F445503

General Info

Members Datasets Scaffolds Average Seq Length
445 246 890 204

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10000016|Ga0157378_1000001685
Length 245
Sequence MCTMRAPAAGAEMPEVTLLRSRQFPLSCATPSTTTARMEGLSSNLVIIGITAVVSMLAFGNVALLQRLILWPPAVSRDRQYYRLVTYGLIHADPSHLIFNMLTLYFFGSTMERFYVLRLGEWGYPLFYLGGLVVSILPSYLDNRNNAEYRSLGASGAVSAALFASILLQPWTTLLVFYALPIPAILYAVLYVAYSIYMDRRGGTNVNHSAHLWGAAYGVAVTAMVEPATLSRFLAALAHPSFHIR

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
139 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
140 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
141 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
142 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
143 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
169 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
170 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
171 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
172 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
173 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
195 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
223 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
224 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
225 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
226 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
227 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
230 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
231 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
232 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
233 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
234 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
235 2734482264 Dyella sp. AD052 Isolate Unclassified
236 2738543009 Luteibacter sp. OK325 Isolate Unclassified
237 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
238 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
239 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
240 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
241 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
242 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
243 2919085039 Luteibacter sp. 1214 Isolate Unclassified
244 2919404418 Luteibacter sp. 3190 Isolate Unclassified
245 2941471342 Luteibacter sp. 621 Isolate Unclassified
246 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.96
Metatranscriptomes 0
Isolates 4.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.74
Nodule 0
Rhizoplane 3.15
Rhizosphere 77.08
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10000016 3300013297 Bacteria 142649
2 JGI24740J21852_10057032 3300001979 Bacteria 1092
3 JGI24739J22299_10000112 3300001989 Bacteria 25198
4 JGI24737J22298_10065515 3300001990 Bacteria 1089
5 JGI24735J21928_10014873 3300002067 Bacteria 2435
6 JGI24738J21930_10003653 3300002075 Bacteria 3854
7 JGI25162J39368_1001541 3300002737 Bacteria 11869
8 JGI25162J39368_1008138 3300002737 Bacteria 1537
9 JGI25157J39369_1001675 3300002741 Bacteria 7530
10 JGI25164J39214_1000704 3300002772 Bacteria 12938
11 JGI25152J39213_1016482 3300002773 Bacteria 1424
12 JGI25165J46597_1006721 3300003214 Bacteria 2006
13 JGI25153J46596_10010874 3300003215 Bacteria 4074
14 JGI25153J46596_10055792 3300003215 Bacteria 1103
15 rootH1_10104321 3300003316 Bacteria 4144
16 rootH2_10000174 3300003320 Bacteria 21671
17 rootH2_10098021 3300003320 Bacteria 1995
18 Ga0065165_1000096 3300005262 Bacteria 144938
19 Ga0070658_10252467 3300005327 Bacteria 1496
20 Ga0070676_10309115 3300005328 Bacteria 1074
21 Ga0070676_10356782 3300005328 Bacteria 1006
22 Ga0070690_100164715 3300005330 Bacteria 1522
23 Ga0070666_10169821 3300005335 Bacteria 1527
24 Ga0068868_100297905 3300005338 Bacteria 1369
25 Ga0068868_100373295 3300005338 Bacteria 1226
26 Ga0070661_100051558 3300005344 Bacteria 3012
27 Ga0070661_100103054 3300005344 Bacteria 2125
28 Ga0070661_100309027 3300005344 Bacteria 1232
29 Ga0070661_100525933 3300005344 Bacteria 949
30 Ga0070668_100006284 3300005347 Bacteria 8792
31 Ga0070668_100392075 3300005347 Unclassified 1184
32 Ga0070671_101079764 3300005355 Bacteria 704
33 Ga0070673_100036540 3300005364 Bacteria 3734
34 Ga0070659_100003331 3300005366 Bacteria 11431
35 Ga0070709_10063861 3300005434 Bacteria 2353
36 Ga0070714_100000148 3300005435 Bacteria 55926
37 Ga0070714_100047584 3300005435 Bacteria 3645
38 Ga0070711_100035980 3300005439 Bacteria 3315
39 Ga0070663_100062106 3300005455 Bacteria 2692
40 Ga0070678_100013341 3300005456 Bacteria 5147
41 Ga0070678_100070892 3300005456 Bacteria 2607
42 Ga0070662_100145102 3300005457 Bacteria 1843
43 Ga0070662_100476198 3300005457 Bacteria 1039
44 Ga0070681_10016767 3300005458 Bacteria 7313
45 Ga0070684_100756553 3300005535 Bacteria 907
46 Ga0068853_100001246 3300005539 Bacteria 18189
47 Ga0068853_100018600 3300005539 Bacteria 5753
48 Ga0068853_100383848 3300005539 Bacteria 1312
49 Ga0070672_100035349 3300005543 Bacteria 3798
50 Ga0070672_100272875 3300005543 Bacteria 1428
51 Ga0070693_100057198 3300005547 Bacteria 2254
52 Ga0070665_100392396 3300005548 Bacteria 1396
53 Ga0068855_100005870 3300005563 Bacteria 14986
54 Ga0068855_100009108 3300005563 Bacteria 11992
55 Ga0068855_100077123 3300005563 Bacteria 3866
56 Ga0068855_100551363 3300005563 Bacteria 1248
57 Ga0068857_100000319 3300005577 Bacteria 33193
58 Ga0068857_100069500 3300005577 Bacteria 3136
59 Ga0068857_100312397 3300005577 Bacteria 1450
60 Ga0068854_100001263 3300005578 Bacteria 15187
61 Ga0068854_100028611 3300005578 Bacteria 3852
62 Ga0068854_100308186 3300005578 Bacteria 1283
63 Ga0068856_100012574 3300005614 Bacteria 8193
64 Ga0068856_100129021 3300005614 Bacteria 2533
65 Ga0068856_100618690 3300005614 Unclassified 1104
66 Ga0068852_100303657 3300005616 Bacteria 1546
67 Ga0068859_100401916 3300005617 Bacteria 1466
68 Ga0068866_10489470 3300005718 Bacteria 812
69 Ga0068861_100673928 3300005719 Bacteria 958
70 Ga0068851_10013091 3300005834 Bacteria 3924
71 Ga0068851_10020936 3300005834 Bacteria 3172
72 Ga0068870_10012318 3300005840 Bacteria 3994
73 Ga0068863_100049063 3300005841 Bacteria 4003
74 Ga0068863_100051873 3300005841 Bacteria 3887
75 Ga0068863_100091384 3300005841 Bacteria 2887
76 Ga0081540_1005683 3300005983 Bacteria 9266
77 Ga0070716_100562221 3300006173 Bacteria 852
78 Ga0075369_10041684 3300006186 Bacteria 1966
79 Ga0075369_10076591 3300006186 Bacteria 1479
80 Ga0097621_100023978 3300006237 Bacteria 4757
81 Ga0097621_100126849 3300006237 Bacteria 2168
82 Ga0097621_100136493 3300006237 Bacteria 2092
83 Ga0097621_100373315 3300006237 Bacteria 1273
84 Ga0068871_100009728 3300006358 Bacteria 6979
85 Ga0068871_100049160 3300006358 Bacteria 3408
86 Ga0068871_100147971 3300006358 Bacteria 2001
87 Ga0068871_100606998 3300006358 Bacteria 995
88 Ga0075434_100148489 3300006871 Bacteria 2364
89 Ga0068865_100004567 3300006881 Bacteria 8356
90 Ga0097620_100401924 3300006931 Bacteria 1466
91 Ga0105240_10000254 3300009093 Bacteria 106067
92 Ga0105240_10002163 3300009093 Bacteria 32091
93 Ga0105240_10014975 3300009093 Bacteria 10566
94 Ga0105240_10037564 3300009093 Bacteria 6223
95 Ga0105247_10046289 3300009101 Bacteria 2670
96 Ga0105241_10013447 3300009174 Bacteria 5999
97 Ga0105241_10090270 3300009174 Bacteria 2416
98 Ga0105242_10000838 3300009176 Bacteria 23946
99 Ga0105248_10126378 3300009177 Bacteria 2884
100 Ga0105248_10745030 3300009177 Bacteria 1105
101 Ga0105237_10000307 3300009545 Bacteria 68076
102 Ga0105237_10075656 3300009545 Bacteria 3358
103 Ga0105237_10126445 3300009545 Bacteria 2551
104 Ga0105238_10003052 3300009551 Bacteria 16697
105 Ga0105238_10018809 3300009551 Bacteria 7032
106 Ga0105238_10259920 3300009551 Bacteria 1716
107 Ga0105249_10115752 3300009553 Bacteria 2541
108 Ga0105239_10000020 3300010375 Bacteria 264435
109 Ga0105239_10011929 3300010375 Bacteria 9691
110 Ga0105239_10017512 3300010375 Bacteria 7924
111 Ga0105239_10300660 3300010375 Bacteria 1807
112 Ga0157339_1002026 3300012505 Bacteria 1325
113 Ga0157373_10077383 3300013100 Bacteria 2347
114 Ga0157373_10080848 3300013100 Bacteria 2292
115 Ga0157371_10035591 3300013102 Bacteria 3568
116 Ga0157370_10000371 3300013104 Bacteria 56531
117 Ga0157370_10023320 3300013104 Bacteria 6145
118 Ga0157370_10054162 3300013104 Bacteria 3824
119 Ga0157370_10148848 3300013104 Bacteria 2179
120 Ga0157369_10000172 3300013105 Bacteria 90979
121 Ga0157369_10001880 3300013105 Bacteria 25312
122 Ga0157369_10240912 3300013105 Bacteria 1889
123 Ga0157369_10353392 3300013105 Bacteria 1526
124 Ga0157374_10141927 3300013296 Bacteria 2332
125 Ga0157378_10010549 3300013297 Bacteria 8074
126 Ga0157378_10096616 3300013297 Bacteria 2692
127 Ga0157378_10293903 3300013297 Bacteria 1570
128 Ga0163162_10030144 3300013306 Bacteria 5374
129 Ga0163162_10060053 3300013306 Bacteria 3835
130 Ga0163162_10079311 3300013306 Bacteria 3349
131 Ga0163162_10296007 3300013306 Bacteria 1750
132 Ga0163162_10407229 3300013306 Bacteria 1493
133 Ga0157375_10002308 3300013308 Bacteria 16484
134 Ga0157375_10016058 3300013308 Bacteria 6717
135 Ga0157375_10858513 3300013308 Bacteria 1054
136 Ga0157375_10887539 3300013308 Bacteria 1036
137 Ga0182008_10009764 3300014497 Bacteria 5164
138 Ga0182008_10012102 3300014497 Bacteria 4564
139 Ga0182008_10026060 3300014497 Bacteria 2966
140 Ga0157379_10134751 3300014968 Bacteria 2225
141 Ga0157376_10001282 3300014969 Bacteria 16537
142 Ga0157376_10003161 3300014969 Bacteria 11314
143 Ga0157376_10004551 3300014969 Bacteria 9654
144 Ga0157376_10153322 3300014969 Bacteria 2080
145 Ga0157376_10167884 3300014969 Bacteria 1995
146 Ga0182006_1000293 3300015261 Bacteria 44075
147 Ga0182006_1000492 3300015261 Bacteria 30798
148 Ga0182007_10009655 3300015262 Bacteria 3871
149 Ga0182007_10010487 3300015262 Bacteria 3656
150 Ga0182007_10062843 3300015262 Bacteria 1217
151 Ga0182005_1000079 3300015265 Bacteria 76726
152 Ga0182005_1001099 3300015265 Bacteria 11313
153 Ga0182005_1014243 3300015265 Bacteria 2226
154 Ga0182005_1025025 3300015265 Bacteria 1629
155 Ga0183369_1006 3300015685 Bacteria 449058
156 Ga0163161_10126466 3300017792 Bacteria 1925
157 Ga0209674_102042 3300025226 Bacteria 4633
158 Ga0207427_100069 3300025231 Bacteria 161547
159 Ga0209437_100139 3300025233 Bacteria 172506
160 Ga0209437_102085 3300025233 Bacteria 4059
161 Ga0209026_1000145 3300025250 Bacteria 111490
162 Ga0209148_1002183 3300025254 Bacteria 7237
163 Ga0209129_1012882 3300025258 Bacteria 1881
164 Ga0209233_1000083 3300025261 Bacteria 336016
165 Ga0209233_1000191 3300025261 Bacteria 127938
166 Ga0209758_1000276 3300025297 Bacteria 102362
167 Ga0209758_1008138 3300025297 Bacteria 6892
168 Ga0209256_1005639 3300025299 Bacteria 7066
169 Ga0207426_1010114 3300025302 Bacteria 3684
170 Ga0209051_1022640 3300025303 Bacteria 2640
171 Ga0207642_10351602 3300025899 Bacteria 869
172 Ga0207710_10032869 3300025900 Bacteria 2273
173 Ga0207680_10203343 3300025903 Bacteria 1351
174 Ga0207647_10000190 3300025904 Bacteria 49689
175 Ga0207647_10001769 3300025904 Bacteria 16583
176 Ga0207699_10171601 3300025906 Bacteria 1451
177 Ga0207645_10058558 3300025907 Bacteria 2460
178 Ga0207705_10126249 3300025909 Bacteria 1902
179 Ga0207705_10295962 3300025909 Bacteria 1240
180 Ga0207654_10002472 3300025911 Bacteria 9390
181 Ga0207654_10093171 3300025911 Bacteria 1841
182 Ga0207654_10236224 3300025911 Bacteria 1219
183 Ga0207707_10057192 3300025912 Bacteria 3394
184 Ga0207695_10000408 3300025913 Bacteria 95748
185 Ga0207695_10002857 3300025913 Bacteria 25113
186 Ga0207695_10003147 3300025913 Bacteria 23559
187 Ga0207695_10003259 3300025913 Bacteria 23071
188 Ga0207695_10008177 3300025913 Bacteria 13142
189 Ga0207671_10000031 3300025914 Bacteria 247030
190 Ga0207671_10000614 3300025914 Bacteria 47019
191 Ga0207671_10099062 3300025914 Bacteria 2205
192 Ga0207671_10105840 3300025914 Bacteria 2135
193 Ga0207663_10035848 3300025916 Bacteria 2980
194 Ga0207657_10068020 3300025919 Bacteria 3027
195 Ga0207652_10493813 3300025921 Bacteria 1102
196 Ga0207694_10000389 3300025924 Bacteria 40956
197 Ga0207694_10006399 3300025924 Bacteria 8971
198 Ga0207694_10094443 3300025924 Bacteria 2363
199 Ga0207664_10000472 3300025929 Bacteria 28497
200 Ga0207690_10001265 3300025932 Bacteria 15996
201 Ga0207690_10010204 3300025932 Bacteria 5577
202 Ga0207706_10108220 3300025933 Bacteria 2446
203 Ga0207686_10008831 3300025934 Bacteria 5450
204 Ga0207704_10015042 3300025938 Bacteria 3930
205 Ga0207691_10049210 3300025940 Bacteria 3862
206 Ga0207691_10142443 3300025940 Bacteria 2112
207 Ga0207711_10022885 3300025941 Bacteria 5230
208 Ga0207667_10000082 3300025949 Bacteria 157749
209 Ga0207667_10000313 3300025949 Bacteria 67227
210 Ga0207667_10102103 3300025949 Bacteria 2958
211 Ga0207651_10064686 3300025960 Bacteria 2561
212 Ga0207651_10173050 3300025960 Bacteria 1705
213 Ga0207712_10062934 3300025961 Bacteria 2639
214 Ga0207712_10154327 3300025961 Bacteria 1777
215 Ga0207640_10000018 3300025981 Bacteria 193664
216 Ga0207640_10000667 3300025981 Bacteria 20069
217 Ga0207640_10200847 3300025981 Bacteria 1511
218 Ga0207658_10075811 3300025986 Unclassified 2560
219 Ga0207658_10215419 3300025986 Bacteria 1612
220 Ga0207703_10542408 3300026035 Bacteria 1096
221 Ga0207639_10057260 3300026041 Bacteria 2992
222 Ga0207639_10181368 3300026041 Bacteria 1791
223 Ga0207678_10081039 3300026067 Bacteria 2778
224 Ga0207702_10004051 3300026078 Bacteria 13152
225 Ga0207641_10128356 3300026088 Bacteria 2273
226 Ga0207641_10139087 3300026088 Bacteria 2188
227 Ga0207648_10038668 3300026089 Bacteria 4198
228 Ga0207674_10000397 3300026116 Bacteria 56299
229 Ga0207674_10096697 3300026116 Bacteria 2937
230 Ga0207675_100153343 3300026118 Bacteria 2194
231 Ga0207683_10021929 3300026121 Bacteria 5479
232 Ga0207683_10051976 3300026121 Bacteria 3591
233 Ga0207698_10032143 3300026142 Bacteria 3798
234 Ga0268264_10048325 3300028381 Bacteria 3539
235 Ga0316177_1094683 3300030731 Bacteria 4906
236 Ga0307412_10006301 3300031911 Bacteria 6701
237 Ga0395900_0000439 3300037418 Bacteria 59811
238 Ga0395898_0475219 3300037466 Bacteria 1189
239 Ga0395901_0495578 3300038443 Bacteria 1244
240 Ga0436365_1206858 3300039437 Bacteria 1888
241 Ga0439436_0000090 3300041404 Bacteria 21493
242 Ga0451795_1215900 3300041456 Bacteria 1824
243 Ga0451843_1637993 3300041509 Bacteria 829
244 Ga0439445_0099598 3300042004 Bacteria 823
245 Ga0439462_0062410 3300042015 Bacteria 1009
246 Ga0450908_000619 3300042184 Bacteria 6805
247 Ga0466982_0064056 3300044672 Bacteria 2264
248 Ga0466968_0000200 3300044735 Bacteria 18463
249 Ga0495617_000073 3300046452 Bacteria 80606
250 Ga0495617_000546 3300046452 Bacteria 19492
251 Ga0495638_0000192 3300046460 Bacteria 90034
252 Ga0495650_0026291 3300046471 Bacteria 2710
253 Ga0495650_0032648 3300046471 Bacteria 2326
254 Ga0495582_0050780 3300046473 Bacteria 2286
255 Ga0495585_0000301 3300046492 Bacteria 49423
256 Ga0495585_0004457 3300046492 Bacteria 9079
257 Ga0495607_0000059 3300046501 Bacteria 109443
258 Ga0495607_0000289 3300046501 Bacteria 53401
259 Ga0495607_0009732 3300046501 Bacteria 6489
260 Ga0495583_0038625 3300046506 Bacteria 2255
261 Ga0495606_0000922 3300046507 Bacteria 43414
262 Ga0495606_0001702 3300046507 Bacteria 28412
263 Ga0495606_0055078 3300046507 Bacteria 2573
264 Ga0495610_0004346 3300046512 Bacteria 10523
265 Ga0495610_0010299 3300046512 Bacteria 5821
266 Ga0495616_0000067 3300046513 Bacteria 89610
267 Ga0495616_0015119 3300046513 Bacteria 4295
268 Ga0495620_0000390 3300046515 Bacteria 29651
269 Ga0495620_0002319 3300046515 Bacteria 11028
270 Ga0495631_0000057 3300046518 Bacteria 69190
271 Ga0495631_0001891 3300046518 Bacteria 12340
272 Ga0495631_0060435 3300046518 Bacteria 1644
273 Ga0495632_0000167 3300046519 Bacteria 68027
274 Ga0495632_0016925 3300046519 Bacteria 4040
275 Ga0495637_0020056 3300046520 Bacteria 3079
276 Ga0495643_0049552 3300046522 Bacteria 2265
277 Ga0495648_0003151 3300046524 Bacteria 14672
278 Ga0495648_0053699 3300046524 Bacteria 2439
279 Ga0495609_0002408 3300046538 Bacteria 11511
280 Ga0495645_0164517 3300046543 Bacteria 1531
281 Ga0495668_0018581 3300046616 Bacteria 4017
282 Ga0495611_0000001 3300046648 Bacteria 2628469
283 Ga0495611_0001386 3300046648 Bacteria 12129
284 Ga0495625_0000001 3300046660 Bacteria 1641829
285 Ga0495625_0104241 3300046660 Bacteria 1944
286 Ga0495661_0001187 3300046665 Bacteria 22607
287 Ga0495670_0001834 3300046691 Bacteria 10438
288 Ga0495670_0002399 3300046691 Bacteria 9240
289 Ga0495670_0007765 3300046691 Bacteria 5273
290 Ga0495671_0000075 3300046692 Bacteria 96084
291 Ga0495589_0000106 3300046794 Bacteria 80663
292 Ga0495660_0000205 3300046810 Bacteria 61950
293 Ga0495660_0006700 3300046810 Bacteria 6805
294 Ga0495683_0001866 3300047323 Bacteria 13218
295 Ga0495679_000029 3300047446 Bacteria 190883
296 Ga0495673_0000001 3300047469 Bacteria 1630730
297 Ga0495673_0000018 3300047469 Bacteria 569190
298 Ga0495673_0000578 3300047469 Bacteria 36844
299 Ga0495686_0000555 3300047472 Bacteria 53502
300 Ga0495686_0036214 3300047472 Bacteria 3167
301 Ga0495686_0062242 3300047472 Bacteria 2315
302 Ga0495686_0120701 3300047472 Bacteria 1562
303 Ga0496100_0002003 3300048903 Bacteria 10193
304 Ga0496101_0000993 3300048904 Bacteria 16782
305 Ga0496101_0024146 3300048904 Bacteria 4205
306 Ga0496104_0000038 3300048907 Bacteria 178150
307 Ga0496105_0000038 3300048908 Bacteria 118666
308 Ga0496105_0017452 3300048908 Bacteria 5756
309 Ga0496105_0278610 3300048908 Bacteria 1349
310 Ga0496106_0000525 3300048909 Bacteria 27197
311 Ga0496107_0294316 3300048910 Bacteria 1208
312 Ga0496107_0454793 3300048910 Bacteria 951
313 Ga0496108_0185527 3300048911 Bacteria 1802
314 Ga0496115_0000113 3300048918 Bacteria 74536
315 Ga0496115_0032004 3300048918 Bacteria 4148
316 Ga0496116_0018536 3300048919 Bacteria 5361
317 Ga0496117_0036786 3300048920 Bacteria 3657
318 Ga0496118_0003315 3300048921 Bacteria 20416
319 Ga0496118_0004706 3300048921 Bacteria 15987
320 Ga0496118_0005494 3300048921 Bacteria 14387
321 Ga0496118_0020772 3300048921 Bacteria 5811
322 Ga0496118_0139103 3300048921 Bacteria 1543
323 Ga0496118_0278261 3300048921 Bacteria 933
324 Ga0496119_0000058 3300048922 Bacteria 173131
325 Ga0496119_0027222 3300048922 Bacteria 3936
326 Ga0496120_0000184 3300048923 Bacteria 106643
327 Ga0496120_0000335 3300048923 Bacteria 78595
328 Ga0496121_0000369 3300048924 Bacteria 92541
329 Ga0496121_0000524 3300048924 Bacteria 73122
330 Ga0496121_0001486 3300048924 Bacteria 39523
331 Ga0496121_0001598 3300048924 Bacteria 37640
332 Ga0496121_0022896 3300048924 Bacteria 6038
333 Ga0496121_0042463 3300048924 Bacteria 3955
334 Ga0496121_0097413 3300048924 Bacteria 2279
335 Ga0496121_0245878 3300048924 Bacteria 1243
336 Ga0496122_0008336 3300048925 Bacteria 11212
337 Ga0496122_0063523 3300048925 Bacteria 2693
338 Ga0496123_0011068 3300048926 Bacteria 7874
339 Ga0496123_0251973 3300048926 Bacteria 870
340 Ga0496124_0000565 3300048927 Bacteria 62666
341 Ga0496124_0000571 3300048927 Bacteria 62412
342 Ga0496124_0044551 3300048927 Bacteria 3806
343 Ga0496125_0000499 3300048928 Bacteria 68475
344 Ga0496126_0000226 3300048929 Bacteria 122150
345 Ga0496126_0005474 3300048929 Bacteria 14475
346 Ga0496126_0041957 3300048929 Bacteria 4230
347 Ga0496126_0097336 3300048929 Bacteria 2579
348 Ga0496126_0363740 3300048929 Bacteria 1181
349 Ga0496126_0492031 3300048929 Bacteria 981
350 Ga0495678_000090 3300049459 Bacteria 114550
351 Ga0495682_0001218 3300049460 Bacteria 14595
352 Ga0495682_0011070 3300049460 Bacteria 3475
353 Ga0501031_0009120 3300049568 Bacteria 6453
354 Ga0501031_0085418 3300049568 Bacteria 2057
355 Ga0501031_0756586 3300049568 Bacteria 623
356 Ga0501032_0024172 3300049569 Bacteria 4196
357 Ga0501032_0026380 3300049569 Bacteria 3996
358 Ga0501033_0147807 3300049570 Bacteria 1696
359 Ga0501033_0612044 3300049570 Bacteria 746
360 Ga0501034_0006847 3300049571 Bacteria 12195
361 Ga0501034_0007701 3300049571 Bacteria 11459
362 Ga0501034_0027891 3300049571 Bacteria 5742
363 Ga0501034_0148619 3300049571 Bacteria 2319
364 Ga0501036_0037407 3300049572 Bacteria 4106
365 Ga0501036_0079086 3300049572 Bacteria 2782
366 Ga0501037_0123325 3300049573 Bacteria 1861
367 Ga0501038_0008950 3300049574 Bacteria 9184
368 Ga0501038_0039334 3300049574 Bacteria 4136
369 Ga0501039_0114251 3300049575 Bacteria 2112
370 Ga0501042_0367170 3300049578 Bacteria 1041
371 Ga0501043_0019339 3300049579 Bacteria 5346
372 Ga0501043_0637440 3300049579 Bacteria 784
373 Ga0501046_0086700 3300049580 Bacteria 2413
374 Ga0501046_0215300 3300049580 Bacteria 1424
375 Ga0501046_0264785 3300049580 Bacteria 1262
376 Ga0501047_0008107 3300049581 Bacteria 9912
377 Ga0501047_0010756 3300049581 Bacteria 8650
378 Ga0501047_0026353 3300049581 Bacteria 5593
379 Ga0501047_0081761 3300049581 Bacteria 3105
380 Ga0501048_0023757 3300049582 Bacteria 4476
381 Ga0501067_0006567 3300049583 Bacteria 6447
382 Ga0501068_0024346 3300049584 Bacteria 3554
383 Ga0501069_0002008 3300049585 Bacteria 10187
384 Ga0501069_0008934 3300049585 Bacteria 5284
385 Ga0501069_0145457 3300049585 Bacteria 1361
386 Ga0501070_0012584 3300049586 Bacteria 7137
387 Ga0501070_0018951 3300049586 Bacteria 5771
388 Ga0501070_0033046 3300049586 Bacteria 4327
389 Ga0501070_0036209 3300049586 Bacteria 4121
390 Ga0501070_0147538 3300049586 Bacteria 1941
391 Ga0501072_0024514 3300049588 Bacteria 4693
392 Ga0501073_0017525 3300049589 Bacteria 5186
393 Ga0501073_0037380 3300049589 Bacteria 3448
394 Ga0501073_0078499 3300049589 Bacteria 2297
395 Ga0501073_0147353 3300049589 Bacteria 1631
396 Ga0501073_0266836 3300049589 Bacteria 1181
397 Ga0501074_0016023 3300049590 Bacteria 5447
398 Ga0501074_0023367 3300049590 Bacteria 4495
399 Ga0501074_0025942 3300049590 Bacteria 4250
400 Ga0501074_0086312 3300049590 Bacteria 2248
401 Ga0501074_0113522 3300049590 Bacteria 1938
402 Ga0501079_0004845 3300049741 Bacteria 9972
403 Ga0501079_0197729 3300049741 Bacteria 1570
404 Ga0501080_0000970 3300049742 Bacteria 23431
405 Ga0501080_0028566 3300049742 Bacteria 5190
406 Ga0501080_0031300 3300049742 Bacteria 4957
407 Ga0501080_0034697 3300049742 Bacteria 4710
408 Ga0501080_0170651 3300049742 Bacteria 2006
409 Ga0501080_0856206 3300049742 Bacteria 794
410 Ga0501083_0017653 3300049744 Bacteria 4974
411 Ga0501035_0006193 3300049822 Bacteria 11255
412 Ga0501035_0091162 3300049822 Bacteria 2682
413 Ga0501035_0136378 3300049822 Bacteria 2136
414 Ga0501044_0049879 3300049823 Bacteria 4321
415 Ga0501044_0108276 3300049823 Bacteria 2789
416 Ga0501044_0152244 3300049823 Bacteria 2295
417 Ga0501044_0269416 3300049823 Bacteria 1639
418 nmdc:mga0n895_354795_c1 3300050512 Bacteria 1485
419 nmdc:mga0sz30_128493_c1 3300050516 Bacteria 1116
420 nmdc:mga0sz30_40246_c1 3300050516 Bacteria 1964
421 Ga0500643_000002 3300053087 Bacteria 1277657
422 Ga0500566_0080200 3300053094 Bacteria 1818
423 Ga0500555_000664 3300053103 Bacteria 13115
424 Ga0500633_0006432 3300053160 Bacteria 2881
425 Ga0500645_001579 3300053730 Bacteria 11336
426 Ga0501082_0036753 3300060353 Bacteria 4219
427 Ga0501082_0107814 3300060353 Bacteria 2410
428 2538833122 2537561836 Bacteria 3910579
429 2595446011 2593339238 Bacteria 4182970
430 2595452051 2593339239 Bacteria 4124669
431 2643831592 2643221562 Bacteria 4048635
432 2687583437 2687453130 Bacteria 4227172
433 2721026951 2718218334 Bacteria 4765486
434 2735837500 2734482264 Unclassified 5014763
435 2739226932 2738543009 Bacteria 4944499
436 2819565301 2818991440 Bacteria 4774720
437 2842917477 2842914999 Bacteria 4419378
438 2842919411 2842918807 Bacteria 4289178
439 2884341096 2884338543 Bacteria 4610696
440 2895397012 2895395659 Bacteria 3983269
441 2904466971 2904463128 Bacteria 4775606
442 2919085041 2919085039 Bacteria 4532964
443 2919405792 2919404418 Bacteria 4232372
444 2941471821 2941471342 Bacteria 5018624
445 2953998121 2953994433 Bacteria 4303959
446 Ga0157378_10000016
447 JGI24740J21852_10057032
448 JGI24739J22299_10000112
449 JGI24737J22298_10065515
450 JGI24735J21928_10014873
451 JGI24738J21930_10003653
452 JGI25162J39368_1001541
453 JGI25162J39368_1008138
454 JGI25157J39369_1001675
455 JGI25164J39214_1000704
456 JGI25152J39213_1016482
457 JGI25165J46597_1006721
458 JGI25153J46596_10010874
459 JGI25153J46596_10055792
460 rootH1_10104321
461 rootH2_10000174
462 rootH2_10098021
463 Ga0065165_1000096
464 Ga0070658_10252467
465 Ga0070676_10309115
466 Ga0070676_10356782
467 Ga0070690_100164715
468 Ga0070666_10169821
469 Ga0068868_100297905
470 Ga0068868_100373295
471 Ga0070661_100051558
472 Ga0070661_100103054
473 Ga0070661_100309027
474 Ga0070661_100525933
475 Ga0070668_100006284
476 Ga0070668_100392075
477 Ga0070671_101079764
478 Ga0070673_100036540
479 Ga0070659_100003331
480 Ga0070709_10063861
481 Ga0070714_100000148
482 Ga0070714_100047584
483 Ga0070711_100035980
484 Ga0070663_100062106
485 Ga0070678_100013341
486 Ga0070678_100070892
487 Ga0070662_100145102
488 Ga0070662_100476198
489 Ga0070681_10016767
490 Ga0070684_100756553
491 Ga0068853_100001246
492 Ga0068853_100018600
493 Ga0068853_100383848
494 Ga0070672_100035349
495 Ga0070672_100272875
496 Ga0070693_100057198
497 Ga0070665_100392396
498 Ga0068855_100005870
499 Ga0068855_100009108
500 Ga0068855_100077123
501 Ga0068855_100551363
502 Ga0068857_100000319
503 Ga0068857_100069500
504 Ga0068857_100312397
505 Ga0068854_100001263
506 Ga0068854_100028611
507 Ga0068854_100308186
508 Ga0068856_100012574
509 Ga0068856_100129021
510 Ga0068856_100618690
511 Ga0068852_100303657
512 Ga0068859_100401916
513 Ga0068866_10489470
514 Ga0068861_100673928
515 Ga0068851_10013091
516 Ga0068851_10020936
517 Ga0068870_10012318
518 Ga0068863_100049063
519 Ga0068863_100051873
520 Ga0068863_100091384
521 Ga0081540_1005683
522 Ga0070716_100562221
523 Ga0075369_10041684
524 Ga0075369_10076591
525 Ga0097621_100023978
526 Ga0097621_100126849
527 Ga0097621_100136493
528 Ga0097621_100373315
529 Ga0068871_100009728
530 Ga0068871_100049160
531 Ga0068871_100147971
532 Ga0068871_100606998
533 Ga0075434_100148489
534 Ga0068865_100004567
535 Ga0097620_100401924
536 Ga0105240_10000254
537 Ga0105240_10002163
538 Ga0105240_10014975
539 Ga0105240_10037564
540 Ga0105247_10046289
541 Ga0105241_10013447
542 Ga0105241_10090270
543 Ga0105242_10000838
544 Ga0105248_10126378
545 Ga0105248_10745030
546 Ga0105237_10000307
547 Ga0105237_10075656
548 Ga0105237_10126445
549 Ga0105238_10003052
550 Ga0105238_10018809
551 Ga0105238_10259920
552 Ga0105249_10115752
553 Ga0105239_10000020
554 Ga0105239_10011929
555 Ga0105239_10017512
556 Ga0105239_10300660
557 Ga0157339_1002026
558 Ga0157373_10077383
559 Ga0157373_10080848
560 Ga0157371_10035591
561 Ga0157370_10000371
562 Ga0157370_10023320
563 Ga0157370_10054162
564 Ga0157370_10148848
565 Ga0157369_10000172
566 Ga0157369_10001880
567 Ga0157369_10240912
568 Ga0157369_10353392
569 Ga0157374_10141927
570 Ga0157378_10010549
571 Ga0157378_10096616
572 Ga0157378_10293903
573 Ga0163162_10030144
574 Ga0163162_10060053
575 Ga0163162_10079311
576 Ga0163162_10296007
577 Ga0163162_10407229
578 Ga0157375_10002308
579 Ga0157375_10016058
580 Ga0157375_10858513
581 Ga0157375_10887539
582 Ga0182008_10009764
583 Ga0182008_10012102
584 Ga0182008_10026060
585 Ga0157379_10134751
586 Ga0157376_10001282
587 Ga0157376_10003161
588 Ga0157376_10004551
589 Ga0157376_10153322
590 Ga0157376_10167884
591 Ga0182006_1000293
592 Ga0182006_1000492
593 Ga0182007_10009655
594 Ga0182007_10010487
595 Ga0182007_10062843
596 Ga0182005_1000079
597 Ga0182005_1001099
598 Ga0182005_1014243
599 Ga0182005_1025025
600 Ga0183369_1006
601 Ga0163161_10126466
602 Ga0209674_102042
603 Ga0207427_100069
604 Ga0209437_100139
605 Ga0209437_102085
606 Ga0209026_1000145
607 Ga0209148_1002183
608 Ga0209129_1012882
609 Ga0209233_1000083
610 Ga0209233_1000191
611 Ga0209758_1000276
612 Ga0209758_1008138
613 Ga0209256_1005639
614 Ga0207426_1010114
615 Ga0209051_1022640
616 Ga0207642_10351602
617 Ga0207710_10032869
618 Ga0207680_10203343
619 Ga0207647_10000190
620 Ga0207647_10001769
621 Ga0207699_10171601
622 Ga0207645_10058558
623 Ga0207705_10126249
624 Ga0207705_10295962
625 Ga0207654_10002472
626 Ga0207654_10093171
627 Ga0207654_10236224
628 Ga0207707_10057192
629 Ga0207695_10000408
630 Ga0207695_10002857
631 Ga0207695_10003147
632 Ga0207695_10003259
633 Ga0207695_10008177
634 Ga0207671_10000031
635 Ga0207671_10000614
636 Ga0207671_10099062
637 Ga0207671_10105840
638 Ga0207663_10035848
639 Ga0207657_10068020
640 Ga0207652_10493813
641 Ga0207694_10000389
642 Ga0207694_10006399
643 Ga0207694_10094443
644 Ga0207664_10000472
645 Ga0207690_10001265
646 Ga0207690_10010204
647 Ga0207706_10108220
648 Ga0207686_10008831
649 Ga0207704_10015042
650 Ga0207691_10049210
651 Ga0207691_10142443
652 Ga0207711_10022885
653 Ga0207667_10000082
654 Ga0207667_10000313
655 Ga0207667_10102103
656 Ga0207651_10064686
657 Ga0207651_10173050
658 Ga0207712_10062934
659 Ga0207712_10154327
660 Ga0207640_10000018
661 Ga0207640_10000667
662 Ga0207640_10200847
663 Ga0207658_10075811
664 Ga0207658_10215419
665 Ga0207703_10542408
666 Ga0207639_10057260
667 Ga0207639_10181368
668 Ga0207678_10081039
669 Ga0207702_10004051
670 Ga0207641_10128356
671 Ga0207641_10139087
672 Ga0207648_10038668
673 Ga0207674_10000397
674 Ga0207674_10096697
675 Ga0207675_100153343
676 Ga0207683_10021929
677 Ga0207683_10051976
678 Ga0207698_10032143
679 Ga0268264_10048325
680 Ga0316177_1094683
681 Ga0307412_10006301
682 Ga0395900_0000439
683 Ga0395898_0475219
684 Ga0395901_0495578
685 Ga0436365_1206858
686 Ga0439436_0000090
687 Ga0451795_1215900
688 Ga0451843_1637993
689 Ga0439445_0099598
690 Ga0439462_0062410
691 Ga0450908_000619
692 Ga0466982_0064056
693 Ga0466968_0000200
694 Ga0495617_000073
695 Ga0495617_000546
696 Ga0495638_0000192
697 Ga0495650_0026291
698 Ga0495650_0032648
699 Ga0495582_0050780
700 Ga0495585_0000301
701 Ga0495585_0004457
702 Ga0495607_0000059
703 Ga0495607_0000289
704 Ga0495607_0009732
705 Ga0495583_0038625
706 Ga0495606_0000922
707 Ga0495606_0001702
708 Ga0495606_0055078
709 Ga0495610_0004346
710 Ga0495610_0010299
711 Ga0495616_0000067
712 Ga0495616_0015119
713 Ga0495620_0000390
714 Ga0495620_0002319
715 Ga0495631_0000057
716 Ga0495631_0001891
717 Ga0495631_0060435
718 Ga0495632_0000167
719 Ga0495632_0016925
720 Ga0495637_0020056
721 Ga0495643_0049552
722 Ga0495648_0003151
723 Ga0495648_0053699
724 Ga0495609_0002408
725 Ga0495645_0164517
726 Ga0495668_0018581
727 Ga0495611_0000001
728 Ga0495611_0001386
729 Ga0495625_0000001
730 Ga0495625_0104241
731 Ga0495661_0001187
732 Ga0495670_0001834
733 Ga0495670_0002399
734 Ga0495670_0007765
735 Ga0495671_0000075
736 Ga0495589_0000106
737 Ga0495660_0000205
738 Ga0495660_0006700
739 Ga0495683_0001866
740 Ga0495679_000029
741 Ga0495673_0000001
742 Ga0495673_0000018
743 Ga0495673_0000578
744 Ga0495686_0000555
745 Ga0495686_0036214
746 Ga0495686_0062242
747 Ga0495686_0120701
748 Ga0496100_0002003
749 Ga0496101_0000993
750 Ga0496101_0024146
751 Ga0496104_0000038
752 Ga0496105_0000038
753 Ga0496105_0017452
754 Ga0496105_0278610
755 Ga0496106_0000525
756 Ga0496107_0294316
757 Ga0496107_0454793
758 Ga0496108_0185527
759 Ga0496115_0000113
760 Ga0496115_0032004
761 Ga0496116_0018536
762 Ga0496117_0036786
763 Ga0496118_0003315
764 Ga0496118_0004706
765 Ga0496118_0005494
766 Ga0496118_0020772
767 Ga0496118_0139103
768 Ga0496118_0278261
769 Ga0496119_0000058
770 Ga0496119_0027222
771 Ga0496120_0000184
772 Ga0496120_0000335
773 Ga0496121_0000369
774 Ga0496121_0000524
775 Ga0496121_0001486
776 Ga0496121_0001598
777 Ga0496121_0022896
778 Ga0496121_0042463
779 Ga0496121_0097413
780 Ga0496121_0245878
781 Ga0496122_0008336
782 Ga0496122_0063523
783 Ga0496123_0011068
784 Ga0496123_0251973
785 Ga0496124_0000565
786 Ga0496124_0000571
787 Ga0496124_0044551
788 Ga0496125_0000499
789 Ga0496126_0000226
790 Ga0496126_0005474
791 Ga0496126_0041957
792 Ga0496126_0097336
793 Ga0496126_0363740
794 Ga0496126_0492031
795 Ga0495678_000090
796 Ga0495682_0001218
797 Ga0495682_0011070
798 Ga0501031_0009120
799 Ga0501031_0085418
800 Ga0501031_0756586
801 Ga0501032_0024172
802 Ga0501032_0026380
803 Ga0501033_0147807
804 Ga0501033_0612044
805 Ga0501034_0006847
806 Ga0501034_0007701
807 Ga0501034_0027891
808 Ga0501034_0148619
809 Ga0501036_0037407
810 Ga0501036_0079086
811 Ga0501037_0123325
812 Ga0501038_0008950
813 Ga0501038_0039334
814 Ga0501039_0114251
815 Ga0501042_0367170
816 Ga0501043_0019339
817 Ga0501043_0637440
818 Ga0501046_0086700
819 Ga0501046_0215300
820 Ga0501046_0264785
821 Ga0501047_0008107
822 Ga0501047_0010756
823 Ga0501047_0026353
824 Ga0501047_0081761
825 Ga0501048_0023757
826 Ga0501067_0006567
827 Ga0501068_0024346
828 Ga0501069_0002008
829 Ga0501069_0008934
830 Ga0501069_0145457
831 Ga0501070_0012584
832 Ga0501070_0018951
833 Ga0501070_0033046
834 Ga0501070_0036209
835 Ga0501070_0147538
836 Ga0501072_0024514
837 Ga0501073_0017525
838 Ga0501073_0037380
839 Ga0501073_0078499
840 Ga0501073_0147353
841 Ga0501073_0266836
842 Ga0501074_0016023
843 Ga0501074_0023367
844 Ga0501074_0025942
845 Ga0501074_0086312
846 Ga0501074_0113522
847 Ga0501079_0004845
848 Ga0501079_0197729
849 Ga0501080_0000970
850 Ga0501080_0028566
851 Ga0501080_0031300
852 Ga0501080_0034697
853 Ga0501080_0170651
854 Ga0501080_0856206
855 Ga0501083_0017653
856 Ga0501035_0006193
857 Ga0501035_0091162
858 Ga0501035_0136378
859 Ga0501044_0049879
860 Ga0501044_0108276
861 Ga0501044_0152244
862 Ga0501044_0269416
863 nmdc:mga0n895_354795_c1
864 nmdc:mga0sz30_128493_c1
865 nmdc:mga0sz30_40246_c1
866 Ga0500643_000002
867 Ga0500566_0080200
868 Ga0500555_000664
869 Ga0500633_0006432
870 Ga0500645_001579
871 Ga0501082_0036753
872 Ga0501082_0107814
873 2538833122
874 2595446011
875 2595452051
876 2643831592
877 2687583437
878 2721026951
879 2735837500
880 2739226932
881 2819565301
882 2842917477
883 2842919411
884 2884341096
885 2895397012
886 2904466971
887 2919085041
888 2919405792
889 2941471821
890 2953998121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01694

Rhomboid

Rhomboid family

78

227

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pj5-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.769 1 183
5f5d-assembly1.cif.gz_A crystal structures and inhibition kinetics reveal a two-state catalytic mechanism with drug design implications for rhomboid proteolysis 0.7462 4 183
3zot-assembly1.cif.gz_A structure of e.coli rhomboid protease glpg in complex with monobactam l29 (data set 2) 0.743 3 183
6pjp-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.74 3 183
2irv-assembly1.cif.gz_A crystal structure of glpg, a rhomboid intramembrane serine protease 0.7389 3 183
ID Description Score Start End Superfamily
af_Q8I3V7_262_478_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8919 34 181 1.20.1540.10
af_I1JZG9_137_329_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8609 4 181 1.20.1540.10
af_Q9Y7Y0_16_191_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8491 3 183 1.20.1540.10
af_O53632_31_206_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8436 2 184 1.20.1540.10
af_Q9Y7Y0_16_191_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8275 3 183 1.20.1540.10
ID Description Score Start End GO Terms
AF-A0A561H3H5-F1-model_v4 deleted 0.9798 4 201
AF-A0A7Y1SED8-F1-model_v4 deleted 0.9749 28 199
AF-A0A808FAY8-F1-model_v4 deleted 0.9745 3 200
AF-Z9JG94-F1-model_v4 Membrane protein 0.9728 1 201 GO:0004252
GO:0016020
AF-A0A4R5TJ74-F1-model_v4 Rhomboid family intramembrane serine protease 0.9726 2 201 GO:0004252
GO:0006508
GO:0016020

Map