F445502

General Info

Members Datasets Scaffolds Average Seq Length
445 200 890 170

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10232619|Ga0157374_102326192
Length 185
Sequence MSLCYSAASEECTELTMPDAPDIPRPSQLWKRLSAERKLLAADAFWQDENAAAEQAEAVVMIAQRIKFRVRSVQTLAREKKSRHLVNLGSVSEMVAARLLVAYHLHHQRAMMAAFLDALGIAHDNGLIADEELKAPSADRLRDAARAIGAAYPAEDVALYLATLMWQDPETWAGLTELPELAQHA

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
163 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
175 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
176 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
188 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.45
Rhizosphere 99.55
Stem 0
Stem Tuber 0
Unclassified 5.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10232619 3300013296 Bacteria 1811
2 MBSR1b_contig_7035149 2162886012 Bacteria 903
3 JGI24746J21847_1000693 3300001977 Bacteria 5169
4 JGI24033J26618_1002985 3300002155 Bacteria 1766
5 Ga0065712_10011901 3300005290 Bacteria 3269
6 Ga0065712_10194425 3300005290 Bacteria 1134
7 Ga0065715_10106514 3300005293 Bacteria 2812
8 Ga0065707_10094176 3300005295 Bacteria 3529
9 Ga0070676_10006083 3300005328 Bacteria 6442
10 Ga0070676_10067528 3300005328 Bacteria 2138
11 Ga0070676_10250029 3300005328 Bacteria 1183
12 Ga0070676_10362522 3300005328 Unclassified 999
13 Ga0070690_100128791 3300005330 Bacteria 1707
14 Ga0070690_100598065 3300005330 Bacteria 837
15 Ga0070670_100001257 3300005331 Bacteria 20188
16 Ga0070670_100022864 3300005331 Bacteria 5380
17 Ga0070670_100053100 3300005331 Bacteria 3480
18 Ga0070670_100966311 3300005331 Unclassified 774
19 Ga0070677_10015211 3300005333 Bacteria 2723
20 Ga0070677_10028966 3300005333 Bacteria 2096
21 Ga0070677_10032824 3300005333 Bacteria 1995
22 Ga0068869_100012842 3300005334 Bacteria 5544
23 Ga0068869_100014179 3300005334 Bacteria 5321
24 Ga0070666_10001736 3300005335 Bacteria 13290
25 Ga0070666_10011237 3300005335 Bacteria 5616
26 Ga0068868_100004581 3300005338 Bacteria 9703
27 Ga0068868_100545719 3300005338 Bacteria 1021
28 Ga0070660_100214767 3300005339 Bacteria 1562
29 Ga0070689_100109452 3300005340 Bacteria 2196
30 Ga0070687_100079347 3300005343 Bacteria 1786
31 Ga0070661_100069592 3300005344 Bacteria 2588
32 Ga0070661_100349083 3300005344 Bacteria 1160
33 Ga0070668_100016357 3300005347 Bacteria 5547
34 Ga0070668_100428361 3300005347 Bacteria 1134
35 Ga0070669_100014927 3300005353 Bacteria 5535
36 Ga0070669_100032570 3300005353 Bacteria 3766
37 Ga0070669_100111824 3300005353 Bacteria 2073
38 Ga0070669_100133221 3300005353 Bacteria 1909
39 Ga0070669_100272010 3300005353 Bacteria 1355
40 Ga0070675_100002921 3300005354 Bacteria 12885
41 Ga0070675_100026216 3300005354 Bacteria 4676
42 Ga0070675_100215920 3300005354 Bacteria 1669
43 Ga0070675_100252023 3300005354 Bacteria 1545
44 Ga0070671_100070690 3300005355 Bacteria 2912
45 Ga0070674_100000032 3300005356 Bacteria 64311
46 Ga0070674_100317410 3300005356 Bacteria 1248
47 Ga0070673_100011279 3300005364 Bacteria 6094
48 Ga0070673_100159277 3300005364 Bacteria 1918
49 Ga0070673_100242581 3300005364 Bacteria 1567
50 Ga0070673_101834115 3300005364 Unclassified 575
51 Ga0070688_100004862 3300005365 Bacteria 7028
52 Ga0070688_100160971 3300005365 Bacteria 1542
53 Ga0070688_100201352 3300005365 Bacteria 1393
54 Ga0070659_100097980 3300005366 Bacteria 2357
55 Ga0070659_100190841 3300005366 Bacteria 1684
56 Ga0070659_100368435 3300005366 Bacteria 1208
57 Ga0070667_100005771 3300005367 Bacteria 10334
58 Ga0070667_101025620 3300005367 Bacteria 770
59 Ga0070713_100370355 3300005436 Bacteria 1333
60 Ga0070701_10013819 3300005438 Bacteria 3684
61 Ga0070701_10110757 3300005438 Bacteria 1533
62 Ga0070701_10604098 3300005438 Bacteria 727
63 Ga0070700_100055302 3300005441 Bacteria 2484
64 Ga0070700_100078548 3300005441 Bacteria 2125
65 Ga0070700_100576376 3300005441 Bacteria 878
66 Ga0070694_100418613 3300005444 Bacteria 1052
67 Ga0070694_100487049 3300005444 Bacteria 979
68 Ga0070708_100068859 3300005445 Bacteria 3182
69 Ga0070663_100017123 3300005455 Bacteria 4723
70 Ga0070678_100031871 3300005456 Bacteria 3641
71 Ga0070678_100098130 3300005456 Bacteria 2264
72 Ga0070662_100030484 3300005457 Bacteria 3775
73 Ga0070662_100086229 3300005457 Bacteria 2348
74 Ga0068867_100002741 3300005459 Bacteria 12417
75 Ga0068867_100068939 3300005459 Bacteria 2640
76 Ga0068867_100069053 3300005459 Bacteria 2638
77 Ga0068867_100166806 3300005459 Bacteria 1741
78 Ga0068867_100354509 3300005459 Unclassified 1225
79 Ga0068867_100500610 3300005459 Bacteria 1044
80 Ga0070685_10001085 3300005466 Bacteria 14552
81 Ga0070685_10079263 3300005466 Bacteria 1965
82 Ga0070685_10271373 3300005466 Bacteria 1132
83 Ga0070706_100003379 3300005467 Bacteria 15734
84 Ga0070707_100030534 3300005468 Bacteria 5131
85 Ga0070698_100041266 3300005471 Bacteria 4737
86 Ga0070697_100206851 3300005536 Bacteria 1670
87 Ga0068853_100350767 3300005539 Bacteria 1373
88 Ga0070672_100004171 3300005543 Bacteria 9435
89 Ga0070672_100035995 3300005543 Bacteria 3767
90 Ga0070672_100056778 3300005543 Bacteria 3071
91 Ga0070672_100175563 3300005543 Bacteria 1783
92 Ga0070672_100227844 3300005543 Bacteria 1565
93 Ga0070672_100271460 3300005543 Bacteria 1432
94 Ga0070686_100061356 3300005544 Bacteria 2429
95 Ga0070686_100112653 3300005544 Bacteria 1856
96 Ga0070665_100017696 3300005548 Bacteria 7156
97 Ga0070704_100434669 3300005549 Bacteria 1127
98 Ga0070704_100539313 3300005549 Bacteria 1018
99 Ga0070664_100007165 3300005564 Bacteria 8988
100 Ga0070664_100268023 3300005564 Bacteria 1538
101 Ga0068857_100178940 3300005577 Bacteria 1930
102 Ga0068857_100342156 3300005577 Bacteria 1384
103 Ga0068857_101232419 3300005577 Unclassified 725
104 Ga0068854_100842686 3300005578 Unclassified 802
105 Ga0068856_100010295 3300005614 Bacteria 9090
106 Ga0070702_100093511 3300005615 Bacteria 1828
107 Ga0068852_101497865 3300005616 Bacteria 697
108 Ga0068859_100016203 3300005617 Bacteria 7487
109 Ga0068859_100205677 3300005617 Bacteria 2054
110 Ga0068859_100371464 3300005617 Bacteria 1526
111 Ga0068864_100370161 3300005618 Bacteria 1356
112 Ga0068864_100725090 3300005618 Bacteria 973
113 Ga0068866_10036029 3300005718 Bacteria 2421
114 Ga0068866_10088735 3300005718 Bacteria 1679
115 Ga0068861_100061057 3300005719 Bacteria 2891
116 Ga0068861_100075563 3300005719 Bacteria 2623
117 Ga0068861_100994636 3300005719 Bacteria 800
118 Ga0068851_10007663 3300005834 Bacteria 4966
119 Ga0068870_10000427 3300005840 Bacteria 15916
120 Ga0068870_10052460 3300005840 Bacteria 2162
121 Ga0068870_10145202 3300005840 Bacteria 1392
122 Ga0068870_10200923 3300005840 Bacteria 1208
123 Ga0068863_100097945 3300005841 Bacteria 2785
124 Ga0068863_101900554 3300005841 Unclassified 605
125 Ga0068858_100013400 3300005842 Bacteria 7739
126 Ga0068858_100029531 3300005842 Bacteria 5091
127 Ga0068858_100089572 3300005842 Bacteria 2863
128 Ga0068858_100796180 3300005842 Bacteria 922
129 Ga0068860_100066024 3300005843 Bacteria 3436
130 Ga0068860_100656789 3300005843 Bacteria 1057
131 Ga0068860_101368774 3300005843 Bacteria 729
132 Ga0068862_100004495 3300005844 Bacteria 11758
133 Ga0068862_100151298 3300005844 Bacteria 2066
134 Ga0068862_100475608 3300005844 Bacteria 1182
135 Ga0068862_101146599 3300005844 Unclassified 774
136 Ga0081539_10000750 3300005985 Bacteria 64517
137 Ga0075432_10038343 3300006058 Bacteria 1669
138 Ga0070712_100087513 3300006175 Unclassified 2273
139 Ga0097621_100323377 3300006237 Bacteria 1367
140 Ga0097621_100383868 3300006237 Bacteria 1255
141 Ga0097621_100589807 3300006237 Bacteria 1015
142 Ga0097621_100641548 3300006237 Bacteria 974
143 Ga0068871_100057440 3300006358 Bacteria 3166
144 Ga0068871_100369551 3300006358 Bacteria 1272
145 Ga0075428_100000166 3300006844 Bacteria 60871
146 Ga0075428_100006995 3300006844 Bacteria 12512
147 Ga0075428_100043662 3300006844 Bacteria 4929
148 Ga0075428_100144973 3300006844 Bacteria 2581
149 Ga0075428_100165640 3300006844 Bacteria 2398
150 Ga0075428_100425935 3300006844 Bacteria 1422
151 Ga0075428_100588399 3300006844 Bacteria 1189
152 Ga0075430_100003054 3300006846 Bacteria 13996
153 Ga0075430_100007091 3300006846 Bacteria 9453
154 Ga0075430_100046423 3300006846 Bacteria 3669
155 Ga0075430_100248966 3300006846 Bacteria 1472
156 Ga0075430_100430584 3300006846 Bacteria 1089
157 Ga0075431_100001063 3300006847 Bacteria 24567
158 Ga0075431_100007187 3300006847 Bacteria 11072
159 Ga0075431_100028570 3300006847 Bacteria 5734
160 Ga0075431_100091012 3300006847 Bacteria 3149
161 Ga0075433_10006662 3300006852 Bacteria 9146
162 Ga0075434_100011195 3300006871 Bacteria 8443
163 Ga0075429_100006130 3300006880 Bacteria 10392
164 Ga0075429_100017594 3300006880 Bacteria 6180
165 Ga0075429_100022337 3300006880 Bacteria 5486
166 Ga0075429_100047136 3300006880 Bacteria 3750
167 Ga0075429_100221706 3300006880 Bacteria 1656
168 Ga0075429_100466060 3300006880 Bacteria 1107
169 Ga0068865_100122026 3300006881 Bacteria 1939
170 Ga0068865_100274929 3300006881 Bacteria 1339
171 Ga0068865_100567786 3300006881 Unclassified 955
172 Ga0097620_100016204 3300006931 Bacteria 7487
173 Ga0097620_100205658 3300006931 Bacteria 2054
174 Ga0097620_100371467 3300006931 Bacteria 1526
175 Ga0075435_100056721 3300007076 Bacteria 3167
176 Ga0099794_10015104 3300007265 Bacteria 3401
177 Ga0105240_10006183 3300009093 Bacteria 17642
178 Ga0111539_10002366 3300009094 Bacteria 25064
179 Ga0111539_10006794 3300009094 Bacteria 14720
180 Ga0111539_10116693 3300009094 Bacteria 3130
181 Ga0111539_10181412 3300009094 Bacteria 2459
182 Ga0111539_10904083 3300009094 Bacteria 1027
183 Ga0105245_10501296 3300009098 Bacteria 1230
184 Ga0114129_10048904 3300009147 Bacteria 5943
185 Ga0114129_10055617 3300009147 Bacteria 5545
186 Ga0114129_10756408 3300009147 Bacteria 1243
187 Ga0105243_10316625 3300009148 Bacteria 1420
188 Ga0105242_10002200 3300009176 Bacteria 15384
189 Ga0105242_10320176 3300009176 Bacteria 1422
190 Ga0105248_10164602 3300009177 Bacteria 2500
191 Ga0105248_10180319 3300009177 Bacteria 2380
192 Ga0105248_10568904 3300009177 Unclassified 1279
193 Ga0105248_10636363 3300009177 Bacteria 1203
194 Ga0105248_10784972 3300009177 Bacteria 1075
195 Ga0105248_10815657 3300009177 Bacteria 1053
196 Ga0105248_11863805 3300009177 Bacteria 682
197 Ga0105237_10540017 3300009545 Unclassified 1172
198 Ga0105238_10013406 3300009551 Bacteria 8274
199 Ga0105249_10002282 3300009553 Bacteria 16655
200 Ga0105246_10008930 3300011119 Bacteria 6168
201 Ga0157371_10136221 3300013102 Bacteria 1749
202 Ga0157369_10227495 3300013105 Unclassified 1951
203 Ga0157378_10699366 3300013297 Bacteria 1033
204 Ga0163162_10001129 3300013306 Bacteria 24849
205 Ga0163162_10208037 3300013306 Bacteria 2086
206 Ga0163162_10334418 3300013306 Unclassified 1647
207 Ga0157375_10042456 3300013308 Bacteria 4401
208 Ga0157375_10090851 3300013308 Bacteria 3113
209 Ga0157375_10425344 3300013308 Bacteria 1494
210 Ga0163163_10086930 3300014325 Bacteria 3136
211 Ga0163163_10111093 3300014325 Bacteria 2770
212 Ga0163163_10385144 3300014325 Bacteria 1460
213 Ga0163163_11908203 3300014325 Bacteria 654
214 Ga0157380_10026746 3300014326 Bacteria 4383
215 Ga0157380_10029839 3300014326 Bacteria 4171
216 Ga0157380_10344982 3300014326 Bacteria 1391
217 Ga0157380_10465960 3300014326 Bacteria 1218
218 Ga0157380_10755515 3300014326 Bacteria 984
219 Ga0157377_10003595 3300014745 Bacteria 7019
220 Ga0157377_10260082 3300014745 Bacteria 1129
221 Ga0157377_10317905 3300014745 Bacteria 1033
222 Ga0157379_10016196 3300014968 Bacteria 6558
223 Ga0157376_10025552 3300014969 Bacteria 4653
224 Ga0157376_10226140 3300014969 Bacteria 1736
225 Ga0163161_10001928 3300017792 Bacteria 15134
226 Ga0163161_10120251 3300017792 Bacteria 1973
227 Ga0163161_10271877 3300017792 Bacteria 1326
228 Ga0207697_10001326 3300025315 Bacteria 13620
229 Ga0207656_10009654 3300025321 Bacteria 3586
230 Ga0207682_10003365 3300025893 Bacteria 6965
231 Ga0207682_10006149 3300025893 Bacteria 4850
232 Ga0207682_10015097 3300025893 Bacteria 3008
233 Ga0207682_10066628 3300025893 Bacteria 1518
234 Ga0207682_10278018 3300025893 Bacteria 783
235 Ga0207642_10314247 3300025899 Bacteria 913
236 Ga0207688_10000947 3300025901 Bacteria 14707
237 Ga0207688_10046958 3300025901 Bacteria 2411
238 Ga0207688_10062722 3300025901 Bacteria 2095
239 Ga0207680_10031310 3300025903 Bacteria 3012
240 Ga0207680_10711168 3300025903 Bacteria 720
241 Ga0207645_10000611 3300025907 Bacteria 29564
242 Ga0207645_10006074 3300025907 Bacteria 8685
243 Ga0207645_10044764 3300025907 Bacteria 2831
244 Ga0207645_10219088 3300025907 Bacteria 1254
245 Ga0207643_10000068 3300025908 Bacteria 69282
246 Ga0207643_10002646 3300025908 Bacteria 9695
247 Ga0207643_10062260 3300025908 Bacteria 2132
248 Ga0207643_10149400 3300025908 Bacteria 1400
249 Ga0207643_10153803 3300025908 Bacteria 1380
250 Ga0207684_10080887 3300025910 Bacteria 2764
251 Ga0207684_10477336 3300025910 Unclassified 1070
252 Ga0207695_10023644 3300025913 Bacteria 6934
253 Ga0207693_10442822 3300025915 Bacteria 1015
254 Ga0207662_10065342 3300025918 Bacteria 2191
255 Ga0207662_10081195 3300025918 Bacteria 1979
256 Ga0207657_10189624 3300025919 Bacteria 1659
257 Ga0207649_10273340 3300025920 Bacteria 1226
258 Ga0207649_10550334 3300025920 Bacteria 883
259 Ga0207646_10026668 3300025922 Bacteria 5270
260 Ga0207681_10027526 3300025923 Bacteria 3676
261 Ga0207681_10119372 3300025923 Bacteria 1931
262 Ga0207681_10122034 3300025923 Bacteria 1912
263 Ga0207681_10235329 3300025923 Bacteria 1423
264 Ga0207681_10253635 3300025923 Bacteria 1374
265 Ga0207694_10003599 3300025924 Bacteria 12277
266 Ga0207650_10006429 3300025925 Bacteria 8008
267 Ga0207650_10042419 3300025925 Bacteria 3338
268 Ga0207650_10092874 3300025925 Bacteria 2309
269 Ga0207650_10752155 3300025925 Bacteria 825
270 Ga0207659_10015134 3300025926 Bacteria 4991
271 Ga0207659_10028375 3300025926 Bacteria 3803
272 Ga0207659_10048077 3300025926 Bacteria 3020
273 Ga0207659_10134260 3300025926 Bacteria 1914
274 Ga0207687_10606449 3300025927 Bacteria 923
275 Ga0207644_10058758 3300025931 Bacteria 2780
276 Ga0207644_10159315 3300025931 Bacteria 1753
277 Ga0207644_10324739 3300025931 Unclassified 1245
278 Ga0207690_10857186 3300025932 Bacteria 752
279 Ga0207706_10002047 3300025933 Bacteria 19775
280 Ga0207706_10007978 3300025933 Bacteria 9775
281 Ga0207709_10134150 3300025935 Bacteria 1692
282 Ga0207709_10376477 3300025935 Bacteria 1079
283 Ga0207670_10164159 3300025936 Bacteria 1661
284 Ga0207670_10185908 3300025936 Bacteria 1568
285 Ga0207669_10001787 3300025937 Bacteria 9119
286 Ga0207691_10004937 3300025940 Bacteria 12870
287 Ga0207691_10014496 3300025940 Bacteria 7517
288 Ga0207691_10082133 3300025940 Bacteria 2895
289 Ga0207691_10159706 3300025940 Bacteria 1978
290 Ga0207691_10316070 3300025940 Bacteria 1339
291 Ga0207691_10554318 3300025940 Bacteria 974
292 Ga0207711_10461441 3300025941 Bacteria 1183
293 Ga0207689_10000219 3300025942 Bacteria 50693
294 Ga0207689_10005878 3300025942 Bacteria 10870
295 Ga0207689_10123222 3300025942 Bacteria 2132
296 Ga0207689_10279594 3300025942 Bacteria 1382
297 Ga0207689_10585203 3300025942 Bacteria 938
298 Ga0207679_10002803 3300025945 Bacteria 10807
299 Ga0207679_10544372 3300025945 Bacteria 1041
300 Ga0207679_11140019 3300025945 Bacteria 715
301 Ga0207651_10123456 3300025960 Bacteria 1968
302 Ga0207651_10162445 3300025960 Bacteria 1752
303 Ga0207651_10289959 3300025960 Bacteria 1356
304 Ga0207651_10634818 3300025960 Bacteria 936
305 Ga0207668_10177622 3300025972 Bacteria 1676
306 Ga0207658_10019228 3300025986 Bacteria 4723
307 Ga0207658_10285338 3300025986 Bacteria 1417
308 Ga0207658_10639172 3300025986 Bacteria 958
309 Ga0207677_10116487 3300026023 Bacteria 2000
310 Ga0207677_10298891 3300026023 Bacteria 1329
311 Ga0207703_10042138 3300026035 Bacteria 3661
312 Ga0207703_10056658 3300026035 Bacteria 3193
313 Ga0207703_10723762 3300026035 Bacteria 947
314 Ga0207703_10947016 3300026035 Bacteria 825
315 Ga0207678_10009882 3300026067 Bacteria 8377
316 Ga0207678_10026465 3300026067 Bacteria 5059
317 Ga0207678_10250281 3300026067 Bacteria 1517
318 Ga0207708_10018007 3300026075 Bacteria 5315
319 Ga0207708_10062064 3300026075 Bacteria 2854
320 Ga0207708_10610922 3300026075 Bacteria 925
321 Ga0207702_10015197 3300026078 Bacteria 6383
322 Ga0207641_10533316 3300026088 Bacteria 1143
323 Ga0207641_11070612 3300026088 Unclassified 804
324 Ga0207648_10000660 3300026089 Bacteria 38626
325 Ga0207648_10015486 3300026089 Bacteria 7012
326 Ga0207648_10090507 3300026089 Bacteria 2673
327 Ga0207676_10122443 3300026095 Bacteria 2196
328 Ga0207676_10400104 3300026095 Bacteria 1283
329 Ga0207676_10622998 3300026095 Bacteria 1038
330 Ga0207674_10179889 3300026116 Bacteria 2066
331 Ga0207674_10346065 3300026116 Bacteria 1437
332 Ga0207674_10352083 3300026116 Bacteria 1424
333 Ga0207675_100004566 3300026118 Bacteria 13356
334 Ga0207675_100040575 3300026118 Bacteria 4347
335 Ga0207675_100067041 3300026118 Bacteria 3355
336 Ga0207683_10009806 3300026121 Bacteria 8168
337 Ga0207683_10069383 3300026121 Bacteria 3113
338 Ga0207683_10102149 3300026121 Bacteria 2560
339 Ga0209982_1017618 3300027552 Bacteria 1090
340 Ga0209588_1014064 3300027671 Bacteria 2447
341 Ga0207428_10000977 3300027907 Bacteria 31600
342 Ga0207428_10022626 3300027907 Bacteria 5301
343 Ga0207428_10352922 3300027907 Bacteria 1082
344 Ga0207428_10468299 3300027907 Bacteria 917
345 Ga0268266_10091960 3300028379 Bacteria 2661
346 Ga0268265_10020424 3300028380 Bacteria 4622
347 Ga0268265_10177315 3300028380 Bacteria 1828
348 Ga0268265_10916400 3300028380 Bacteria 861
349 Ga0268264_10219545 3300028381 Bacteria 1749
350 Ga0268264_10499116 3300028381 Bacteria 1187
351 Ga0307408_100061634 3300031548 Bacteria 2739
352 Ga0307408_100111533 3300031548 Bacteria 2102
353 Ga0307408_100448569 3300031548 Bacteria 1118
354 Ga0307408_100528987 3300031548 Bacteria 1037
355 Ga0307405_10034327 3300031731 Bacteria 3018
356 Ga0307405_10129455 3300031731 Bacteria 1741
357 Ga0307405_11001695 3300031731 Bacteria 713
358 Ga0307405_11396681 3300031731 Unclassified 612
359 Ga0307413_10004622 3300031824 Bacteria 6019
360 Ga0307413_10473907 3300031824 Bacteria 999
361 Ga0307410_10045744 3300031852 Bacteria 2916
362 Ga0307410_10048560 3300031852 Bacteria 2843
363 Ga0307410_10396174 3300031852 Bacteria 1114
364 Ga0307406_10137335 3300031901 Bacteria 1725
365 Ga0307407_10016221 3300031903 Bacteria 3704
366 Ga0307412_10026265 3300031911 Bacteria 3617
367 Ga0307412_10153180 3300031911 Bacteria 1704
368 Ga0307412_10563695 3300031911 Bacteria 959
369 Ga0307412_10795471 3300031911 Bacteria 820
370 Ga0307409_100111627 3300031995 Bacteria 2294
371 Ga0307409_100278731 3300031995 Bacteria 1544
372 Ga0307409_100737507 3300031995 Bacteria 988
373 Ga0307409_100739255 3300031995 Bacteria 987
374 Ga0307409_101569573 3300031995 Unclassified 686
375 Ga0307416_100068188 3300032002 Bacteria 2938
376 Ga0307416_100099601 3300032002 Bacteria 2524
377 Ga0307416_100104632 3300032002 Bacteria 2475
378 Ga0307416_100151539 3300032002 Bacteria 2127
379 Ga0307416_100717589 3300032002 Bacteria 1090
380 Ga0307414_10051432 3300032004 Bacteria 2860
381 Ga0307414_10210801 3300032004 Unclassified 1588
382 Ga0307414_10443336 3300032004 Bacteria 1137
383 Ga0307411_10008706 3300032005 Bacteria 5276
384 Ga0307411_10941140 3300032005 Bacteria 770
385 Ga0307415_100313058 3300032126 Bacteria 1305
386 Ga0373950_0031557 3300034818 Unclassified 983
387 Ga0373934_0046702 3300035086 Bacteria 1713
388 Ga0373939_0082462 3300035114 Bacteria 1071
389 Ga0373953_0365012 3300035117 Unclassified 633
390 Ga0373960_0039529 3300035121 Bacteria 1357
391 Ga0373955_0139077 3300035172 Bacteria 1423
392 Ga0373955_0316900 3300035172 Bacteria 942
393 Ga0373962_0059841 3300035242 Bacteria 1116
394 Ga0373931_0074434 3300035691 Bacteria 1860
395 Ga0373937_0017411 3300036401 Bacteria 6401
396 Ga0373937_0063140 3300036401 Bacteria 3406
397 Ga0439439_0144198 3300041406 Bacteria 674
398 Ga0451807_1101640 3300041486 Bacteria 1015
399 Ga0439446_0075925 3300042156 Bacteria 1034
400 Ga0439435_0189734 3300042436 Bacteria 674
401 Ga0439464_0030429 3300042439 Bacteria 1512
402 Ga0453683_0560654 3300044673 Bacteria 744
403 Ga0451576_0089653 3300045051 Bacteria 3198
404 Ga0495580_0305448 3300046472 Unclassified 1083
405 Ga0495662_0269946 3300046476 Unclassified 837
406 Ga0495598_0105753 3300046537 Bacteria 937
407 Ga0495613_0010825 3300046689 Bacteria 6767
408 Ga0495636_0018584 3300047318 Bacteria 2790
409 Ga0496113_0315336 3300048916 Bacteria 1253
410 Ga0501071_0298657 3300049587 Bacteria 1221
411 Ga0501073_1035008 3300049589 Bacteria 565
412 Ga0501076_0251206 3300049592 Bacteria 1447
413 Ga0501076_0419696 3300049592 Bacteria 1101
414 Ga0501249_029542 3300049679 Bacteria 1219
415 Ga0501249_036854 3300049679 Bacteria 1103
416 Ga0501225_0087486 3300049705 Bacteria 900
417 Ga0501083_0946170 3300049744 Bacteria 561
418 nmdc:mga05p37_207754_c1 3300050507 Bacteria 2368
419 nmdc:mga05p37_705840_c1 3300050507 Bacteria 1120
420 nmdc:mga09592_144478_c1 3300050508 Bacteria 2051
421 nmdc:mga09592_21599_c1 3300050508 Bacteria 5306
422 nmdc:mga09592_34457_c1 3300050508 Bacteria 4232
423 nmdc:mga09592_47605_c1 3300050508 Bacteria 3614
424 nmdc:mga09592_808526_c1 3300050508 Bacteria 793
425 nmdc:mga0qj67_11606_c1 3300050509 Bacteria 6607
426 nmdc:mga0qj67_2209_c1 3300050509 Bacteria 13829
427 nmdc:mga0qj67_72093_c1 3300050509 Bacteria 2757
428 nmdc:mga0qj67_815306_c1 3300050509 Bacteria 738
429 nmdc:mga0qj67_86730_c1 3300050509 Bacteria 2512
430 nmdc:mga06r32_1768_c1 3300050510 Bacteria 19402
431 nmdc:mga06r32_30119_c1 3300050510 Bacteria 5092
432 nmdc:mga06r32_446114_c1 3300050510 Bacteria 1274
433 nmdc:mga08y16_360473_c1 3300050511 Bacteria 1493
434 nmdc:mga08y16_386151_c1 3300050511 Bacteria 1435
435 nmdc:mga08y16_44058_c1 3300050511 Bacteria 4675
436 nmdc:mga0n895_6276_c1 3300050512 Bacteria 10071
437 nmdc:mga0n895_671829_c1 3300050512 Unclassified 1033
438 nmdc:mga0rr50_107185_c1 3300050513 Unclassified 2205
439 nmdc:mga0rr50_44215_c1 3300050513 Bacteria 3265
440 nmdc:mga0a205_1229_c1 3300050515 Bacteria 21485
441 nmdc:mga0a205_911927_c1 3300050515 Bacteria 725
442 Ga0590071_001004 3300059421 Bacteria 7699
443 Ga0590071_043777 3300059421 Bacteria 1079
444 Ga0590074_005958 3300059423 Bacteria 2022
445 Ga0590075_006033 3300059424 Bacteria 2867
446 Ga0157374_10232619
447 MBSR1b_contig_7035149
448 JGI24746J21847_1000693
449 JGI24033J26618_1002985
450 Ga0065712_10011901
451 Ga0065712_10194425
452 Ga0065715_10106514
453 Ga0065707_10094176
454 Ga0070676_10006083
455 Ga0070676_10067528
456 Ga0070676_10250029
457 Ga0070676_10362522
458 Ga0070690_100128791
459 Ga0070690_100598065
460 Ga0070670_100001257
461 Ga0070670_100022864
462 Ga0070670_100053100
463 Ga0070670_100966311
464 Ga0070677_10015211
465 Ga0070677_10028966
466 Ga0070677_10032824
467 Ga0068869_100012842
468 Ga0068869_100014179
469 Ga0070666_10001736
470 Ga0070666_10011237
471 Ga0068868_100004581
472 Ga0068868_100545719
473 Ga0070660_100214767
474 Ga0070689_100109452
475 Ga0070687_100079347
476 Ga0070661_100069592
477 Ga0070661_100349083
478 Ga0070668_100016357
479 Ga0070668_100428361
480 Ga0070669_100014927
481 Ga0070669_100032570
482 Ga0070669_100111824
483 Ga0070669_100133221
484 Ga0070669_100272010
485 Ga0070675_100002921
486 Ga0070675_100026216
487 Ga0070675_100215920
488 Ga0070675_100252023
489 Ga0070671_100070690
490 Ga0070674_100000032
491 Ga0070674_100317410
492 Ga0070673_100011279
493 Ga0070673_100159277
494 Ga0070673_100242581
495 Ga0070673_101834115
496 Ga0070688_100004862
497 Ga0070688_100160971
498 Ga0070688_100201352
499 Ga0070659_100097980
500 Ga0070659_100190841
501 Ga0070659_100368435
502 Ga0070667_100005771
503 Ga0070667_101025620
504 Ga0070713_100370355
505 Ga0070701_10013819
506 Ga0070701_10110757
507 Ga0070701_10604098
508 Ga0070700_100055302
509 Ga0070700_100078548
510 Ga0070700_100576376
511 Ga0070694_100418613
512 Ga0070694_100487049
513 Ga0070708_100068859
514 Ga0070663_100017123
515 Ga0070678_100031871
516 Ga0070678_100098130
517 Ga0070662_100030484
518 Ga0070662_100086229
519 Ga0068867_100002741
520 Ga0068867_100068939
521 Ga0068867_100069053
522 Ga0068867_100166806
523 Ga0068867_100354509
524 Ga0068867_100500610
525 Ga0070685_10001085
526 Ga0070685_10079263
527 Ga0070685_10271373
528 Ga0070706_100003379
529 Ga0070707_100030534
530 Ga0070698_100041266
531 Ga0070697_100206851
532 Ga0068853_100350767
533 Ga0070672_100004171
534 Ga0070672_100035995
535 Ga0070672_100056778
536 Ga0070672_100175563
537 Ga0070672_100227844
538 Ga0070672_100271460
539 Ga0070686_100061356
540 Ga0070686_100112653
541 Ga0070665_100017696
542 Ga0070704_100434669
543 Ga0070704_100539313
544 Ga0070664_100007165
545 Ga0070664_100268023
546 Ga0068857_100178940
547 Ga0068857_100342156
548 Ga0068857_101232419
549 Ga0068854_100842686
550 Ga0068856_100010295
551 Ga0070702_100093511
552 Ga0068852_101497865
553 Ga0068859_100016203
554 Ga0068859_100205677
555 Ga0068859_100371464
556 Ga0068864_100370161
557 Ga0068864_100725090
558 Ga0068866_10036029
559 Ga0068866_10088735
560 Ga0068861_100061057
561 Ga0068861_100075563
562 Ga0068861_100994636
563 Ga0068851_10007663
564 Ga0068870_10000427
565 Ga0068870_10052460
566 Ga0068870_10145202
567 Ga0068870_10200923
568 Ga0068863_100097945
569 Ga0068863_101900554
570 Ga0068858_100013400
571 Ga0068858_100029531
572 Ga0068858_100089572
573 Ga0068858_100796180
574 Ga0068860_100066024
575 Ga0068860_100656789
576 Ga0068860_101368774
577 Ga0068862_100004495
578 Ga0068862_100151298
579 Ga0068862_100475608
580 Ga0068862_101146599
581 Ga0081539_10000750
582 Ga0075432_10038343
583 Ga0070712_100087513
584 Ga0097621_100323377
585 Ga0097621_100383868
586 Ga0097621_100589807
587 Ga0097621_100641548
588 Ga0068871_100057440
589 Ga0068871_100369551
590 Ga0075428_100000166
591 Ga0075428_100006995
592 Ga0075428_100043662
593 Ga0075428_100144973
594 Ga0075428_100165640
595 Ga0075428_100425935
596 Ga0075428_100588399
597 Ga0075430_100003054
598 Ga0075430_100007091
599 Ga0075430_100046423
600 Ga0075430_100248966
601 Ga0075430_100430584
602 Ga0075431_100001063
603 Ga0075431_100007187
604 Ga0075431_100028570
605 Ga0075431_100091012
606 Ga0075433_10006662
607 Ga0075434_100011195
608 Ga0075429_100006130
609 Ga0075429_100017594
610 Ga0075429_100022337
611 Ga0075429_100047136
612 Ga0075429_100221706
613 Ga0075429_100466060
614 Ga0068865_100122026
615 Ga0068865_100274929
616 Ga0068865_100567786
617 Ga0097620_100016204
618 Ga0097620_100205658
619 Ga0097620_100371467
620 Ga0075435_100056721
621 Ga0099794_10015104
622 Ga0105240_10006183
623 Ga0111539_10002366
624 Ga0111539_10006794
625 Ga0111539_10116693
626 Ga0111539_10181412
627 Ga0111539_10904083
628 Ga0105245_10501296
629 Ga0114129_10048904
630 Ga0114129_10055617
631 Ga0114129_10756408
632 Ga0105243_10316625
633 Ga0105242_10002200
634 Ga0105242_10320176
635 Ga0105248_10164602
636 Ga0105248_10180319
637 Ga0105248_10568904
638 Ga0105248_10636363
639 Ga0105248_10784972
640 Ga0105248_10815657
641 Ga0105248_11863805
642 Ga0105237_10540017
643 Ga0105238_10013406
644 Ga0105249_10002282
645 Ga0105246_10008930
646 Ga0157371_10136221
647 Ga0157369_10227495
648 Ga0157378_10699366
649 Ga0163162_10001129
650 Ga0163162_10208037
651 Ga0163162_10334418
652 Ga0157375_10042456
653 Ga0157375_10090851
654 Ga0157375_10425344
655 Ga0163163_10086930
656 Ga0163163_10111093
657 Ga0163163_10385144
658 Ga0163163_11908203
659 Ga0157380_10026746
660 Ga0157380_10029839
661 Ga0157380_10344982
662 Ga0157380_10465960
663 Ga0157380_10755515
664 Ga0157377_10003595
665 Ga0157377_10260082
666 Ga0157377_10317905
667 Ga0157379_10016196
668 Ga0157376_10025552
669 Ga0157376_10226140
670 Ga0163161_10001928
671 Ga0163161_10120251
672 Ga0163161_10271877
673 Ga0207697_10001326
674 Ga0207656_10009654
675 Ga0207682_10003365
676 Ga0207682_10006149
677 Ga0207682_10015097
678 Ga0207682_10066628
679 Ga0207682_10278018
680 Ga0207642_10314247
681 Ga0207688_10000947
682 Ga0207688_10046958
683 Ga0207688_10062722
684 Ga0207680_10031310
685 Ga0207680_10711168
686 Ga0207645_10000611
687 Ga0207645_10006074
688 Ga0207645_10044764
689 Ga0207645_10219088
690 Ga0207643_10000068
691 Ga0207643_10002646
692 Ga0207643_10062260
693 Ga0207643_10149400
694 Ga0207643_10153803
695 Ga0207684_10080887
696 Ga0207684_10477336
697 Ga0207695_10023644
698 Ga0207693_10442822
699 Ga0207662_10065342
700 Ga0207662_10081195
701 Ga0207657_10189624
702 Ga0207649_10273340
703 Ga0207649_10550334
704 Ga0207646_10026668
705 Ga0207681_10027526
706 Ga0207681_10119372
707 Ga0207681_10122034
708 Ga0207681_10235329
709 Ga0207681_10253635
710 Ga0207694_10003599
711 Ga0207650_10006429
712 Ga0207650_10042419
713 Ga0207650_10092874
714 Ga0207650_10752155
715 Ga0207659_10015134
716 Ga0207659_10028375
717 Ga0207659_10048077
718 Ga0207659_10134260
719 Ga0207687_10606449
720 Ga0207644_10058758
721 Ga0207644_10159315
722 Ga0207644_10324739
723 Ga0207690_10857186
724 Ga0207706_10002047
725 Ga0207706_10007978
726 Ga0207709_10134150
727 Ga0207709_10376477
728 Ga0207670_10164159
729 Ga0207670_10185908
730 Ga0207669_10001787
731 Ga0207691_10004937
732 Ga0207691_10014496
733 Ga0207691_10082133
734 Ga0207691_10159706
735 Ga0207691_10316070
736 Ga0207691_10554318
737 Ga0207711_10461441
738 Ga0207689_10000219
739 Ga0207689_10005878
740 Ga0207689_10123222
741 Ga0207689_10279594
742 Ga0207689_10585203
743 Ga0207679_10002803
744 Ga0207679_10544372
745 Ga0207679_11140019
746 Ga0207651_10123456
747 Ga0207651_10162445
748 Ga0207651_10289959
749 Ga0207651_10634818
750 Ga0207668_10177622
751 Ga0207658_10019228
752 Ga0207658_10285338
753 Ga0207658_10639172
754 Ga0207677_10116487
755 Ga0207677_10298891
756 Ga0207703_10042138
757 Ga0207703_10056658
758 Ga0207703_10723762
759 Ga0207703_10947016
760 Ga0207678_10009882
761 Ga0207678_10026465
762 Ga0207678_10250281
763 Ga0207708_10018007
764 Ga0207708_10062064
765 Ga0207708_10610922
766 Ga0207702_10015197
767 Ga0207641_10533316
768 Ga0207641_11070612
769 Ga0207648_10000660
770 Ga0207648_10015486
771 Ga0207648_10090507
772 Ga0207676_10122443
773 Ga0207676_10400104
774 Ga0207676_10622998
775 Ga0207674_10179889
776 Ga0207674_10346065
777 Ga0207674_10352083
778 Ga0207675_100004566
779 Ga0207675_100040575
780 Ga0207675_100067041
781 Ga0207683_10009806
782 Ga0207683_10069383
783 Ga0207683_10102149
784 Ga0209982_1017618
785 Ga0209588_1014064
786 Ga0207428_10000977
787 Ga0207428_10022626
788 Ga0207428_10352922
789 Ga0207428_10468299
790 Ga0268266_10091960
791 Ga0268265_10020424
792 Ga0268265_10177315
793 Ga0268265_10916400
794 Ga0268264_10219545
795 Ga0268264_10499116
796 Ga0307408_100061634
797 Ga0307408_100111533
798 Ga0307408_100448569
799 Ga0307408_100528987
800 Ga0307405_10034327
801 Ga0307405_10129455
802 Ga0307405_11001695
803 Ga0307405_11396681
804 Ga0307413_10004622
805 Ga0307413_10473907
806 Ga0307410_10045744
807 Ga0307410_10048560
808 Ga0307410_10396174
809 Ga0307406_10137335
810 Ga0307407_10016221
811 Ga0307412_10026265
812 Ga0307412_10153180
813 Ga0307412_10563695
814 Ga0307412_10795471
815 Ga0307409_100111627
816 Ga0307409_100278731
817 Ga0307409_100737507
818 Ga0307409_100739255
819 Ga0307409_101569573
820 Ga0307416_100068188
821 Ga0307416_100099601
822 Ga0307416_100104632
823 Ga0307416_100151539
824 Ga0307416_100717589
825 Ga0307414_10051432
826 Ga0307414_10210801
827 Ga0307414_10443336
828 Ga0307411_10008706
829 Ga0307411_10941140
830 Ga0307415_100313058
831 Ga0373950_0031557
832 Ga0373934_0046702
833 Ga0373939_0082462
834 Ga0373953_0365012
835 Ga0373960_0039529
836 Ga0373955_0139077
837 Ga0373955_0316900
838 Ga0373962_0059841
839 Ga0373931_0074434
840 Ga0373937_0017411
841 Ga0373937_0063140
842 Ga0439439_0144198
843 Ga0451807_1101640
844 Ga0439446_0075925
845 Ga0439435_0189734
846 Ga0439464_0030429
847 Ga0453683_0560654
848 Ga0451576_0089653
849 Ga0495580_0305448
850 Ga0495662_0269946
851 Ga0495598_0105753
852 Ga0495613_0010825
853 Ga0495636_0018584
854 Ga0496113_0315336
855 Ga0501071_0298657
856 Ga0501073_1035008
857 Ga0501076_0251206
858 Ga0501076_0419696
859 Ga0501249_029542
860 Ga0501249_036854
861 Ga0501225_0087486
862 Ga0501083_0946170
863 nmdc:mga05p37_207754_c1
864 nmdc:mga05p37_705840_c1
865 nmdc:mga09592_144478_c1
866 nmdc:mga09592_21599_c1
867 nmdc:mga09592_34457_c1
868 nmdc:mga09592_47605_c1
869 nmdc:mga09592_808526_c1
870 nmdc:mga0qj67_11606_c1
871 nmdc:mga0qj67_2209_c1
872 nmdc:mga0qj67_72093_c1
873 nmdc:mga0qj67_815306_c1
874 nmdc:mga0qj67_86730_c1
875 nmdc:mga06r32_1768_c1
876 nmdc:mga06r32_30119_c1
877 nmdc:mga06r32_446114_c1
878 nmdc:mga08y16_360473_c1
879 nmdc:mga08y16_386151_c1
880 nmdc:mga08y16_44058_c1
881 nmdc:mga0n895_6276_c1
882 nmdc:mga0n895_671829_c1
883 nmdc:mga0rr50_107185_c1
884 nmdc:mga0rr50_44215_c1
885 nmdc:mga0a205_1229_c1
886 nmdc:mga0a205_911927_c1
887 Ga0590071_001004
888 Ga0590071_043777
889 Ga0590074_005958
890 Ga0590075_006033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n7y-assembly1.cif.gz_F-2 crystal structure of human fpps in complex with an allosteric inhibitor mit-01-102 0.2424 95 167
4rhp-assembly1.cif.gz_B crystal structure of human coq9 in complex with a phospholipid, northeast structural genomics consortium target hr5043 0.2261 33 184
4gba-assembly2.cif.gz_B dcnl complex with n-terminally acetylated nedd8 e2 peptide 0.2159 24 169
6hs1-assembly1.cif.gz_B ethr2 in complex with compound 9 (bdm76060) 0.2127 53 184
4yxx-assembly1.cif.gz_A computationally designed left-handed alpha/alpha toroid with 6 repeats 0.2067 33 182
ID Description Score Start End Superfamily
af_Q8INF0_1_188_3.90.1520.10 Alpha Beta;Alpha-Beta Complex;H-NOX domain;H-NOX domain 0.408 99 173 3.90.1520.10
3p7nB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.3763 25 102 1.10.10.10
af_I1MLF3_444_633_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3559 95 184 1.25.40.10
3p7nB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.3378 25 102 1.10.10.10
af_Q10NT7_120_228_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3056 96 184 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A521TC89-F1-model_v4 Uncharacterized protein 0.9672 24 184
AF-A0A1F2U2G6-F1-model_v4 Uncharacterized protein 0.9648 33 180
AF-A0A2W4RWJ5-F1-model_v4 Uncharacterized protein 0.9561 33 175
AF-A0A2V7UHB1-F1-model_v4 Uncharacterized protein 0.9487 74 175
AF-A0A2V8CXT5-F1-model_v4 Uncharacterized protein 0.9472 26 175

Map