3413
365 Ga0466963_0005117 3300044694 Bacteria 7660
366 Ga0466963_0014008 3300044694 Bacteria 4938
367 Ga0466963_0039353 3300044694 Bacteria 3096
368 Ga0466967_0022868 3300045976 Bacteria 5111
369 Ga0466967_0158376 3300045976 Bacteria 2123
370 Ga0495638_0017010 3300046460 Bacteria 4860
371 Ga0495583_0000033 3300046506 Bacteria 246882
372 Ga0495606_0000685 3300046507 Bacteria 52815
373 Ga0495606_0061052 3300046507 Bacteria 2412
374 Ga0495610_0063994 3300046512 Bacteria 1740
375 Ga0495654_0001253 3300046530 Bacteria 17890
376 Ga0495597_0010701 3300046542 Bacteria 4473
377 Ga0495686_0000310 3300047472 Bacteria 82212
378 Ga0495686_0021172 3300047472 Bacteria 4324
379 Ga0496102_0000640 3300048905 Bacteria 35507
380 Ga0496102_0047576 3300048905 Bacteria 3899
381 Ga0496102_0051328 3300048905 Bacteria 3757
382 Ga0496103_0000197 3300048906 Bacteria 60344
383 Ga0496103_0060835 3300048906 Bacteria 2348
384 Ga0496104_0038798 3300048907 Bacteria 4458
385 Ga0496104_0045437 3300048907 Bacteria 4131
386 Ga0496105_0015983 3300048908 Bacteria 5985
387 Ga0496107_0068561 3300048910 Bacteria 2574
388 Ga0496109_0096077 3300048912 Bacteria 2745
389 Ga0496109_0103389 3300048912 Bacteria 2644
390 Ga0496110_0121204 3300048913 Bacteria 2356
391 Ga0496112_0034921 3300048915 Bacteria 4893
392 Ga0496115_0001950 3300048918 Bacteria 14718
393 Ga0496116_0001609 3300048919 Bacteria 24823
394 Ga0496116_0027104 3300048919 Bacteria 4175
395 Ga0496116_0034879 3300048919 Bacteria 3541
396 Ga0496117_0000467 3300048920 Bacteria 67483
397 Ga0496117_0061017 3300048920 Bacteria 2594
398 Ga0496118_0000335 3300048921 Bacteria 80253
399 Ga0496118_0000459 3300048921 Bacteria 67483
400 Ga0496118_0015929 3300048921 Bacteria 6926
401 Ga0496120_0010920 3300048923 Bacteria 6283
402 Ga0496120_0028973 3300048923 Bacteria 3386
403 Ga0496120_0082808 3300048923 Bacteria 1733
404 Ga0496121_0002963 3300048924 Bacteria 24733
405 Ga0496121_0006668 3300048924 Bacteria 14201
406 Ga0496123_0002155 3300048926 Bacteria 25154
407 Ga0496124_0000499 3300048927 Bacteria 67483
408 Ga0496124_0007794 3300048927 Bacteria 11310
409 Ga0496124_0035156 3300048927 Bacteria 4387
410 Ga0496125_0043694 3300048928 Bacteria 3798
411 Ga0496126_0002845 3300048929 Bacteria 22641
412 Ga0496126_0061853 3300048929 Bacteria 3361
413 Ga0495682_0004879 3300049460 Bacteria 5653
414 Ga0501047_0002646 3300049581 Bacteria 17045
415 nmdc:mga0k408_79864_c1 3300050493 Bacteria 1914
416 nmdc:mga07m45_67786_c1 3300050496 Bacteria 2028
417 nmdc:mga05p37_245785_c1 3300050507 Bacteria 2148
418 nmdc:mga08y16_41709_c1 3300050511 Bacteria 4807
419 Ga0500643_000098 3300053087 Bacteria 91878
420 Ga0500643_000467 3300053087 Bacteria 29824
421 Ga0500643_001548 3300053087 Bacteria 13030
422 Ga0500647_0056862 3300053091 Bacteria 1881
423 Ga0500651_0002418 3300053093 Bacteria 9848
424 Ga0500641_0008336 3300053096 Bacteria 3695
425 Ga0500555_000389 3300053103 Bacteria 18479
426 Ga0500592_000525 3300053116 Bacteria 6315
427 Ga0500642_0038971 3300053130 Bacteria 2040
428 Ga0500655_000552 3300053133 Bacteria 7530
429 Ga0500573_0048640 3300053140 Bacteria 2441
430 Ga0500590_005198 3300053148 Bacteria 6244
431 Ga0500616_0026800 3300053153 Bacteria 3186
432 Ga0500622_0009917 3300053156 Bacteria 5255
433 Ga0500627_0000275 3300053158 Bacteria 14662
434 Ga0500627_0000599 3300053158 Bacteria 9602
435 Ga0500570_006148 3300053724 Bacteria 6495
436 Ga0466962_0001271 3300061719 Bacteria 11646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005577 Ga0068857_100068219 Ga0068857_1000682192 395
2 3300026116 Ga0207674_10083254 Ga0207674_100832543 395
3 3300050493 nmdc:mga0k408_79864_c1 nmdc:mga0k408_79864_c1_19_1449 395
4 3300001989 JGI24739J22299_10017365 JGI24739J22299_100173653 400
5 3300002075 JGI24738J21930_10009804 JGI24738J21930_100098042 400
6 3300005327 Ga0070658_10015486 Ga0070658_100154864 400
7 3300005335 Ga0070666_10002894 Ga0070666_100028949 400
8 3300005457 Ga0070662_100092497 Ga0070662_1000924972 400
9 3300005548 Ga0070665_100022725 Ga0070665_1000227257 400
10 3300005577 Ga0068857_100028506 Ga0068857_1000285063 400
11 3300005578 Ga0068854_100037677 Ga0068854_1000376773 400
12 3300009551 Ga0105238_10295444 Ga0105238_102954441 400
13 3300013102 Ga0157371_10036919 Ga0157371_100369192 400
14 3300013307 Ga0157372_10068612 Ga0157372_100686124 400
15 3300025924 Ga0207694_10202820 Ga0207694_102028201 400
16 3300005344 Ga0070661_100134337 Ga0070661_1001343371 401
17 3300025904 Ga0207647_10017381 Ga0207647_100173813 401
18 3300025909 Ga0207705_10007151 Ga0207705_100071517 401
19 3300025919 Ga0207657_10048983 Ga0207657_100489833 401
20 3300025919 Ga0207657_10058499 Ga0207657_100584993 401
21 3300025920 Ga0207649_10101744 Ga0207649_101017441 401
22 3300026067 Ga0207678_10045950 Ga0207678_100459504 401
23 3300026116 Ga0207674_10034257 Ga0207674_100342574 401
24 3300005539 Ga0068853_100188528 Ga0068853_1001885282 402
25 3300037418 Ga0395900_0188296 Ga0395900_0188296_97_1506 402
26 3300048918 Ga0496115_0001950 Ga0496115_0001950_9073_10482 402
27 3300005339 Ga0070660_100011318 Ga0070660_1000113183 403
28 3300005344 Ga0070661_100005038 Ga0070661_1000050385 403
29 3300005347 Ga0070668_100020711 Ga0070668_1000207113 403
30 3300005366 Ga0070659_100005279 Ga0070659_1000052792 403
31 3300005458 Ga0070681_10004074 Ga0070681_100040747 403
32 3300005530 Ga0070679_100097087 Ga0070679_1000970873 403
33 3300025917 Ga0207660_10032472 Ga0207660_100324722 403
34 3300025919 Ga0207657_10001177 Ga0207657_1000117710 403
35 3300025920 Ga0207649_10006434 Ga0207649_100064344 403
36 3300025972 Ga0207668_10037813 Ga0207668_100378132 403
37 3300005327 Ga0070658_10000107 Ga0070658_100001079 404
38 3300005329 Ga0070683_100001635 Ga0070683_1000016358 404
39 3300005331 Ga0070670_100060931 Ga0070670_1000609313 404
40 3300005335 Ga0070666_10001184 Ga0070666_100011848 404
41 3300005339 Ga0070660_100000861 Ga0070660_10000086124 404
42 3300005344 Ga0070661_100000101 Ga0070661_10000010128 404
43 3300005355 Ga0070671_100014143 Ga0070671_1000141435 404
44 3300005366 Ga0070659_100000045 Ga0070659_10000004567 404
45 3300005367 Ga0070667_100072503 Ga0070667_1000725032 404
46 3300005455 Ga0070663_100000549 Ga0070663_10000054911 404
47 3300005457 Ga0070662_100000036 Ga0070662_10000003654 404
48 3300005539 Ga0068853_100000059 Ga0068853_10000005938 404
49 3300005547 Ga0070693_100000361 Ga0070693_1000003614 404
50 3300005548 Ga0070665_100004200 Ga0070665_1000042006 404
51 3300005563 Ga0068855_100003767 Ga0068855_10000376717 404
52 3300005564 Ga0070664_100000027 Ga0070664_10000002754 404
53 3300005577 Ga0068857_100096655 Ga0068857_1000966553 404
54 3300005614 Ga0068856_100000705 Ga0068856_1000007057 404
55 3300005616 Ga0068852_100002112 Ga0068852_1000021128 404
56 3300005842 Ga0068858_100014145 Ga0068858_1000141456 404
57 3300006237 Ga0097621_100026649 Ga0097621_1000266495 404
58 3300009177 Ga0105248_10001451 Ga0105248_1000145123 404
59 3300013100 Ga0157373_10094737 Ga0157373_100947372 404
60 3300013102 Ga0157371_10002958 Ga0157371_1000295813 404
61 3300013296 Ga0157374_10031240 Ga0157374_100312402 404
62 3300014325 Ga0163163_10000187 Ga0163163_1000018724 404
63 3300025903 Ga0207680_10004748 Ga0207680_100047483 404
64 3300025909 Ga0207705_10000086 Ga0207705_10000086117 404
65 3300025919 Ga0207657_10000133 Ga0207657_1000013349 404
66 3300025920 Ga0207649_10000378 Ga0207649_1000037824 404
67 3300025931 Ga0207644_10015617 Ga0207644_100156174 404
68 3300025932 Ga0207690_10000080 Ga0207690_1000008038 404
69 3300025933 Ga0207706_10000159 Ga0207706_1000015949 404
70 3300025941 Ga0207711_10003526 Ga0207711_1000352612 404
71 3300025944 Ga0207661_10001549 Ga0207661_100015496 404
72 3300025945 Ga0207679_10000155 Ga0207679_1000015533 404
73 3300025945 Ga0207679_10219414 Ga0207679_102194141 404
74 3300025986 Ga0207658_10040844 Ga0207658_100408443 404
75 3300026041 Ga0207639_10000137 Ga0207639_100001378 404
76 3300026067 Ga0207678_10000973 Ga0207678_1000097319 404
77 3300026078 Ga0207702_10000246 Ga0207702_1000024642 404
78 3300026116 Ga0207674_10034831 Ga0207674_100348312 404
79 3300026142 Ga0207698_10001565 Ga0207698_1000156510 404
80 3300026142 Ga0207698_10239365 Ga0207698_102393651 404
81 3300048915 Ga0496112_0034921 Ga0496112_0034921_2476_3891 404
82 3300005355 Ga0070671_100001226 Ga0070671_10000122611 405
83 3300025931 Ga0207644_10000892 Ga0207644_1000089210 405
84 3300025945 Ga0207679_10004012 Ga0207679_100040127 405
85 3300025986 Ga0207658_10005442 Ga0207658_100054426 405
86 3300026121 Ga0207683_10015444 Ga0207683_100154444 405
87 3300028380 Ga0268265_10001950 Ga0268265_1000195012 405
88 3300044694 Ga0466963_0005117 Ga0466963_0005117_3182_4600 405
89 3300045976 Ga0466967_0158376 Ga0466967_0158376_478_1896 405
90 3300031456 Ga0307513_10109130 Ga0307513_101091303 406
91 3300037466 Ga0395898_0287531 Ga0395898_0287531_53_1474 406
92 3300037471 Ga0395905_0034213 Ga0395905_0034213_2969_4378 406
93 3300037471 Ga0395905_0056760 Ga0395905_0056760_1542_2963 406
94 3300038443 Ga0395901_0107009 Ga0395901_0107009_127_1548 406
95 3300053096 Ga0500641_0008336 Ga0500641_0008336_632_2035 406
96 3300005347 Ga0070668_100094567 Ga0070668_1000945673 407
97 3300005841 Ga0068863_100029870 Ga0068863_1000298704 407
98 3300025941 Ga0207711_10043955 Ga0207711_100439553 407
99 3300025972 Ga0207668_10074211 Ga0207668_100742112 407
100 3300026088 Ga0207641_10011478 Ga0207641_100114785 407
101 3300005335 Ga0070666_10047574 Ga0070666_100475742 408
102 3300005367 Ga0070667_100139636 Ga0070667_1001396362 408
103 3300015690 Ga0183363_1003 Ga0183363_1003404 408
104 3300026088 Ga0207641_10024082 Ga0207641_100240824 408
105 3300037312 Ga0395899_0060893 Ga0395899_0060893_353_1768 408
106 3300037418 Ga0395900_0070642 Ga0395900_0070642_1162_2577 408
107 3300037466 Ga0395898_0059511 Ga0395898_0059511_1863_3278 408
108 3300038443 Ga0395901_0028486 Ga0395901_0028486_1162_2577 408
109 3300005327 Ga0070658_10031166 Ga0070658_100311664 409
110 3300005328 Ga0070676_10000889 Ga0070676_1000088912 409
111 3300005329 Ga0070683_100006411 Ga0070683_1000064114 409
112 3300005334 Ga0068869_100000428 Ga0068869_10000042812 409
113 3300005336 Ga0070680_100008676 Ga0070680_1000086766 409
114 3300005338 Ga0068868_100000387 Ga0068868_10000038716 409
115 3300005344 Ga0070661_100032037 Ga0070661_1000320371 409
116 3300005364 Ga0070673_100000015 Ga0070673_10000001557 409
117 3300005458 Ga0070681_10043394 Ga0070681_100433943 409
118 3300005459 Ga0068867_100000030 Ga0068867_10000003025 409
119 3300005530 Ga0070679_100011120 Ga0070679_1000111205 409
120 3300005563 Ga0068855_100158173 Ga0068855_1001581733 409
121 3300006881 Ga0068865_100000021 Ga0068865_10000002158 409
122 3300009098 Ga0105245_10003301 Ga0105245_100033019 409
123 3300009148 Ga0105243_10001112 Ga0105243_1000111217 409
124 3300009176 Ga0105242_10005683 Ga0105242_100056839 409
125 3300013296 Ga0157374_10007766 Ga0157374_100077666 409
126 3300013297 Ga0157378_10002783 Ga0157378_1000278312 409
127 3300013308 Ga0157375_10001073 Ga0157375_100010736 409
128 3300014969 Ga0157376_10000078 Ga0157376_1000007818 409
129 3300025321 Ga0207656_10001958 Ga0207656_100019582 409
130 3300025909 Ga0207705_10006870 Ga0207705_100068706 409
131 3300025909 Ga0207705_10010242 Ga0207705_100102428 409
132 3300025913 Ga0207695_10269495 Ga0207695_102694952 409
133 3300025917 Ga0207660_10070277 Ga0207660_100702772 409
134 3300025919 Ga0207657_10010382 Ga0207657_100103826 409
135 3300025919 Ga0207657_10014227 Ga0207657_100142276 409
136 3300025920 Ga0207649_10005706 Ga0207649_100057065 409
137 3300025949 Ga0207667_10033960 Ga0207667_100339604 409
138 3300026067 Ga0207678_10003440 Ga0207678_1000344011 409
139 3300026067 Ga0207678_10006022 Ga0207678_100060226 409
140 3300026078 Ga0207702_10009858 Ga0207702_100098585 409
141 3300026142 Ga0207698_10044975 Ga0207698_100449752 409
142 3300037312 Ga0395899_0011726 Ga0395899_0011726_823_2244 409
143 3300037418 Ga0395900_0009432 Ga0395900_0009432_1623_3044 409
144 3300037466 Ga0395898_0007043 Ga0395898_0007043_6961_8382 409
145 3300037466 Ga0395898_0232858 Ga0395898_0232858_212_1651 409
146 3300037471 Ga0395905_0011414 Ga0395905_0011414_4598_6019 409
147 3300038443 Ga0395901_0006129 Ga0395901_0006129_3801_5222 409
148 3300044694 Ga0466963_0039353 Ga0466963_0039353_13_1446 409
149 3300048912 Ga0496109_0096077 Ga0496109_0096077_1309_2727 409
150 3300044694 Ga0466963_0014008 Ga0466963_0014008_272_1711 410
151 3300045976 Ga0466967_0022868 Ga0466967_0022868_655_2094 410
152 3300061719 Ga0466962_0001271 Ga0466962_0001271_4685_6124 410
153 3300013307 Ga0157372_10061574 Ga0157372_100615743 412
154 3300025315 Ga0207697_10013778 Ga0207697_100137782 412
155 3300025904 Ga0207647_10008918 Ga0207647_100089182 412
156 3300025932 Ga0207690_10062589 Ga0207690_100625892 412
157 3300025933 Ga0207706_10003996 Ga0207706_100039964 412
158 3300042005 Ga0439448_0000284 Ga0439448_0000284_1353_2789 412
159 3300042012 Ga0439455_0003871 Ga0439455_0003871_379_1815 412
160 3300042157 Ga0439458_0000334 Ga0439458_0000334_7683_9119 412
161 3300042157 Ga0439458_0003981 Ga0439458_0003981_1288_2724 412
162 3300049581 Ga0501047_0002646 Ga0501047_0002646_13490_14905 414
163 3300005347 Ga0070668_100012208 Ga0070668_1000122084 415
164 3300005353 Ga0070669_100005271 Ga0070669_1000052711 415
165 3300005355 Ga0070671_100008884 Ga0070671_1000088843 415
166 3300005367 Ga0070667_100005000 Ga0070667_1000050009 415
167 3300005548 Ga0070665_100000271 Ga0070665_1000002711 415
168 3300005841 Ga0068863_100017347 Ga0068863_1000173473 415
169 3300005843 Ga0068860_100021172 Ga0068860_1000211722 415
170 3300009011 Ga0105251_10008535 Ga0105251_100085353 415
171 3300009101 Ga0105247_10027929 Ga0105247_100279291 415
172 3300009177 Ga0105248_10027406 Ga0105248_100274064 415
173 3300025923 Ga0207681_10001210 Ga0207681_100012103 415
174 3300025931 Ga0207644_10002420 Ga0207644_100024207 415
175 3300025941 Ga0207711_10042545 Ga0207711_100425453 415
176 3300025986 Ga0207658_10005292 Ga0207658_100052921 415
177 3300026088 Ga0207641_10003799 Ga0207641_100037999 415
178 3300028379 Ga0268266_10000479 Ga0268266_1000047946 415
179 3300028380 Ga0268265_10070011 Ga0268265_100700113 415
180 3300028381 Ga0268264_10008884 Ga0268264_100088845 415
181 3300048919 Ga0496116_0027104 Ga0496116_0027104_1116_2570 415
182 3300048923 Ga0496120_0028973 Ga0496120_0028973_92_1546 415
183 3300048924 Ga0496121_0006668 Ga0496121_0006668_5084_6538 415
184 3300048929 Ga0496126_0061853 Ga0496126_0061853_598_2052 415
185 3300005841 Ga0068863_100000072 Ga0068863_100000072105 416
186 3300026088 Ga0207641_10000084 Ga0207641_10000084106 416
187 3300001976 JGI24752J21851_1000844 JGI24752J21851_10008444 418
188 3300005289 Ga0065704_10073574 Ga0065704_100735745 418
189 3300005331 Ga0070670_100000215 Ga0070670_10000021544 418
190 3300005367 Ga0070667_100000311 Ga0070667_10000031144 418
191 3300005617 Ga0068859_100038388 Ga0068859_1000383882 418
192 3300005618 Ga0068864_100000080 Ga0068864_10000008053 418
193 3300005841 Ga0068863_100000087 Ga0068863_10000008753 418
194 3300005844 Ga0068862_100000101 Ga0068862_10000010153 418
195 3300006931 Ga0097620_100038386 Ga0097620_1000383867 418
196 3300009011 Ga0105251_10000248 Ga0105251_100002487 418
197 3300009177 Ga0105248_10000029 Ga0105248_10000029102 418
198 3300009553 Ga0105249_10000024 Ga0105249_1000002494 418
199 3300013306 Ga0163162_10010762 Ga0163162_100107625 418
200 3300014968 Ga0157379_10029547 Ga0157379_100295476 418
201 3300031824 Ga0307413_10061153 Ga0307413_100611532 418
202 3300032002 Ga0307416_100040491 Ga0307416_1000404914 418
203 3300053091 Ga0500647_0056862 Ga0500647_0056862_116_1522 418
204 3300046507 Ga0495606_0000685 Ga0495606_0000685_22584_23996 419
205 3300046542 Ga0495597_0010701 Ga0495597_0010701_681_2087 419
206 3300053093 Ga0500651_0002418 Ga0500651_0002418_769_2175 419
207 3300053130 Ga0500642_0038971 Ga0500642_0038971_540_1946 419
208 3300053133 Ga0500655_000552 Ga0500655_000552_1243_2649 419
209 3300053148 Ga0500590_005198 Ga0500590_005198_4064_5470 419
210 3300053153 Ga0500616_0026800 Ga0500616_0026800_407_1828 419
211 3300053156 Ga0500622_0009917 Ga0500622_0009917_3286_4692 419
212 3300053724 Ga0500570_006148 Ga0500570_006148_4689_6095 419
213 3300005843 Ga0068860_100000125 Ga0068860_10000012512 420
214 3300025986 Ga0207658_10000165 Ga0207658_1000016532 420
215 3300028381 Ga0268264_10000166 Ga0268264_1000016634 420
216 3300031901 Ga0307406_10037688 Ga0307406_100376882 420
217 3300031911 Ga0307412_10023870 Ga0307412_100238702 420
218 3300046460 Ga0495638_0017010 Ga0495638_0017010_751_2166 420
219 3300046506 Ga0495583_0000033 Ga0495583_0000033_211420_212835 420
220 3300046507 Ga0495606_0061052 Ga0495606_0061052_57_1472 420
221 3300046512 Ga0495610_0063994 Ga0495610_0063994_73_1488 420
222 3300047472 Ga0495686_0000310 Ga0495686_0000310_46218_47633 420
223 3300049460 Ga0495682_0004879 Ga0495682_0004879_2790_4205 420
224 3300053103 Ga0500555_000389 Ga0500555_000389_13924_15339 420
225 3300053140 Ga0500573_0048640 Ga0500573_0048640_780_2180 420
226 3300005578 Ga0068854_100013247 Ga0068854_1000132474 421
227 3300005616 Ga0068852_100000447 Ga0068852_10000044711 421
228 3300009094 Ga0111539_10019386 Ga0111539_100193864 421
229 3300009147 Ga0114129_10143741 Ga0114129_101437413 421
230 3300009177 Ga0105248_10006393 Ga0105248_100063934 421
231 3300025941 Ga0207711_10002421 Ga0207711_1000242112 421
232 3300025981 Ga0207640_10012922 Ga0207640_100129225 421
233 3300026142 Ga0207698_10000746 Ga0207698_100007464 421
234 3300027907 Ga0207428_10086012 Ga0207428_100860122 421
235 3300031731 Ga0307405_10059825 Ga0307405_100598252 421
236 3300042142 Ga0450905_000216 Ga0450905_000216_3891_5306 421
237 3300042144 Ga0450889_000027 Ga0450889_000027_8376_9791 421
238 3300048928 Ga0496125_0043694 Ga0496125_0043694_609_2006 421
239 3300050507 nmdc:mga05p37_245785_c1 nmdc:mga05p37_245785_c1_494_1909 421
240 3300050511 nmdc:mga08y16_41709_c1 nmdc:mga08y16_41709_c1_892_2307 421
241 3300053116 Ga0500592_000525 Ga0500592_000525_2735_4141 421
242 iso_pu_bacteria 2990265787 2990265996 421
243 iso_pu_bacteria 2993693658 2993696212 421
244 3300001989 JGI24739J22299_10029993 JGI24739J22299_100299932 422
245 3300001990 JGI24737J22298_10025732 JGI24737J22298_100257322 422
246 3300002067 JGI24735J21928_10017389 JGI24735J21928_100173892 422
247 3300002067 JGI24735J21928_10022942 JGI24735J21928_100229422 422
248 3300002077 JGI24744J21845_10002029 JGI24744J21845_100020292 422
249 3300005328 Ga0070676_10060943 Ga0070676_100609432 422
250 3300005339 Ga0070660_100003311 Ga0070660_1000033112 422
251 3300005354 Ga0070675_100001982 Ga0070675_1000019829 422
252 3300005355 Ga0070671_100022048 Ga0070671_1000220482 422
253 3300005366 Ga0070659_100014000 Ga0070659_1000140004 422
254 3300005455 Ga0070663_100021237 Ga0070663_1000212373 422
255 3300005456 Ga0070678_100010776 Ga0070678_1000107762 422
256 3300005543 Ga0070672_100026452 Ga0070672_1000264524 422
257 3300009551 Ga0105238_10268999 Ga0105238_102689991 422
258 3300025907 Ga0207645_10064066 Ga0207645_100640661 422
259 3300025919 Ga0207657_10031486 Ga0207657_100314862 422
260 3300025931 Ga0207644_10014177 Ga0207644_100141773 422
261 3300025932 Ga0207690_10017349 Ga0207690_100173493 422
262 3300025940 Ga0207691_10032535 Ga0207691_100325352 422
263 3300025944 Ga0207661_10005873 Ga0207661_100058732 422
264 3300025949 Ga0207667_10000035 Ga0207667_1000003564 422
265 3300026067 Ga0207678_10004764 Ga0207678_100047649 422
266 3300026116 Ga0207674_10046080 Ga0207674_100460803 422
267 3300026121 Ga0207683_10006249 Ga0207683_100062496 422
268 3300037312 Ga0395899_0056365 Ga0395899_0056365_1151_2578 422
269 3300037466 Ga0395898_0048807 Ga0395898_0048807_2396_3823 422
270 3300053087 Ga0500643_000098 Ga0500643_000098_64030_65439 422
271 3300053087 Ga0500643_001548 Ga0500643_001548_9659_11056 422
272 3300053158 Ga0500627_0000599 Ga0500627_0000599_3309_4715 422
273 iso_pu_bacteria 2808606404 2809079285 422
274 iso_pu_bacteria 2808606405 2809083341 422
275 iso_pu_bacteria 2880518877 2880520549 422
276 3300005548 Ga0070665_100001608 Ga0070665_10000160810 423
277 3300005617 Ga0068859_100112394 Ga0068859_1001123943 423
278 3300005618 Ga0068864_100018087 Ga0068864_1000180873 423
279 3300005842 Ga0068858_100002472 Ga0068858_10000247220 423
280 3300005842 Ga0068858_100032391 Ga0068858_1000323913 423
281 3300005843 Ga0068860_100000549 Ga0068860_10000054930 423
282 3300006931 Ga0097620_100112395 Ga0097620_1001123951 423
283 3300025986 Ga0207658_10003476 Ga0207658_100034765 423
284 3300026035 Ga0207703_10002142 Ga0207703_1000214219 423
285 3300026035 Ga0207703_10027988 Ga0207703_100279883 423
286 3300028379 Ga0268266_10004041 Ga0268266_100040419 423
287 3300028380 Ga0268265_10013764 Ga0268265_100137645 423
288 3300028381 Ga0268264_10000291 Ga0268264_1000029163 423
289 3300048906 Ga0496103_0060835 Ga0496103_0060835_22_1461 423
290 3300048907 Ga0496104_0038798 Ga0496104_0038798_2849_4288 423
291 3300048908 Ga0496105_0015983 Ga0496105_0015983_1593_3032 423
292 3300048912 Ga0496109_0103389 Ga0496109_0103389_184_1653 423
293 3300048913 Ga0496110_0121204 Ga0496110_0121204_245_1714 423
294 3300048923 Ga0496120_0082808 Ga0496120_0082808_180_1619 423
295 3300048924 Ga0496121_0002963 Ga0496121_0002963_5138_6577 423
296 3300048929 Ga0496126_0002845 Ga0496126_0002845_13634_15103 423
297 3300005457 Ga0070662_100116951 Ga0070662_1001169512 424
298 3300006353 Ga0075370_10012464 Ga0075370_100124646 424
299 3300031548 Ga0307408_100100473 Ga0307408_1001004732 424
300 3300048905 Ga0496102_0000640 Ga0496102_0000640_26206_27606 424
301 3300048906 Ga0496103_0000197 Ga0496103_0000197_26206_27606 424
302 3300048919 Ga0496116_0001609 Ga0496116_0001609_15497_16897 424
303 3300048920 Ga0496117_0000467 Ga0496117_0000467_26206_27606 424
304 3300048920 Ga0496117_0061017 Ga0496117_0061017_529_1956 424
305 3300048921 Ga0496118_0000459 Ga0496118_0000459_39878_41278 424
306 3300048923 Ga0496120_0010920 Ga0496120_0010920_4070_5497 424
307 3300048927 Ga0496124_0000499 Ga0496124_0000499_26206_27606 424
308 3300048927 Ga0496124_0007794 Ga0496124_0007794_8922_10349 424
309 3300050496 nmdc:mga07m45_67786_c1 nmdc:mga07m45_67786_c1_507_1937 424
310 iso_pu_bacteria 2919709256 2919712103 424
311 3300002076 JGI24749J21850_1000160 JGI24749J21850_10001607 425
312 3300002459 JGI24751J29686_10000377 JGI24751J29686_1000037710 425
313 3300005295 Ga0065707_10098385 Ga0065707_100983853 425
314 3300005331 Ga0070670_100000006 Ga0070670_100000006302 425
315 3300005335 Ga0070666_10022520 Ga0070666_100225204 425
316 3300005347 Ga0070668_100000723 Ga0070668_1000007235 425
317 3300005353 Ga0070669_100000036 Ga0070669_100000036140 425
318 3300005353 Ga0070669_100106047 Ga0070669_1001060472 425
319 3300005355 Ga0070671_100000273 Ga0070671_10000027332 425
320 3300005367 Ga0070667_100000398 Ga0070667_10000039849 425
321 3300005367 Ga0070667_100006820 Ga0070667_1000068209 425
322 3300005618 Ga0068864_100000014 Ga0068864_10000001410 425
323 3300005618 Ga0068864_100004182 Ga0068864_1000041827 425
324 3300005719 Ga0068861_100016867 Ga0068861_1000168672 425
325 3300005841 Ga0068863_100014865 Ga0068863_1000148657 425
326 3300005842 Ga0068858_100000957 Ga0068858_1000009577 425
327 3300005843 Ga0068860_100000143 Ga0068860_10000014310 425
328 3300005844 Ga0068862_100000007 Ga0068862_100000007301 425
329 3300005844 Ga0068862_100013378 Ga0068862_1000133784 425
330 3300006177 Ga0075362_10000119 Ga0075362_1000011923 425
331 3300006186 Ga0075369_10000252 Ga0075369_1000025211 425
332 3300009177 Ga0105248_10000113 Ga0105248_100001138 425
333 3300014326 Ga0157380_10000042 Ga0157380_1000004275 425
334 3300025923 Ga0207681_10000001 Ga0207681_100000018 425
335 3300025925 Ga0207650_10000023 Ga0207650_100000238 425
336 3300025925 Ga0207650_10009207 Ga0207650_100092076 425
337 3300025931 Ga0207644_10000283 Ga0207644_1000028310 425
338 3300025941 Ga0207711_10007201 Ga0207711_100072018 425
339 3300025972 Ga0207668_10000395 Ga0207668_1000039510 425
340 3300025986 Ga0207658_10000026 Ga0207658_10000026177 425
341 3300025986 Ga0207658_10005452 Ga0207658_100054522 425
342 3300026035 Ga0207703_10000845 Ga0207703_1000084526 425
343 3300026088 Ga0207641_10000346 Ga0207641_100003467 425
344 3300026088 Ga0207641_10001953 Ga0207641_1000195317 425
345 3300026095 Ga0207676_10000017 Ga0207676_1000001710 425
346 3300026095 Ga0207676_10004874 Ga0207676_100048742 425
347 3300026118 Ga0207675_100000280 Ga0207675_1000002802 425
348 3300028380 Ga0268265_10000002 Ga0268265_100000028 425
349 3300028380 Ga0268265_10005518 Ga0268265_1000551810 425
350 3300028381 Ga0268264_10000076 Ga0268264_1000007610 425
351 3300053087 Ga0500643_000467 Ga0500643_000467_8914_10332 425
352 3300002067 JGI24735J21928_10003064 JGI24735J21928_100030645 426
353 3300013307 Ga0157372_10016878 Ga0157372_100168784 426
354 3300025909 Ga0207705_10000025 Ga0207705_1000002568 426
355 iso_pu_bacteria 2643221605 2644038307 426
356 iso_pu_bacteria 2643221606 2644043253 426
357 iso_pu_bacteria 2643221671 2644395316 426
358 3300025925 Ga0207650_10000261 Ga0207650_1000026149 427
359 3300025941 Ga0207711_10000004 Ga0207711_10000004405 427
360 3300025961 Ga0207712_10000034 Ga0207712_1000003494 427
361 3300025986 Ga0207658_10000239 Ga0207658_1000023949 427
362 3300026088 Ga0207641_10000010 Ga0207641_1000001048 427
363 3300026095 Ga0207676_10000036 Ga0207676_1000003691 427
364 3300026116 Ga0207674_10045713 Ga0207674_100457133 427
365 3300028380 Ga0268265_10000059 Ga0268265_1000005944 427
366 3300048921 Ga0496118_0000335 Ga0496118_0000335_65703_67115 427
367 3300011119 Ga0105246_10041602 Ga0105246_100416022 428
368 3300047472 Ga0495686_0021172 Ga0495686_0021172_2645_4069 428
369 3300048926 Ga0496123_0002155 Ga0496123_0002155_8604_10022 430
370 3300046530 Ga0495654_0001253 Ga0495654_0001253_6509_7933 431
371 3300048905 Ga0496102_0047576 Ga0496102_0047576_1859_3286 431
372 3300053158 Ga0500627_0000275 Ga0500627_0000275_7513_8937 431
373 3300001976 JGI24752J21851_1000008 JGI24752J21851_100000812 434
374 3300001979 JGI24740J21852_10002881 JGI24740J21852_100028816 434
375 3300001989 JGI24739J22299_10008009 JGI24739J22299_100080093 434
376 3300002067 JGI24735J21928_10001909 JGI24735J21928_100019096 434
377 3300002074 JGI24748J21848_1000140 JGI24748J21848_10001403 434
378 3300002239 JGI24034J26672_10000024 JGI24034J26672_1000002420 434
379 3300005330 Ga0070690_100000016 Ga0070690_10000001635 434
380 3300005331 Ga0070670_100024378 Ga0070670_1000243784 434
381 3300005335 Ga0070666_10000011 Ga0070666_1000001138 434
382 3300005340 Ga0070689_100090408 Ga0070689_1000904082 434
383 3300005344 Ga0070661_100104790 Ga0070661_1001047902 434
384 3300005353 Ga0070669_100000009 Ga0070669_10000000975 434
385 3300005355 Ga0070671_100035202 Ga0070671_1000352021 434
386 3300005365 Ga0070688_100014762 Ga0070688_1000147623 434
387 3300005366 Ga0070659_100011408 Ga0070659_1000114085 434
388 3300005455 Ga0070663_100074740 Ga0070663_1000747403 434
389 3300005466 Ga0070685_10000186 Ga0070685_1000018613 434
390 3300005544 Ga0070686_100000001 Ga0070686_100000001481 434
391 3300005548 Ga0070665_100000004 Ga0070665_100000004216 434
392 3300005577 Ga0068857_100008971 Ga0068857_1000089716 434
393 3300005577 Ga0068857_100188269 Ga0068857_1001882692 434
394 3300005616 Ga0068852_100134852 Ga0068852_1001348521 434
395 3300005617 Ga0068859_100005061 Ga0068859_1000050613 434
396 3300005719 Ga0068861_100012312 Ga0068861_1000123128 434
397 3300005841 Ga0068863_100000010 Ga0068863_100000010105 434
398 3300005842 Ga0068858_100000360 Ga0068858_10000036031 434
399 3300005843 Ga0068860_100000030 Ga0068860_100000030221 434
400 3300005844 Ga0068862_100023858 Ga0068862_1000238584 434
401 3300006931 Ga0097620_100005061 Ga0097620_10000506120 434
402 3300009011 Ga0105251_10058264 Ga0105251_100582642 434
403 3300009553 Ga0105249_10000016 Ga0105249_10000016222 434
404 3300013100 Ga0157373_10099842 Ga0157373_100998421 434
405 3300013104 Ga0157370_10032073 Ga0157370_100320736 434
406 3300013306 Ga0163162_10057426 Ga0163162_100574263 434
407 3300013307 Ga0157372_10036698 Ga0157372_100366983 434
408 3300014326 Ga0157380_10001265 Ga0157380_1000126521 434
409 3300017792 Ga0163161_10000044 Ga0163161_1000004470 434
410 3300025321 Ga0207656_10010388 Ga0207656_100103882 434
411 3300025903 Ga0207680_10000008 Ga0207680_10000008474 434
412 3300025904 Ga0207647_10000283 Ga0207647_1000028320 434
413 3300025904 Ga0207647_10073173 Ga0207647_100731732 434
414 3300025909 Ga0207705_10041994 Ga0207705_100419942 434
415 3300025911 Ga0207654_10000709 Ga0207654_100007098 434
416 3300025913 Ga0207695_10009470 Ga0207695_100094706 434
417 3300025914 Ga0207671_10001568 Ga0207671_1000156813 434
418 3300025923 Ga0207681_10000020 Ga0207681_1000002059 434
419 3300025925 Ga0207650_10018726 Ga0207650_100187266 434
420 3300025931 Ga0207644_10003251 Ga0207644_100032512 434
421 3300025932 Ga0207690_10058016 Ga0207690_100580162 434
422 3300025933 Ga0207706_10002278 Ga0207706_1000227812 434
423 3300025933 Ga0207706_10062733 Ga0207706_100627333 434
424 3300025949 Ga0207667_10048055 Ga0207667_100480552 434
425 3300025961 Ga0207712_10000009 Ga0207712_10000009474 434
426 3300025981 Ga0207640_10017769 Ga0207640_100177694 434
427 3300025986 Ga0207658_10000305 Ga0207658_100003054 434
428 3300026041 Ga0207639_10002722 Ga0207639_100027225 434
429 3300026067 Ga0207678_10010321 Ga0207678_100103214 434
430 3300026078 Ga0207702_10001125 Ga0207702_1000112518 434
431 3300026088 Ga0207641_10000171 Ga0207641_1000017119 434
432 3300026095 Ga0207676_10001337 Ga0207676_1000133710 434
433 3300026116 Ga0207674_10007324 Ga0207674_1000732412 434
434 3300026116 Ga0207674_10052916 Ga0207674_100529162 434
435 3300026118 Ga0207675_100003112 Ga0207675_1000031123 434
436 3300026142 Ga0207698_10024421 Ga0207698_100244212 434
437 3300028379 Ga0268266_10000009 Ga0268266_10000009573 434
438 3300028380 Ga0268265_10000785 Ga0268265_1000078517 434
439 3300028381 Ga0268264_10000003 Ga0268264_100000031096 434
440 3300048905 Ga0496102_0051328 Ga0496102_0051328_162_1580 434
441 3300048907 Ga0496104_0045437 Ga0496104_0045437_2234_3652 434
442 3300048910 Ga0496107_0068561 Ga0496107_0068561_447_1865 434
443 3300048919 Ga0496116_0034879 Ga0496116_0034879_1860_3278 434
444 3300048921 Ga0496118_0015929 Ga0496118_0015929_4449_5867 434
445 3300048927 Ga0496124_0035156 Ga0496124_0035156_2740_4158 434

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01769

MgtE

Divalent cation transporter

381

504

0.97

PF00571

CBS

CBS domain

262

318

0.93

Feature Viewer

pLDDT pTM Quality
74.83 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map