F445492
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 445 | 285 | 426 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10073969|Ga0105248_100739694 |
| Length | 162 |
| Sequence | LTVPPVAAMVAAGRGESGAGAMTDLPETSGARSLGEIASYHAHVYYDPAATRAEAERLRTWIGERFSVTLGRWHDVKVGPHDQAMYQVAFAREVFPDLVPWLMLNHGRLSVLVHPNTTNPRRDHLADPIWIGPALAVHADKLPEHSELEAAPAPNTSPTLRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 2 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 3 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 4 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 5 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 6 | 2904699407 | |||
| 7 | 2906610324 | |||
| 8 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 9 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 10 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 11 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 12 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 13 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 14 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 70 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 96 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 135 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 136 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 137 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 141 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 142 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 143 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 144 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 145 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 146 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 147 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 148 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 149 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 150 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 151 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 152 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 153 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 154 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 155 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 156 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 157 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 158 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 159 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 171 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 172 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 173 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 174 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 175 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 179 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 180 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 181 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 182 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 183 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 220 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 221 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 222 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 223 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 224 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 225 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 228 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 229 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 230 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 231 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 232 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 233 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 234 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 235 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 236 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 237 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 238 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 239 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 249 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 250 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 251 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 252 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 253 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 254 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 255 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 256 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 259 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 262 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 263 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 264 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 265 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 266 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 267 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 268 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 269 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 270 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 271 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 272 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 273 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 274 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 275 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 276 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 277 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 278 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 279 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 280 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 281 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 282 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 283 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 284 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 285 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.49 |
| Metatranscriptomes | 0.68 |
| Isolates | 3.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.16 |
| Nodule | 4.49 |
| Rhizoplane | 7.87 |
| Rhizosphere | 63.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10423421 | 3300005293 | Bacteria | 846 |
| 2 | Ga0070683_100101130 | 3300005329 | Bacteria | 2714 |
| 3 | Ga0070680_101223515 | 3300005336 | Bacteria | 650 |
| 4 | Ga0070682_100058498 | 3300005337 | Bacteria | 2431 |
| 5 | Ga0070682_100299244 | 3300005337 | Bacteria | 1180 |
| 6 | Ga0068868_100009479 | 3300005338 | Bacteria | 7011 |
| 7 | Ga0068868_100401824 | 3300005338 | Bacteria | 1182 |
| 8 | Ga0068868_101183526 | 3300005338 | Bacteria | 706 |
| 9 | Ga0070660_101769625 | 3300005339 | Bacteria | 526 |
| 10 | Ga0070689_101596766 | 3300005340 | Bacteria | 592 |
| 11 | Ga0070687_100383457 | 3300005343 | Bacteria | 917 |
| 12 | Ga0070668_100097206 | 3300005347 | Bacteria | 2328 |
| 13 | Ga0070671_100791171 | 3300005355 | Bacteria | 825 |
| 14 | Ga0070671_100846012 | 3300005355 | Bacteria | 798 |
| 15 | Ga0070671_101529624 | 3300005355 | Bacteria | 591 |
| 16 | Ga0070674_100173066 | 3300005356 | Bacteria | 1648 |
| 17 | Ga0070674_100359666 | 3300005356 | Bacteria | 1178 |
| 18 | Ga0070688_100051288 | 3300005365 | Bacteria | 2574 |
| 19 | Ga0070667_101392877 | 3300005367 | Bacteria | 658 |
| 20 | Ga0070714_100062425 | 3300005435 | Bacteria | 3202 |
| 21 | Ga0070714_101077046 | 3300005435 | Bacteria | 783 |
| 22 | Ga0070713_100064529 | 3300005436 | Bacteria | 3074 |
| 23 | Ga0070713_100114574 | 3300005436 | Bacteria | 2355 |
| 24 | Ga0070710_10204687 | 3300005437 | Bacteria | 1248 |
| 25 | Ga0070711_100035068 | 3300005439 | Bacteria | 3351 |
| 26 | Ga0070708_100207938 | 3300005445 | Bacteria | 1833 |
| 27 | Ga0070663_100025740 | 3300005455 | Bacteria | 3975 |
| 28 | Ga0070663_100085680 | 3300005455 | Bacteria | 2325 |
| 29 | Ga0070663_100242743 | 3300005455 | Bacteria | 1423 |
| 30 | Ga0070663_100731575 | 3300005455 | Bacteria | 843 |
| 31 | Ga0070663_101447115 | 3300005455 | Bacteria | 610 |
| 32 | Ga0070678_100214800 | 3300005456 | Bacteria | 1596 |
| 33 | Ga0070678_100909241 | 3300005456 | Bacteria | 805 |
| 34 | Ga0070678_102342555 | 3300005456 | Bacteria | 507 |
| 35 | Ga0070681_10121663 | 3300005458 | Bacteria | 2544 |
| 36 | Ga0070681_10542311 | 3300005458 | Bacteria | 1077 |
| 37 | Ga0070679_100016478 | 3300005530 | Bacteria | 7131 |
| 38 | Ga0070679_100728471 | 3300005530 | Bacteria | 934 |
| 39 | Ga0070679_101750600 | 3300005530 | Bacteria | 570 |
| 40 | Ga0070684_100062555 | 3300005535 | Bacteria | 3260 |
| 41 | Ga0070684_100250530 | 3300005535 | Bacteria | 1619 |
| 42 | Ga0070684_100545821 | 3300005535 | Bacteria | 1075 |
| 43 | Ga0068853_100413526 | 3300005539 | Bacteria | 1264 |
| 44 | Ga0068853_100680899 | 3300005539 | Bacteria | 980 |
| 45 | Ga0068853_101028121 | 3300005539 | Bacteria | 794 |
| 46 | Ga0068853_101370335 | 3300005539 | Bacteria | 684 |
| 47 | Ga0068853_101770216 | 3300005539 | Bacteria | 599 |
| 48 | Ga0070672_100279899 | 3300005543 | Bacteria | 1410 |
| 49 | Ga0070693_100122484 | 3300005547 | Bacteria | 1615 |
| 50 | Ga0070693_100198708 | 3300005547 | Bacteria | 1301 |
| 51 | Ga0070665_100034649 | 3300005548 | Bacteria | 5078 |
| 52 | Ga0070665_100056456 | 3300005548 | Bacteria | 3936 |
| 53 | Ga0070665_100332646 | 3300005548 | Bacteria | 1524 |
| 54 | Ga0070665_100672139 | 3300005548 | Bacteria | 1049 |
| 55 | Ga0068855_100077435 | 3300005563 | Bacteria | 3858 |
| 56 | Ga0070664_100050577 | 3300005564 | Bacteria | 3518 |
| 57 | Ga0070664_100090557 | 3300005564 | Bacteria | 2647 |
| 58 | Ga0068857_100255596 | 3300005577 | Bacteria | 1607 |
| 59 | Ga0068854_100120150 | 3300005578 | Bacteria | 1994 |
| 60 | Ga0068856_100303659 | 3300005614 | Bacteria | 1614 |
| 61 | Ga0068856_100314617 | 3300005614 | Bacteria | 1583 |
| 62 | Ga0068852_100058058 | 3300005616 | Bacteria | 3350 |
| 63 | Ga0068852_100103550 | 3300005616 | Bacteria | 2574 |
| 64 | Ga0068852_100549064 | 3300005616 | Bacteria | 1155 |
| 65 | Ga0068864_100442215 | 3300005618 | Bacteria | 1242 |
| 66 | Ga0068866_10281874 | 3300005718 | Bacteria | 1030 |
| 67 | Ga0068866_10578946 | 3300005718 | Bacteria | 755 |
| 68 | Ga0068863_100044445 | 3300005841 | Bacteria | 4217 |
| 69 | Ga0068863_101363107 | 3300005841 | Bacteria | 717 |
| 70 | Ga0068858_100751889 | 3300005842 | Bacteria | 950 |
| 71 | Ga0068858_100919054 | 3300005842 | Bacteria | 856 |
| 72 | Ga0068860_100000135 | 3300005843 | Bacteria | 120265 |
| 73 | Ga0081455_10077863 | 3300005937 | Bacteria | 2726 |
| 74 | Ga0081538_10055572 | 3300005981 | Bacteria | 2329 |
| 75 | Ga0081540_1006530 | 3300005983 | Bacteria | 8472 |
| 76 | Ga0081540_1049223 | 3300005983 | Bacteria | 2104 |
| 77 | Ga0081540_1070113 | 3300005983 | Unclassified | 1625 |
| 78 | Ga0081540_1082347 | 3300005983 | Bacteria | 1444 |
| 79 | Ga0081539_10034446 | 3300005985 | Bacteria | 3062 |
| 80 | Ga0075365_10001096 | 3300006038 | Bacteria | 11780 |
| 81 | Ga0075365_10030500 | 3300006038 | Bacteria | 3454 |
| 82 | Ga0075365_10043087 | 3300006038 | Bacteria | 2953 |
| 83 | Ga0075365_10048537 | 3300006038 | Bacteria | 2795 |
| 84 | Ga0075365_10082161 | 3300006038 | Bacteria | 2184 |
| 85 | Ga0075365_10253300 | 3300006038 | Bacteria | 1237 |
| 86 | Ga0075365_10680959 | 3300006038 | Bacteria | 727 |
| 87 | Ga0075368_10116587 | 3300006042 | Bacteria | 1104 |
| 88 | Ga0075363_100047766 | 3300006048 | Bacteria | 2274 |
| 89 | Ga0075364_10068654 | 3300006051 | Bacteria | 2331 |
| 90 | Ga0075364_10417615 | 3300006051 | Bacteria | 916 |
| 91 | Ga0075432_10017477 | 3300006058 | Bacteria | 2447 |
| 92 | Ga0070712_100078247 | 3300006175 | Bacteria | 2387 |
| 93 | Ga0075367_10038683 | 3300006178 | Bacteria | 2777 |
| 94 | Ga0075367_10071359 | 3300006178 | Bacteria | 2089 |
| 95 | Ga0075367_10164934 | 3300006178 | Bacteria | 1378 |
| 96 | Ga0075369_10074129 | 3300006186 | Bacteria | 1501 |
| 97 | Ga0075369_10300648 | 3300006186 | Bacteria | 749 |
| 98 | Ga0097621_100034861 | 3300006237 | Bacteria | 4017 |
| 99 | Ga0097621_100195212 | 3300006237 | Bacteria | 1755 |
| 100 | Ga0097621_100936534 | 3300006237 | Bacteria | 808 |
| 101 | Ga0097621_101029499 | 3300006237 | Bacteria | 771 |
| 102 | Ga0075370_10019137 | 3300006353 | Bacteria | 3725 |
| 103 | Ga0075370_10107685 | 3300006353 | Bacteria | 1617 |
| 104 | Ga0068871_100137171 | 3300006358 | Bacteria | 2078 |
| 105 | Ga0068871_100248111 | 3300006358 | Bacteria | 1550 |
| 106 | Ga0068865_100215045 | 3300006881 | Bacteria | 1500 |
| 107 | Ga0099825_1030153 | 3300006941 | Bacteria | 2431 |
| 108 | Ga0099822_1007120 | 3300006943 | Bacteria | 14505 |
| 109 | Ga0105245_10009440 | 3300009098 | Bacteria | 8508 |
| 110 | Ga0105247_10004773 | 3300009101 | Bacteria | 8633 |
| 111 | Ga0105247_10209790 | 3300009101 | Bacteria | 1313 |
| 112 | Ga0105247_10548312 | 3300009101 | Bacteria | 850 |
| 113 | Ga0105243_10672200 | 3300009148 | Bacteria | 1006 |
| 114 | Ga0105241_10348985 | 3300009174 | Bacteria | 1284 |
| 115 | Ga0105241_10624660 | 3300009174 | Bacteria | 976 |
| 116 | Ga0105242_10194595 | 3300009176 | Bacteria | 1797 |
| 117 | Ga0105248_10045447 | 3300009177 | Bacteria | 4925 |
| 118 | Ga0105248_10073969 | 3300009177 | Bacteria | 3830 |
| 119 | Ga0105237_10117488 | 3300009545 | Bacteria | 2653 |
| 120 | Ga0105237_10500984 | 3300009545 | Bacteria | 1221 |
| 121 | Ga0105237_11369205 | 3300009545 | Bacteria | 714 |
| 122 | Ga0105238_10152595 | 3300009551 | Bacteria | 2285 |
| 123 | Ga0105238_10270007 | 3300009551 | Bacteria | 1681 |
| 124 | Ga0105238_10461986 | 3300009551 | Bacteria | 1267 |
| 125 | Ga0105238_10594827 | 3300009551 | Bacteria | 1114 |
| 126 | Ga0105238_11256100 | 3300009551 | Bacteria | 766 |
| 127 | Ga0105249_10389612 | 3300009553 | Bacteria | 1421 |
| 128 | Ga0099796_10091360 | 3300010159 | Bacteria | 1132 |
| 129 | Ga0099796_10128523 | 3300010159 | Bacteria | 980 |
| 130 | Ga0105239_10073958 | 3300010375 | Bacteria | 3746 |
| 131 | Ga0105239_10093154 | 3300010375 | Bacteria | 3326 |
| 132 | Ga0105239_10243895 | 3300010375 | Bacteria | 2017 |
| 133 | Ga0105246_10091504 | 3300011119 | Bacteria | 2193 |
| 134 | Ga0105246_10336439 | 3300011119 | Bacteria | 1232 |
| 135 | Ga0105246_10779972 | 3300011119 | Bacteria | 846 |
| 136 | Ga0157369_10002654 | 3300013105 | Bacteria | 21358 |
| 137 | Ga0157374_10100928 | 3300013296 | Bacteria | 2767 |
| 138 | Ga0157378_10034647 | 3300013297 | Bacteria | 4465 |
| 139 | Ga0163162_10050431 | 3300013306 | Bacteria | 4174 |
| 140 | Ga0163162_10277633 | 3300013306 | Bacteria | 1807 |
| 141 | Ga0157372_10115973 | 3300013307 | Bacteria | 3071 |
| 142 | Ga0157375_10026957 | 3300013308 | Bacteria | 5364 |
| 143 | Ga0157375_10933961 | 3300013308 | Bacteria | 1010 |
| 144 | Ga0163163_10006739 | 3300014325 | Bacteria | 10065 |
| 145 | Ga0163163_10136913 | 3300014325 | Bacteria | 2490 |
| 146 | Ga0163163_10239251 | 3300014325 | Bacteria | 1865 |
| 147 | Ga0157380_10274344 | 3300014326 | Bacteria | 1539 |
| 148 | Ga0157380_11355030 | 3300014326 | Bacteria | 760 |
| 149 | Ga0157380_11370266 | 3300014326 | Unclassified | 757 |
| 150 | Ga0157377_10162667 | 3300014745 | Bacteria | 1389 |
| 151 | Ga0157379_10187014 | 3300014968 | Bacteria | 1872 |
| 152 | Ga0157379_10524050 | 3300014968 | Bacteria | 1100 |
| 153 | Ga0157376_10108553 | 3300014969 | Bacteria | 2438 |
| 154 | Ga0157376_11412756 | 3300014969 | Bacteria | 728 |
| 155 | Ga0206356_10214755 | 3300020070 | Bacteria | 1212 |
| 156 | Ga0213872_10076119 | 3300021361 | Bacteria | 1510 |
| 157 | Ga0213874_10030794 | 3300021377 | Bacteria | 1548 |
| 158 | Ga0213876_10247041 | 3300021384 | Bacteria | 948 |
| 159 | Ga0224712_10378100 | 3300022467 | Bacteria | 673 |
| 160 | Ga0209233_1014953 | 3300025261 | Bacteria | 2174 |
| 161 | Ga0209758_1009397 | 3300025297 | Bacteria | 6085 |
| 162 | Ga0209758_1017948 | 3300025297 | Bacteria | 3494 |
| 163 | Ga0207710_10041520 | 3300025900 | Bacteria | 2040 |
| 164 | Ga0207688_10143879 | 3300025901 | Bacteria | 1405 |
| 165 | Ga0207699_10075606 | 3300025906 | Bacteria | 2072 |
| 166 | Ga0207654_10414278 | 3300025911 | Bacteria | 939 |
| 167 | Ga0207707_10008703 | 3300025912 | Bacteria | 8808 |
| 168 | Ga0207707_10016072 | 3300025912 | Bacteria | 6527 |
| 169 | Ga0207695_10145468 | 3300025913 | Bacteria | 2315 |
| 170 | Ga0207671_10287276 | 3300025914 | Bacteria | 1298 |
| 171 | Ga0207671_10583349 | 3300025914 | Bacteria | 891 |
| 172 | Ga0207693_10199556 | 3300025915 | Bacteria | 1573 |
| 173 | Ga0207693_11176369 | 3300025915 | Bacteria | 579 |
| 174 | Ga0207663_10284038 | 3300025916 | Bacteria | 1230 |
| 175 | Ga0207663_10680666 | 3300025916 | Bacteria | 813 |
| 176 | Ga0207652_10203197 | 3300025921 | Bacteria | 1783 |
| 177 | Ga0207652_10883489 | 3300025921 | Bacteria | 790 |
| 178 | Ga0207694_10313122 | 3300025924 | Bacteria | 1294 |
| 179 | Ga0207700_10103457 | 3300025928 | Bacteria | 2277 |
| 180 | Ga0207700_10342819 | 3300025928 | Bacteria | 1299 |
| 181 | Ga0207664_10057187 | 3300025929 | Bacteria | 3100 |
| 182 | Ga0207644_10074539 | 3300025931 | Bacteria | 2491 |
| 183 | Ga0207686_10597573 | 3300025934 | Bacteria | 868 |
| 184 | Ga0207686_10657555 | 3300025934 | Bacteria | 830 |
| 185 | Ga0207709_10219523 | 3300025935 | Bacteria | 1370 |
| 186 | Ga0207669_10168285 | 3300025937 | Bacteria | 1557 |
| 187 | Ga0207669_11080708 | 3300025937 | Bacteria | 677 |
| 188 | Ga0207704_10243649 | 3300025938 | Bacteria | 1345 |
| 189 | Ga0207661_10016193 | 3300025944 | Bacteria | 5496 |
| 190 | Ga0207679_10164750 | 3300025945 | Bacteria | 1819 |
| 191 | Ga0207667_10270684 | 3300025949 | Bacteria | 1736 |
| 192 | Ga0207667_11220349 | 3300025949 | Bacteria | 731 |
| 193 | Ga0207668_10074943 | 3300025972 | Bacteria | 2431 |
| 194 | Ga0207640_10244038 | 3300025981 | Bacteria | 1390 |
| 195 | Ga0207677_10024150 | 3300026023 | Bacteria | 3771 |
| 196 | Ga0207677_11082832 | 3300026023 | Bacteria | 730 |
| 197 | Ga0207703_10556288 | 3300026035 | Bacteria | 1082 |
| 198 | Ga0207639_10105338 | 3300026041 | Bacteria | 2288 |
| 199 | Ga0207639_10342310 | 3300026041 | Bacteria | 1333 |
| 200 | Ga0207639_10905476 | 3300026041 | Bacteria | 824 |
| 201 | Ga0207639_11476185 | 3300026041 | Bacteria | 638 |
| 202 | Ga0207678_10008051 | 3300026067 | Bacteria | 9294 |
| 203 | Ga0207678_10060777 | 3300026067 | Bacteria | 3250 |
| 204 | Ga0207678_10068429 | 3300026067 | Bacteria | 3046 |
| 205 | Ga0207678_10246303 | 3300026067 | Bacteria | 1531 |
| 206 | Ga0207702_10125918 | 3300026078 | Bacteria | 2300 |
| 207 | Ga0207702_10259466 | 3300026078 | Bacteria | 1636 |
| 208 | Ga0207702_10299087 | 3300026078 | Bacteria | 1527 |
| 209 | Ga0207641_10757999 | 3300026088 | Bacteria | 958 |
| 210 | Ga0207676_11278732 | 3300026095 | Bacteria | 728 |
| 211 | Ga0207674_10176221 | 3300026116 | Bacteria | 2090 |
| 212 | Ga0207683_10175114 | 3300026121 | Bacteria | 1944 |
| 213 | Ga0207683_10387046 | 3300026121 | Bacteria | 1286 |
| 214 | Ga0207683_11011728 | 3300026121 | Bacteria | 771 |
| 215 | Ga0207698_10051871 | 3300026142 | Bacteria | 3139 |
| 216 | Ga0207698_10279606 | 3300026142 | Bacteria | 1543 |
| 217 | Ga0207698_10712844 | 3300026142 | Bacteria | 999 |
| 218 | Ga0209589_1000002 | 3300027357 | Bacteria | 708598 |
| 219 | Ga0209489_100002 | 3300027361 | Bacteria | 708609 |
| 220 | Ga0209700_100002 | 3300027363 | Bacteria | 708598 |
| 221 | Ga0207428_10034034 | 3300027907 | Bacteria | 4178 |
| 222 | Ga0268266_10003694 | 3300028379 | Bacteria | 15090 |
| 223 | Ga0268266_10071874 | 3300028379 | Bacteria | 2999 |
| 224 | Ga0268266_10807836 | 3300028379 | Bacteria | 906 |
| 225 | Ga0268264_10000038 | 3300028381 | Bacteria | 383623 |
| 226 | Ga0268264_11220145 | 3300028381 | Bacteria | 762 |
| 227 | Ga0307517_10000124 | 3300028786 | Bacteria | 115570 |
| 228 | Ga0307515_10049656 | 3300028794 | Bacteria | 6303 |
| 229 | Ga0307511_10152782 | 3300030521 | Bacteria | 1320 |
| 230 | Ga0307513_10138368 | 3300031456 | Bacteria | 2366 |
| 231 | Ga0307513_10160247 | 3300031456 | Bacteria | 2144 |
| 232 | Ga0307509_10085524 | 3300031507 | Bacteria | 3245 |
| 233 | Ga0307509_10281016 | 3300031507 | Bacteria | 1425 |
| 234 | Ga0307508_10319396 | 3300031616 | Bacteria | 1144 |
| 235 | Ga0307514_10280967 | 3300031649 | Bacteria | 953 |
| 236 | Ga0307516_10007317 | 3300031730 | Bacteria | 12708 |
| 237 | Ga0307516_10007383 | 3300031730 | Bacteria | 12649 |
| 238 | Ga0307516_10011746 | 3300031730 | Bacteria | 9502 |
| 239 | Ga0307516_10329112 | 3300031730 | Bacteria | 1197 |
| 240 | Ga0307516_10337316 | 3300031730 | Bacteria | 1175 |
| 241 | Ga0307405_10981149 | 3300031731 | Bacteria | 720 |
| 242 | Ga0307406_10319877 | 3300031901 | Bacteria | 1200 |
| 243 | Ga0307412_10127444 | 3300031911 | Bacteria | 1843 |
| 244 | Ga0307416_101093329 | 3300032002 | Bacteria | 902 |
| 245 | Ga0307411_10998341 | 3300032005 | Bacteria | 749 |
| 246 | Ga0307415_100506890 | 3300032126 | Bacteria | 1056 |
| 247 | Ga0307415_101695517 | 3300032126 | Bacteria | 609 |
| 248 | Ga0307507_10026738 | 3300033179 | Bacteria | 6207 |
| 249 | Ga0307510_10019988 | 3300033180 | Bacteria | 7842 |
| 250 | Ga0307510_10321286 | 3300033180 | Bacteria | 1005 |
| 251 | Ga0315911_1000004 | 3300033442 | Bacteria | 472637 |
| 252 | Ga0316215_1025652 | 3300033544 | Bacteria | 606 |
| 253 | Ga0373945_0146590 | 3300035116 | Bacteria | 955 |
| 254 | Ga0373943_0357470 | 3300035170 | Bacteria | 838 |
| 255 | Ga0373946_0119144 | 3300035171 | Bacteria | 1203 |
| 256 | Ga0373946_0398952 | 3300035171 | Bacteria | 694 |
| 257 | Ga0373931_0014177 | 3300035691 | Bacteria | 3892 |
| 258 | Ga0373935_0080888 | 3300035692 | Bacteria | 2111 |
| 259 | Ga0373927_0044100 | 3300035695 | Bacteria | 2886 |
| 260 | Ga0373927_0082502 | 3300035695 | Bacteria | 2084 |
| 261 | Ga0373927_0096916 | 3300035695 | Bacteria | 1917 |
| 262 | Ga0373927_0181322 | 3300035695 | Bacteria | 1381 |
| 263 | Ga0373927_0309142 | 3300035695 | Bacteria | 1040 |
| 264 | Ga0373927_0931372 | 3300035695 | Bacteria | 573 |
| 265 | Ga0373947_1036503 | 3300035725 | Bacteria | 559 |
| 266 | Ga0372808_060860 | 3300036459 | Bacteria | 543 |
| 267 | Ga0373925_0228010 | 3300037068 | Bacteria | 1489 |
| 268 | Ga0395900_0051257 | 3300037418 | Bacteria | 4252 |
| 269 | Ga0395898_0029897 | 3300037466 | Bacteria | 5454 |
| 270 | Ga0395898_0875834 | 3300037466 | Bacteria | 837 |
| 271 | Ga0395901_0905295 | 3300038443 | Bacteria | 864 |
| 272 | Ga0395901_1327581 | 3300038443 | Bacteria | 680 |
| 273 | Ga0436365_0191297 | 3300039437 | Bacteria | 921 |
| 274 | Ga0436365_1281786 | 3300039437 | Bacteria | 1003 |
| 275 | Ga0436365_1725135 | 3300039437 | Bacteria | 3983 |
| 276 | Ga0436361_0391251 | 3300039447 | Bacteria | 3624 |
| 277 | Ga0436363_0070651 | 3300039450 | Bacteria | 537 |
| 278 | Ga0436363_0433273 | 3300039450 | Bacteria | 2506 |
| 279 | Ga0436362_1206612 | 3300039453 | Bacteria | 718 |
| 280 | Ga0439465_0082975 | 3300041413 | Bacteria | 1089 |
| 281 | Ga0451787_295617 | 3300041441 | Bacteria | 676 |
| 282 | Ga0451791_1419379 | 3300041451 | Bacteria | 833 |
| 283 | Ga0451800_0441647 | 3300041459 | Bacteria | 791 |
| 284 | Ga0451853_1660116 | 3300041512 | Bacteria | 753 |
| 285 | Ga0466966_0428339 | 3300044684 | Bacteria | 795 |
| 286 | Ga0466963_0492972 | 3300044694 | Bacteria | 865 |
| 287 | Ga0466964_0561755 | 3300044706 | Bacteria | 621 |
| 288 | Ga0466967_0127975 | 3300045976 | Bacteria | 2354 |
| 289 | Ga0495603_0095351 | 3300046455 | Bacteria | 1738 |
| 290 | Ga0495629_0422351 | 3300046459 | Bacteria | 905 |
| 291 | Ga0495629_0634298 | 3300046459 | Bacteria | 713 |
| 292 | Ga0495638_0134359 | 3300046460 | Bacteria | 1451 |
| 293 | Ga0495638_0476975 | 3300046460 | Bacteria | 632 |
| 294 | Ga0495641_0136498 | 3300046461 | Bacteria | 1095 |
| 295 | Ga0495582_0050235 | 3300046473 | Bacteria | 2298 |
| 296 | Ga0495639_0042249 | 3300046475 | Bacteria | 2056 |
| 297 | Ga0495584_0037069 | 3300046491 | Bacteria | 2463 |
| 298 | Ga0495608_0438937 | 3300046511 | Bacteria | 795 |
| 299 | Ga0495644_0049238 | 3300046523 | Bacteria | 1582 |
| 300 | Ga0495665_0027612 | 3300046531 | Bacteria | 3046 |
| 301 | Ga0495586_0214975 | 3300046535 | Bacteria | 1092 |
| 302 | Ga0495622_0011312 | 3300046557 | Bacteria | 4121 |
| 303 | Ga0495656_0097402 | 3300046615 | Bacteria | 1355 |
| 304 | Ga0495668_0145055 | 3300046616 | Bacteria | 1299 |
| 305 | Ga0495634_0304780 | 3300046642 | Bacteria | 962 |
| 306 | Ga0495625_0085517 | 3300046660 | Bacteria | 2189 |
| 307 | Ga0495659_0320510 | 3300046664 | Bacteria | 658 |
| 308 | Ga0495657_0330468 | 3300046675 | Bacteria | 905 |
| 309 | Ga0495599_0591430 | 3300046678 | Bacteria | 647 |
| 310 | Ga0495647_0341989 | 3300046681 | Bacteria | 680 |
| 311 | Ga0495658_0153635 | 3300046683 | Bacteria | 1415 |
| 312 | Ga0495658_0610358 | 3300046683 | Bacteria | 699 |
| 313 | Ga0495658_1105035 | 3300046683 | Bacteria | 505 |
| 314 | Ga0495669_0071987 | 3300046684 | Bacteria | 1577 |
| 315 | Ga0495613_0408939 | 3300046689 | Bacteria | 925 |
| 316 | Ga0495624_0410759 | 3300046690 | Bacteria | 812 |
| 317 | Ga0495649_0169623 | 3300046694 | Bacteria | 1142 |
| 318 | Ga0495581_0056236 | 3300047315 | Bacteria | 2271 |
| 319 | Ga0495581_0140005 | 3300047315 | Bacteria | 1411 |
| 320 | Ga0495604_0876549 | 3300047317 | Bacteria | 562 |
| 321 | Ga0495674_0118274 | 3300047319 | Bacteria | 2241 |
| 322 | Ga0495672_0022747 | 3300047320 | Bacteria | 4068 |
| 323 | Ga0495676_0805458 | 3300047321 | Bacteria | 605 |
| 324 | Ga0495677_0033796 | 3300047445 | Bacteria | 1864 |
| 325 | Ga0495673_0082230 | 3300047469 | Bacteria | 1332 |
| 326 | Ga0495686_0395568 | 3300047472 | Bacteria | 743 |
| 327 | Ga0495593_0374036 | 3300047673 | Bacteria | 712 |
| 328 | Ga0496100_0012355 | 3300048903 | Bacteria | 4893 |
| 329 | Ga0496101_0166337 | 3300048904 | Bacteria | 1693 |
| 330 | Ga0496101_0477148 | 3300048904 | Bacteria | 985 |
| 331 | Ga0496102_0003231 | 3300048905 | Bacteria | 13823 |
| 332 | Ga0496102_0144548 | 3300048905 | Bacteria | 2231 |
| 333 | Ga0496103_0089130 | 3300048906 | Bacteria | 1946 |
| 334 | Ga0496103_0227029 | 3300048906 | Bacteria | 1201 |
| 335 | Ga0496103_0328917 | 3300048906 | Bacteria | 983 |
| 336 | Ga0496104_0067184 | 3300048907 | Bacteria | 3405 |
| 337 | Ga0496104_0216155 | 3300048907 | Bacteria | 1828 |
| 338 | Ga0496105_0047792 | 3300048908 | Bacteria | 3531 |
| 339 | Ga0496105_0061167 | 3300048908 | Bacteria | 3107 |
| 340 | Ga0496105_0544956 | 3300048908 | Bacteria | 906 |
| 341 | Ga0496106_0000846 | 3300048909 | Bacteria | 22208 |
| 342 | Ga0496106_0048023 | 3300048909 | Bacteria | 3214 |
| 343 | Ga0496106_0196827 | 3300048909 | Bacteria | 1603 |
| 344 | Ga0496107_0012935 | 3300048910 | Bacteria | 5831 |
| 345 | Ga0496107_0104716 | 3300048910 | Bacteria | 2076 |
| 346 | Ga0496108_0065767 | 3300048911 | Bacteria | 3056 |
| 347 | Ga0496108_0198337 | 3300048911 | Bacteria | 1741 |
| 348 | Ga0496109_0008675 | 3300048912 | Bacteria | 8652 |
| 349 | Ga0496109_0600888 | 3300048912 | Bacteria | 1036 |
| 350 | Ga0496110_0050396 | 3300048913 | Bacteria | 3655 |
| 351 | Ga0496110_0086466 | 3300048913 | Bacteria | 2800 |
| 352 | Ga0496111_0257228 | 3300048914 | Bacteria | 1295 |
| 353 | Ga0496112_0019963 | 3300048915 | Bacteria | 6341 |
| 354 | Ga0496113_0047960 | 3300048916 | Bacteria | 3176 |
| 355 | Ga0496113_0102611 | 3300048916 | Bacteria | 2218 |
| 356 | Ga0496113_0668873 | 3300048916 | Bacteria | 830 |
| 357 | Ga0496114_0004884 | 3300048917 | Bacteria | 10442 |
| 358 | Ga0496115_0002667 | 3300048918 | Bacteria | 12802 |
| 359 | Ga0496115_0373133 | 3300048918 | Bacteria | 1161 |
| 360 | Ga0496117_0030192 | 3300048920 | Bacteria | 4163 |
| 361 | Ga0496118_0005969 | 3300048921 | Bacteria | 13587 |
| 362 | Ga0496121_0000099 | 3300048924 | Bacteria | 200160 |
| 363 | Ga0496121_0085559 | 3300048924 | Bacteria | 2481 |
| 364 | Ga0496121_0192628 | 3300048924 | Bacteria | 1460 |
| 365 | Ga0496124_0004730 | 3300048927 | Bacteria | 15715 |
| 366 | Ga0496125_0220966 | 3300048928 | Bacteria | 1221 |
| 367 | Ga0496126_0006199 | 3300048929 | Bacteria | 13378 |
| 368 | Ga0496126_0074638 | 3300048929 | Bacteria | 3011 |
| 369 | Ga0496126_0190586 | 3300048929 | Bacteria | 1737 |
| 370 | Ga0496126_0713897 | 3300048929 | Bacteria | 778 |
| 371 | Ga0495682_0279193 | 3300049460 | Bacteria | 590 |
| 372 | Ga0501042_0183199 | 3300049578 | Bacteria | 1511 |
| 373 | Ga0501067_0108645 | 3300049583 | Bacteria | 1542 |
| 374 | Ga0501071_0327068 | 3300049587 | Bacteria | 1165 |
| 375 | Ga0501073_0698816 | 3300049589 | Bacteria | 700 |
| 376 | Ga0501076_0140141 | 3300049592 | Bacteria | 1964 |
| 377 | Ga0501079_0699230 | 3300049741 | Bacteria | 798 |
| 378 | Ga0501035_0182643 | 3300049822 | Bacteria | 1807 |
| 379 | Ga0501044_0167456 | 3300049823 | Bacteria | 2171 |
| 380 | nmdc:mga03683_348339_c1 | 3300050489 | Bacteria | 701 |
| 381 | nmdc:mga03n38_10440_c1 | 3300050490 | Bacteria | 3416 |
| 382 | nmdc:mga03n38_178599_c1 | 3300050490 | Bacteria | 1086 |
| 383 | nmdc:mga03n38_30187_c1 | 3300050490 | Bacteria | 2276 |
| 384 | nmdc:mga00v17_251140_c1 | 3300050491 | Bacteria | 1147 |
| 385 | nmdc:mga00v17_66831_c1 | 3300050491 | Bacteria | 2220 |
| 386 | nmdc:mga0yw44_10911_c1 | 3300050492 | Bacteria | 4658 |
| 387 | nmdc:mga0yw44_370116_c1 | 3300050492 | Bacteria | 967 |
| 388 | nmdc:mga06z11_207028_c1 | 3300050494 | Bacteria | 1142 |
| 389 | nmdc:mga06z11_207311_c1 | 3300050494 | Bacteria | 1141 |
| 390 | nmdc:mga06z11_301135_c1 | 3300050494 | Bacteria | 953 |
| 391 | nmdc:mga06z11_48930_c1 | 3300050494 | Bacteria | 2154 |
| 392 | nmdc:mga04h51_3126_c1 | 3300050495 | Bacteria | 3994 |
| 393 | nmdc:mga07m45_4680_c1 | 3300050496 | Bacteria | 6717 |
| 394 | nmdc:mga07m45_67326_c1 | 3300050496 | Bacteria | 2035 |
| 395 | nmdc:mga0sz30_503550_c1 | 3300050516 | Bacteria | 545 |
| 396 | Ga0495601_0594352 | 3300053077 | Bacteria | 710 |
| 397 | Ga0495612_0054462 | 3300053078 | Bacteria | 1648 |
| 398 | Ga0500635_0012677 | 3300053080 | Bacteria | 2428 |
| 399 | Ga0495595_0012629 | 3300053084 | Bacteria | 3554 |
| 400 | Ga0495619_0004132 | 3300053085 | Bacteria | 9278 |
| 401 | Ga0495619_0465465 | 3300053085 | Bacteria | 871 |
| 402 | Ga0500647_0298472 | 3300053091 | Bacteria | 690 |
| 403 | Ga0500651_0423997 | 3300053093 | Bacteria | 744 |
| 404 | Ga0500566_0050480 | 3300053094 | Bacteria | 2382 |
| 405 | Ga0500566_0067401 | 3300053094 | Bacteria | 2015 |
| 406 | Ga0500648_123471 | 3300053097 | Bacteria | 1415 |
| 407 | Ga0500554_001888 | 3300053102 | Bacteria | 4056 |
| 408 | Ga0500595_000660 | 3300053119 | Bacteria | 20694 |
| 409 | Ga0500595_012400 | 3300053119 | Bacteria | 3298 |
| 410 | Ga0500597_063843 | 3300053120 | Bacteria | 1585 |
| 411 | Ga0500559_0154134 | 3300053136 | Bacteria | 1079 |
| 412 | Ga0500568_0049672 | 3300053139 | Bacteria | 1655 |
| 413 | Ga0500573_0262438 | 3300053140 | Bacteria | 883 |
| 414 | Ga0500577_0058641 | 3300053142 | Bacteria | 1473 |
| 415 | Ga0500590_234296 | 3300053148 | Bacteria | 745 |
| 416 | Ga0500603_052099 | 3300053150 | Bacteria | 1123 |
| 417 | Ga0500603_057075 | 3300053150 | Bacteria | 1083 |
| 418 | Ga0500604_0196082 | 3300053151 | Bacteria | 694 |
| 419 | Ga0500627_0339019 | 3300053158 | Bacteria | 650 |
| 420 | Ga0500638_084153 | 3300053162 | Bacteria | 1507 |
| 421 | Ga0500636_0105937 | 3300053177 | Bacteria | 1593 |
| 422 | Ga0500636_0106914 | 3300053177 | Bacteria | 1585 |
| 423 | Ga0500636_0178780 | 3300053177 | Bacteria | 1141 |
| 424 | Ga0500637_0001532 | 3300053178 | Bacteria | 9873 |
| 425 | Ga0500596_004903 | 3300053735 | Bacteria | 2408 |
| 426 | Ga0500661_001928 | 3300055283 | Bacteria | 3914 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2524023228 | 2524539670 | 132 |
| 2 | iso_pu_bacteria | 2791355197 | 2793073907 | 132 |
| 3 | iso_pu_bacteria | 2904699407 | 2904710967 | 132 |
| 4 | iso_pu_bacteria | 2906610324 | 2906615880 | 132 |
| 5 | iso_pu_bacteria | 2906635258 | 2906639790 | 132 |
| 6 | iso_pu_bacteria | 2906660503 | 2906662040 | 132 |
| 7 | iso_pu_bacteria | 2935630451 | 2935630993 | 132 |
| 8 | iso_pu_bacteria | 2941507105 | 2941507645 | 132 |
| 9 | iso_pu_bacteria | 2941515067 | 2941516072 | 132 |
| 10 | iso_pu_bacteria | 2941523033 | 2941523220 | 132 |
| 11 | iso_pu_bacteria | 8006933436 | 8006934580 | 132 |
| 12 | iso_pu_bacteria | 8006973647 | 8006974550 | 132 |
| 13 | iso_pu_bacteria | 8019555841 | 8019564088 | 132 |
| 14 | iso_pu_bacteria | 8019565922 | 8019574163 | 132 |
| 15 | 3300006038 | Ga0075365_10082161 | Ga0075365_100821613 | 133 |
| 16 | 3300005718 | Ga0068866_10281874 | Ga0068866_102818742 | 134 |
| 17 | 3300006941 | Ga0099825_1030153 | Ga0099825_10301532 | 136 |
| 18 | 3300006943 | Ga0099822_1007120 | Ga0099822_100712010 | 136 |
| 19 | 3300021377 | Ga0213874_10030794 | Ga0213874_100307943 | 136 |
| 20 | 3300025261 | Ga0209233_1014953 | Ga0209233_10149532 | 136 |
| 21 | 3300027357 | Ga0209589_1000002 | Ga0209589_100000292 | 136 |
| 22 | 3300027361 | Ga0209489_100002 | Ga0209489_10000292 | 136 |
| 23 | 3300027363 | Ga0209700_100002 | Ga0209700_10000292 | 136 |
| 24 | 3300032002 | Ga0307416_101093329 | Ga0307416_1010933292 | 136 |
| 25 | 3300033442 | Ga0315911_1000004 | Ga0315911_1000004268 | 136 |
| 26 | 3300039437 | Ga0436365_1281786 | Ga0436365_1281786_133_543 | 136 |
| 27 | 3300039450 | Ga0436363_0433273 | Ga0436363_0433273_1672_2082 | 136 |
| 28 | 3300048929 | Ga0496126_0190586 | Ga0496126_0190586_12_422 | 136 |
| 29 | iso_pu_bacteria | 8056689827 | 8056695663 | 136 |
| 30 | 3300005937 | Ga0081455_10077863 | Ga0081455_100778633 | 137 |
| 31 | 3300005983 | Ga0081540_1049223 | Ga0081540_10492232 | 137 |
| 32 | 3300014326 | Ga0157380_11370266 | Ga0157380_113702662 | 137 |
| 33 | iso_pu_bacteria | 2513237101 | 2513696446 | 137 |
| 34 | iso_pu_bacteria | 2721755755 | 2723842950 | 137 |
| 35 | iso_pu_bacteria | 2879110137 | 2879114291 | 137 |
| 36 | iso_pu_bacteria | 2922386360 | 2922390109 | 137 |
| 37 | 3300005329 | Ga0070683_100101130 | Ga0070683_1001011303 | 138 |
| 38 | 3300005336 | Ga0070680_101223515 | Ga0070680_1012235151 | 138 |
| 39 | 3300005337 | Ga0070682_100299244 | Ga0070682_1002992441 | 138 |
| 40 | 3300005338 | Ga0068868_100401824 | Ga0068868_1004018242 | 138 |
| 41 | 3300005355 | Ga0070671_101529624 | Ga0070671_1015296241 | 138 |
| 42 | 3300005356 | Ga0070674_100359666 | Ga0070674_1003596662 | 138 |
| 43 | 3300005365 | Ga0070688_100051288 | Ga0070688_1000512882 | 138 |
| 44 | 3300005435 | Ga0070714_100062425 | Ga0070714_1000624253 | 138 |
| 45 | 3300005436 | Ga0070713_100064529 | Ga0070713_1000645293 | 138 |
| 46 | 3300005436 | Ga0070713_100114574 | Ga0070713_1001145743 | 138 |
| 47 | 3300005437 | Ga0070710_10204687 | Ga0070710_102046872 | 138 |
| 48 | 3300005439 | Ga0070711_100035068 | Ga0070711_1000350681 | 138 |
| 49 | 3300005456 | Ga0070678_102342555 | Ga0070678_1023425551 | 138 |
| 50 | 3300005458 | Ga0070681_10121663 | Ga0070681_101216632 | 138 |
| 51 | 3300005458 | Ga0070681_10542311 | Ga0070681_105423112 | 138 |
| 52 | 3300005530 | Ga0070679_100016478 | Ga0070679_1000164785 | 138 |
| 53 | 3300005530 | Ga0070679_100728471 | Ga0070679_1007284712 | 138 |
| 54 | 3300005530 | Ga0070679_101750600 | Ga0070679_1017506001 | 138 |
| 55 | 3300005535 | Ga0070684_100062555 | Ga0070684_1000625552 | 138 |
| 56 | 3300005535 | Ga0070684_100545821 | Ga0070684_1005458211 | 138 |
| 57 | 3300005539 | Ga0068853_101370335 | Ga0068853_1013703351 | 138 |
| 58 | 3300005563 | Ga0068855_100077435 | Ga0068855_1000774353 | 138 |
| 59 | 3300005577 | Ga0068857_100255596 | Ga0068857_1002555961 | 138 |
| 60 | 3300005578 | Ga0068854_100120150 | Ga0068854_1001201501 | 138 |
| 61 | 3300005614 | Ga0068856_100303659 | Ga0068856_1003036592 | 138 |
| 62 | 3300005614 | Ga0068856_100314617 | Ga0068856_1003146172 | 138 |
| 63 | 3300005616 | Ga0068852_100058058 | Ga0068852_1000580582 | 138 |
| 64 | 3300006038 | Ga0075365_10001096 | Ga0075365_100010964 | 138 |
| 65 | 3300006175 | Ga0070712_100078247 | Ga0070712_1000782473 | 138 |
| 66 | 3300006178 | Ga0075367_10038683 | Ga0075367_100386832 | 138 |
| 67 | 3300009174 | Ga0105241_10348985 | Ga0105241_103489852 | 138 |
| 68 | 3300009174 | Ga0105241_10624660 | Ga0105241_106246602 | 138 |
| 69 | 3300009545 | Ga0105237_10500984 | Ga0105237_105009842 | 138 |
| 70 | 3300009551 | Ga0105238_10270007 | Ga0105238_102700072 | 138 |
| 71 | 3300009553 | Ga0105249_10389612 | Ga0105249_103896122 | 138 |
| 72 | 3300013105 | Ga0157369_10002654 | Ga0157369_1000265414 | 138 |
| 73 | 3300013307 | Ga0157372_10115973 | Ga0157372_101159731 | 138 |
| 74 | 3300014325 | Ga0163163_10239251 | Ga0163163_102392512 | 138 |
| 75 | 3300014969 | Ga0157376_11412756 | Ga0157376_114127562 | 138 |
| 76 | 3300020070 | Ga0206356_10214755 | Ga0206356_102147552 | 138 |
| 77 | 3300021384 | Ga0213876_10247041 | Ga0213876_102470412 | 138 |
| 78 | 3300022467 | Ga0224712_10378100 | Ga0224712_103781001 | 138 |
| 79 | 3300025906 | Ga0207699_10075606 | Ga0207699_100756062 | 138 |
| 80 | 3300025911 | Ga0207654_10414278 | Ga0207654_104142782 | 138 |
| 81 | 3300025912 | Ga0207707_10008703 | Ga0207707_1000870311 | 138 |
| 82 | 3300025912 | Ga0207707_10016072 | Ga0207707_100160724 | 138 |
| 83 | 3300025913 | Ga0207695_10145468 | Ga0207695_101454682 | 138 |
| 84 | 3300025914 | Ga0207671_10287276 | Ga0207671_102872762 | 138 |
| 85 | 3300025915 | Ga0207693_10199556 | Ga0207693_101995562 | 138 |
| 86 | 3300025916 | Ga0207663_10680666 | Ga0207663_106806662 | 138 |
| 87 | 3300025921 | Ga0207652_10203197 | Ga0207652_102031971 | 138 |
| 88 | 3300025921 | Ga0207652_10883489 | Ga0207652_108834892 | 138 |
| 89 | 3300025924 | Ga0207694_10313122 | Ga0207694_103131222 | 138 |
| 90 | 3300025928 | Ga0207700_10103457 | Ga0207700_101034572 | 138 |
| 91 | 3300025928 | Ga0207700_10342819 | Ga0207700_103428192 | 138 |
| 92 | 3300025929 | Ga0207664_10057187 | Ga0207664_100571873 | 138 |
| 93 | 3300025944 | Ga0207661_10016193 | Ga0207661_100161932 | 138 |
| 94 | 3300025949 | Ga0207667_10270684 | Ga0207667_102706842 | 138 |
| 95 | 3300025981 | Ga0207640_10244038 | Ga0207640_102440382 | 138 |
| 96 | 3300026023 | Ga0207677_11082832 | Ga0207677_110828323 | 138 |
| 97 | 3300026041 | Ga0207639_10105338 | Ga0207639_101053383 | 138 |
| 98 | 3300026041 | Ga0207639_11476185 | Ga0207639_114761851 | 138 |
| 99 | 3300026078 | Ga0207702_10125918 | Ga0207702_101259182 | 138 |
| 100 | 3300026078 | Ga0207702_10259466 | Ga0207702_102594662 | 138 |
| 101 | 3300026116 | Ga0207674_10176221 | Ga0207674_101762213 | 138 |
| 102 | 3300026142 | Ga0207698_10279606 | Ga0207698_102796062 | 138 |
| 103 | 3300035171 | Ga0373946_0119144 | Ga0373946_0119144_720_1136 | 138 |
| 104 | 3300035695 | Ga0373927_0044100 | Ga0373927_0044100_1280_1696 | 138 |
| 105 | 3300035695 | Ga0373927_0309142 | Ga0373927_0309142_168_584 | 138 |
| 106 | 3300035695 | Ga0373927_0931372 | Ga0373927_0931372_44_460 | 138 |
| 107 | 3300035725 | Ga0373947_1036503 | Ga0373947_1036503_82_498 | 138 |
| 108 | 3300037418 | Ga0395900_0051257 | Ga0395900_0051257_1974_2390 | 138 |
| 109 | 3300037466 | Ga0395898_0029897 | Ga0395898_0029897_4368_4784 | 138 |
| 110 | 3300037466 | Ga0395898_0875834 | Ga0395898_0875834_109_525 | 138 |
| 111 | 3300038443 | Ga0395901_0905295 | Ga0395901_0905295_349_765 | 138 |
| 112 | 3300038443 | Ga0395901_1327581 | Ga0395901_1327581_245_661 | 138 |
| 113 | 3300039437 | Ga0436365_0191297 | Ga0436365_0191297_319_735 | 138 |
| 114 | 3300039437 | Ga0436365_1725135 | Ga0436365_1725135_2256_2672 | 138 |
| 115 | 3300039450 | Ga0436363_0070651 | Ga0436363_0070651_38_460 | 138 |
| 116 | 3300039453 | Ga0436362_1206612 | Ga0436362_1206612_173_589 | 138 |
| 117 | 3300044684 | Ga0466966_0428339 | Ga0466966_0428339_93_509 | 138 |
| 118 | 3300044694 | Ga0466963_0492972 | Ga0466963_0492972_138_554 | 138 |
| 119 | 3300044706 | Ga0466964_0561755 | Ga0466964_0561755_11_427 | 138 |
| 120 | 3300045976 | Ga0466967_0127975 | Ga0466967_0127975_1741_2157 | 138 |
| 121 | 3300046455 | Ga0495603_0095351 | Ga0495603_0095351_938_1354 | 138 |
| 122 | 3300046531 | Ga0495665_0027612 | Ga0495665_0027612_465_881 | 138 |
| 123 | 3300046642 | Ga0495634_0304780 | Ga0495634_0304780_474_890 | 138 |
| 124 | 3300046681 | Ga0495647_0341989 | Ga0495647_0341989_54_470 | 138 |
| 125 | 3300046683 | Ga0495658_0153635 | Ga0495658_0153635_862_1278 | 138 |
| 126 | 3300047315 | Ga0495581_0140005 | Ga0495581_0140005_181_597 | 138 |
| 127 | 3300047317 | Ga0495604_0876549 | Ga0495604_0876549_116_532 | 138 |
| 128 | 3300047320 | Ga0495672_0022747 | Ga0495672_0022747_1802_2218 | 138 |
| 129 | 3300048929 | Ga0496126_0713897 | Ga0496126_0713897_323_739 | 138 |
| 130 | 3300049587 | Ga0501071_0327068 | Ga0501071_0327068_447_863 | 138 |
| 131 | 3300050490 | nmdc:mga03n38_178599_c1 | nmdc:mga03n38_178599_c1_586_1002 | 138 |
| 132 | 3300050491 | nmdc:mga00v17_251140_c1 | nmdc:mga00v17_251140_c1_128_544 | 138 |
| 133 | 3300050494 | nmdc:mga06z11_48930_c1 | nmdc:mga06z11_48930_c1_437_853 | 138 |
| 134 | 3300053078 | Ga0495612_0054462 | Ga0495612_0054462_1060_1476 | 138 |
| 135 | 3300053085 | Ga0495619_0465465 | Ga0495619_0465465_383_799 | 138 |
| 136 | 3300005338 | Ga0068868_101183526 | Ga0068868_1011835261 | 139 |
| 137 | 3300005539 | Ga0068853_100680899 | Ga0068853_1006808992 | 139 |
| 138 | 3300005841 | Ga0068863_100044445 | Ga0068863_1000444452 | 139 |
| 139 | 3300005842 | Ga0068858_100919054 | Ga0068858_1009190542 | 139 |
| 140 | 3300005843 | Ga0068860_100000135 | Ga0068860_100000135104 | 139 |
| 141 | 3300005983 | Ga0081540_1070113 | Ga0081540_10701133 | 139 |
| 142 | 3300006186 | Ga0075369_10300648 | Ga0075369_103006482 | 139 |
| 143 | 3300006237 | Ga0097621_100195212 | Ga0097621_1001952122 | 139 |
| 144 | 3300006358 | Ga0068871_100248111 | Ga0068871_1002481112 | 139 |
| 145 | 3300009101 | Ga0105247_10004773 | Ga0105247_1000477310 | 139 |
| 146 | 3300011119 | Ga0105246_10091504 | Ga0105246_100915043 | 139 |
| 147 | 3300025900 | Ga0207710_10041520 | Ga0207710_100415202 | 139 |
| 148 | 3300025915 | Ga0207693_11176369 | Ga0207693_111763692 | 139 |
| 149 | 3300025916 | Ga0207663_10284038 | Ga0207663_102840382 | 139 |
| 150 | 3300026035 | Ga0207703_10556288 | Ga0207703_105562882 | 139 |
| 151 | 3300026088 | Ga0207641_10757999 | Ga0207641_107579991 | 139 |
| 152 | 3300028381 | Ga0268264_10000038 | Ga0268264_10000038180 | 139 |
| 153 | 3300028381 | Ga0268264_11220145 | Ga0268264_112201452 | 139 |
| 154 | 3300030521 | Ga0307511_10152782 | Ga0307511_101527822 | 139 |
| 155 | 3300031507 | Ga0307509_10281016 | Ga0307509_102810161 | 139 |
| 156 | 3300031616 | Ga0307508_10319396 | Ga0307508_103193962 | 139 |
| 157 | 3300031730 | Ga0307516_10007383 | Ga0307516_1000738314 | 139 |
| 158 | 3300031730 | Ga0307516_10329112 | Ga0307516_103291122 | 139 |
| 159 | 3300031730 | Ga0307516_10337316 | Ga0307516_103373162 | 139 |
| 160 | 3300031901 | Ga0307406_10319877 | Ga0307406_103198772 | 139 |
| 161 | 3300032126 | Ga0307415_101695517 | Ga0307415_1016955171 | 139 |
| 162 | 3300033179 | Ga0307507_10026738 | Ga0307507_100267386 | 139 |
| 163 | 3300033180 | Ga0307510_10321286 | Ga0307510_103212862 | 139 |
| 164 | 3300035116 | Ga0373945_0146590 | Ga0373945_0146590_42_461 | 139 |
| 165 | 3300035171 | Ga0373946_0398952 | Ga0373946_0398952_112_531 | 139 |
| 166 | 3300035692 | Ga0373935_0080888 | Ga0373935_0080888_826_1245 | 139 |
| 167 | 3300046459 | Ga0495629_0422351 | Ga0495629_0422351_44_463 | 139 |
| 168 | 3300046461 | Ga0495641_0136498 | Ga0495641_0136498_424_843 | 139 |
| 169 | 3300046557 | Ga0495622_0011312 | Ga0495622_0011312_581_1000 | 139 |
| 170 | 3300046678 | Ga0495599_0591430 | Ga0495599_0591430_195_614 | 139 |
| 171 | 3300046683 | Ga0495658_0610358 | Ga0495658_0610358_43_462 | 139 |
| 172 | 3300048906 | Ga0496103_0227029 | Ga0496103_0227029_392_811 | 139 |
| 173 | 3300048909 | Ga0496106_0000846 | Ga0496106_0000846_6334_6753 | 139 |
| 174 | 3300048920 | Ga0496117_0030192 | Ga0496117_0030192_541_960 | 139 |
| 175 | 3300048921 | Ga0496118_0005969 | Ga0496118_0005969_2495_2914 | 139 |
| 176 | 3300048924 | Ga0496121_0000099 | Ga0496121_0000099_114159_114578 | 139 |
| 177 | 3300048924 | Ga0496121_0192628 | Ga0496121_0192628_583_1002 | 139 |
| 178 | 3300048927 | Ga0496124_0004730 | Ga0496124_0004730_11151_11570 | 139 |
| 179 | 3300048929 | Ga0496126_0006199 | Ga0496126_0006199_1669_2088 | 139 |
| 180 | 3300048929 | Ga0496126_0074638 | Ga0496126_0074638_699_1118 | 139 |
| 181 | 3300053080 | Ga0500635_0012677 | Ga0500635_0012677_724_1143 | 139 |
| 182 | 3300053091 | Ga0500647_0298472 | Ga0500647_0298472_162_581 | 139 |
| 183 | 3300053094 | Ga0500566_0067401 | Ga0500566_0067401_1191_1610 | 139 |
| 184 | 3300053097 | Ga0500648_123471 | Ga0500648_123471_202_621 | 139 |
| 185 | 3300053136 | Ga0500559_0154134 | Ga0500559_0154134_281_700 | 139 |
| 186 | 3300053140 | Ga0500573_0262438 | Ga0500573_0262438_165_584 | 139 |
| 187 | 3300053148 | Ga0500590_234296 | Ga0500590_234296_169_588 | 139 |
| 188 | 3300053150 | Ga0500603_052099 | Ga0500603_052099_240_659 | 139 |
| 189 | 3300053162 | Ga0500638_084153 | Ga0500638_084153_122_541 | 139 |
| 190 | 3300053177 | Ga0500636_0105937 | Ga0500636_0105937_947_1366 | 139 |
| 191 | 3300053177 | Ga0500636_0106914 | Ga0500636_0106914_222_641 | 139 |
| 192 | 3300053735 | Ga0500596_004903 | Ga0500596_004903_1690_2109 | 139 |
| 193 | 3300005337 | Ga0070682_100058498 | Ga0070682_1000584982 | 140 |
| 194 | 3300005338 | Ga0068868_100009479 | Ga0068868_1000094794 | 140 |
| 195 | 3300005339 | Ga0070660_101769625 | Ga0070660_1017696251 | 140 |
| 196 | 3300005355 | Ga0070671_100791171 | Ga0070671_1007911711 | 140 |
| 197 | 3300005455 | Ga0070663_100085680 | Ga0070663_1000856804 | 140 |
| 198 | 3300005456 | Ga0070678_100214800 | Ga0070678_1002148001 | 140 |
| 199 | 3300005535 | Ga0070684_100250530 | Ga0070684_1002505302 | 140 |
| 200 | 3300005547 | Ga0070693_100122484 | Ga0070693_1001224842 | 140 |
| 201 | 3300005564 | Ga0070664_100050577 | Ga0070664_1000505774 | 140 |
| 202 | 3300005616 | Ga0068852_100103550 | Ga0068852_1001035504 | 140 |
| 203 | 3300005618 | Ga0068864_100442215 | Ga0068864_1004422152 | 140 |
| 204 | 3300005842 | Ga0068858_100751889 | Ga0068858_1007518893 | 140 |
| 205 | 3300006237 | Ga0097621_100034861 | Ga0097621_1000348614 | 140 |
| 206 | 3300006358 | Ga0068871_100137171 | Ga0068871_1001371713 | 140 |
| 207 | 3300006881 | Ga0068865_100215045 | Ga0068865_1002150452 | 140 |
| 208 | 3300009098 | Ga0105245_10009440 | Ga0105245_100094409 | 140 |
| 209 | 3300009101 | Ga0105247_10209790 | Ga0105247_102097902 | 140 |
| 210 | 3300009176 | Ga0105242_10194595 | Ga0105242_101945951 | 140 |
| 211 | 3300009551 | Ga0105238_10461986 | Ga0105238_104619862 | 140 |
| 212 | 3300010375 | Ga0105239_10073958 | Ga0105239_100739584 | 140 |
| 213 | 3300011119 | Ga0105246_10336439 | Ga0105246_103364391 | 140 |
| 214 | 3300011119 | Ga0105246_10779972 | Ga0105246_107799721 | 140 |
| 215 | 3300013296 | Ga0157374_10100928 | Ga0157374_101009283 | 140 |
| 216 | 3300013297 | Ga0157378_10034647 | Ga0157378_100346474 | 140 |
| 217 | 3300013306 | Ga0163162_10050431 | Ga0163162_100504314 | 140 |
| 218 | 3300013308 | Ga0157375_10026957 | Ga0157375_100269576 | 140 |
| 219 | 3300014325 | Ga0163163_10006739 | Ga0163163_100067396 | 140 |
| 220 | 3300014745 | Ga0157377_10162667 | Ga0157377_101626672 | 140 |
| 221 | 3300014968 | Ga0157379_10524050 | Ga0157379_105240502 | 140 |
| 222 | 3300014969 | Ga0157376_10108553 | Ga0157376_101085532 | 140 |
| 223 | 3300021361 | Ga0213872_10076119 | Ga0213872_100761192 | 140 |
| 224 | 3300025934 | Ga0207686_10657555 | Ga0207686_106575551 | 140 |
| 225 | 3300025938 | Ga0207704_10243649 | Ga0207704_102436492 | 140 |
| 226 | 3300026023 | Ga0207677_10024150 | Ga0207677_100241504 | 140 |
| 227 | 3300026041 | Ga0207639_10342310 | Ga0207639_103423102 | 140 |
| 228 | 3300026067 | Ga0207678_10060777 | Ga0207678_100607774 | 140 |
| 229 | 3300026078 | Ga0207702_10299087 | Ga0207702_102990874 | 140 |
| 230 | 3300026121 | Ga0207683_11011728 | Ga0207683_110117281 | 140 |
| 231 | 3300026142 | Ga0207698_10051871 | Ga0207698_100518713 | 140 |
| 232 | 3300031731 | Ga0307405_10981149 | Ga0307405_109811492 | 140 |
| 233 | 3300032005 | Ga0307411_10998341 | Ga0307411_109983411 | 140 |
| 234 | 3300039447 | Ga0436361_0391251 | Ga0436361_0391251_1250_1672 | 140 |
| 235 | 3300041441 | Ga0451787_295617 | Ga0451787_295617_49_471 | 140 |
| 236 | 3300041459 | Ga0451800_0441647 | Ga0451800_0441647_238_660 | 140 |
| 237 | 3300046675 | Ga0495657_0330468 | Ga0495657_0330468_255_677 | 140 |
| 238 | 3300048903 | Ga0496100_0012355 | Ga0496100_0012355_3980_4402 | 140 |
| 239 | 3300048905 | Ga0496102_0003231 | Ga0496102_0003231_10392_10814 | 140 |
| 240 | 3300048907 | Ga0496104_0067184 | Ga0496104_0067184_214_636 | 140 |
| 241 | 3300048908 | Ga0496105_0061167 | Ga0496105_0061167_1812_2234 | 140 |
| 242 | 3300048909 | Ga0496106_0196827 | Ga0496106_0196827_797_1219 | 140 |
| 243 | 3300048910 | Ga0496107_0012935 | Ga0496107_0012935_703_1125 | 140 |
| 244 | 3300048911 | Ga0496108_0065767 | Ga0496108_0065767_2079_2501 | 140 |
| 245 | 3300048912 | Ga0496109_0008675 | Ga0496109_0008675_5184_5606 | 140 |
| 246 | 3300048913 | Ga0496110_0086466 | Ga0496110_0086466_1904_2326 | 140 |
| 247 | 3300048916 | Ga0496113_0102611 | Ga0496113_0102611_1435_1857 | 140 |
| 248 | 3300048917 | Ga0496114_0004884 | Ga0496114_0004884_9397_9819 | 140 |
| 249 | 3300048918 | Ga0496115_0002667 | Ga0496115_0002667_5429_5851 | 140 |
| 250 | 3300053093 | Ga0500651_0423997 | Ga0500651_0423997_146_568 | 140 |
| 251 | 3300053094 | Ga0500566_0050480 | Ga0500566_0050480_477_899 | 140 |
| 252 | 3300053102 | Ga0500554_001888 | Ga0500554_001888_2550_2972 | 140 |
| 253 | 3300053119 | Ga0500595_000660 | Ga0500595_000660_16805_17227 | 140 |
| 254 | 3300053150 | Ga0500603_057075 | Ga0500603_057075_527_949 | 140 |
| 255 | 3300053177 | Ga0500636_0178780 | Ga0500636_0178780_236_658 | 140 |
| 256 | 3300053178 | Ga0500637_0001532 | Ga0500637_0001532_8933_9355 | 140 |
| 257 | 3300055283 | Ga0500661_001928 | Ga0500661_001928_2643_3065 | 140 |
| 258 | 3300005293 | Ga0065715_10423421 | Ga0065715_104234211 | 141 |
| 259 | 3300005340 | Ga0070689_101596766 | Ga0070689_1015967661 | 141 |
| 260 | 3300005343 | Ga0070687_100383457 | Ga0070687_1003834572 | 141 |
| 261 | 3300005347 | Ga0070668_100097206 | Ga0070668_1000972064 | 141 |
| 262 | 3300005355 | Ga0070671_100846012 | Ga0070671_1008460122 | 141 |
| 263 | 3300005356 | Ga0070674_100173066 | Ga0070674_1001730662 | 141 |
| 264 | 3300005367 | Ga0070667_101392877 | Ga0070667_1013928771 | 141 |
| 265 | 3300005435 | Ga0070714_101077046 | Ga0070714_1010770461 | 141 |
| 266 | 3300005445 | Ga0070708_100207938 | Ga0070708_1002079382 | 141 |
| 267 | 3300005455 | Ga0070663_100025740 | Ga0070663_1000257404 | 141 |
| 268 | 3300005455 | Ga0070663_100242743 | Ga0070663_1002427432 | 141 |
| 269 | 3300005455 | Ga0070663_100731575 | Ga0070663_1007315752 | 141 |
| 270 | 3300005455 | Ga0070663_101447115 | Ga0070663_1014471151 | 141 |
| 271 | 3300005456 | Ga0070678_100909241 | Ga0070678_1009092411 | 141 |
| 272 | 3300005539 | Ga0068853_100413526 | Ga0068853_1004135262 | 141 |
| 273 | 3300005539 | Ga0068853_101028121 | Ga0068853_1010281211 | 141 |
| 274 | 3300005539 | Ga0068853_101770216 | Ga0068853_1017702161 | 141 |
| 275 | 3300005543 | Ga0070672_100279899 | Ga0070672_1002798992 | 141 |
| 276 | 3300005547 | Ga0070693_100198708 | Ga0070693_1001987082 | 141 |
| 277 | 3300005548 | Ga0070665_100034649 | Ga0070665_1000346492 | 141 |
| 278 | 3300005548 | Ga0070665_100056456 | Ga0070665_1000564564 | 141 |
| 279 | 3300005548 | Ga0070665_100332646 | Ga0070665_1003326461 | 141 |
| 280 | 3300005548 | Ga0070665_100672139 | Ga0070665_1006721392 | 141 |
| 281 | 3300005564 | Ga0070664_100090557 | Ga0070664_1000905572 | 141 |
| 282 | 3300005616 | Ga0068852_100549064 | Ga0068852_1005490642 | 141 |
| 283 | 3300005718 | Ga0068866_10578946 | Ga0068866_105789462 | 141 |
| 284 | 3300005841 | Ga0068863_101363107 | Ga0068863_1013631071 | 141 |
| 285 | 3300005981 | Ga0081538_10055572 | Ga0081538_100555722 | 141 |
| 286 | 3300005983 | Ga0081540_1006530 | Ga0081540_10065302 | 141 |
| 287 | 3300005983 | Ga0081540_1082347 | Ga0081540_10823471 | 141 |
| 288 | 3300005985 | Ga0081539_10034446 | Ga0081539_100344464 | 141 |
| 289 | 3300006038 | Ga0075365_10030500 | Ga0075365_100305001 | 141 |
| 290 | 3300006038 | Ga0075365_10043087 | Ga0075365_100430875 | 141 |
| 291 | 3300006038 | Ga0075365_10048537 | Ga0075365_100485374 | 141 |
| 292 | 3300006038 | Ga0075365_10253300 | Ga0075365_102533002 | 141 |
| 293 | 3300006038 | Ga0075365_10680959 | Ga0075365_106809592 | 141 |
| 294 | 3300006042 | Ga0075368_10116587 | Ga0075368_101165872 | 141 |
| 295 | 3300006048 | Ga0075363_100047766 | Ga0075363_1000477666 | 141 |
| 296 | 3300006051 | Ga0075364_10068654 | Ga0075364_100686542 | 141 |
| 297 | 3300006051 | Ga0075364_10417615 | Ga0075364_104176152 | 141 |
| 298 | 3300006058 | Ga0075432_10017477 | Ga0075432_100174773 | 141 |
| 299 | 3300006178 | Ga0075367_10071359 | Ga0075367_100713593 | 141 |
| 300 | 3300006178 | Ga0075367_10164934 | Ga0075367_101649344 | 141 |
| 301 | 3300006186 | Ga0075369_10074129 | Ga0075369_100741292 | 141 |
| 302 | 3300006237 | Ga0097621_100936534 | Ga0097621_1009365342 | 141 |
| 303 | 3300006237 | Ga0097621_101029499 | Ga0097621_1010294991 | 141 |
| 304 | 3300006353 | Ga0075370_10019137 | Ga0075370_100191372 | 141 |
| 305 | 3300006353 | Ga0075370_10107685 | Ga0075370_101076852 | 141 |
| 306 | 3300009101 | Ga0105247_10548312 | Ga0105247_105483122 | 141 |
| 307 | 3300009148 | Ga0105243_10672200 | Ga0105243_106722002 | 141 |
| 308 | 3300009177 | Ga0105248_10045447 | Ga0105248_100454477 | 141 |
| 309 | 3300009177 | Ga0105248_10073969 | Ga0105248_100739694 | 141 |
| 310 | 3300009545 | Ga0105237_10117488 | Ga0105237_101174883 | 141 |
| 311 | 3300009545 | Ga0105237_11369205 | Ga0105237_113692051 | 141 |
| 312 | 3300009551 | Ga0105238_10152595 | Ga0105238_101525954 | 141 |
| 313 | 3300009551 | Ga0105238_10594827 | Ga0105238_105948271 | 141 |
| 314 | 3300009551 | Ga0105238_11256100 | Ga0105238_112561001 | 141 |
| 315 | 3300010159 | Ga0099796_10091360 | Ga0099796_100913602 | 141 |
| 316 | 3300010159 | Ga0099796_10128523 | Ga0099796_101285232 | 141 |
| 317 | 3300010375 | Ga0105239_10093154 | Ga0105239_100931543 | 141 |
| 318 | 3300010375 | Ga0105239_10243895 | Ga0105239_102438952 | 141 |
| 319 | 3300013306 | Ga0163162_10277633 | Ga0163162_102776332 | 141 |
| 320 | 3300013308 | Ga0157375_10933961 | Ga0157375_109339612 | 141 |
| 321 | 3300014325 | Ga0163163_10136913 | Ga0163163_101369131 | 141 |
| 322 | 3300014326 | Ga0157380_10274344 | Ga0157380_102743443 | 141 |
| 323 | 3300014326 | Ga0157380_11355030 | Ga0157380_113550302 | 141 |
| 324 | 3300014968 | Ga0157379_10187014 | Ga0157379_101870143 | 141 |
| 325 | 3300025297 | Ga0209758_1009397 | Ga0209758_10093975 | 141 |
| 326 | 3300025297 | Ga0209758_1017948 | Ga0209758_10179482 | 141 |
| 327 | 3300025901 | Ga0207688_10143879 | Ga0207688_101438792 | 141 |
| 328 | 3300025914 | Ga0207671_10583349 | Ga0207671_105833492 | 141 |
| 329 | 3300025931 | Ga0207644_10074539 | Ga0207644_100745392 | 141 |
| 330 | 3300025934 | Ga0207686_10597573 | Ga0207686_105975731 | 141 |
| 331 | 3300025935 | Ga0207709_10219523 | Ga0207709_102195232 | 141 |
| 332 | 3300025937 | Ga0207669_10168285 | Ga0207669_101682853 | 141 |
| 333 | 3300025937 | Ga0207669_11080708 | Ga0207669_110807081 | 141 |
| 334 | 3300025945 | Ga0207679_10164750 | Ga0207679_101647503 | 141 |
| 335 | 3300025949 | Ga0207667_11220349 | Ga0207667_112203492 | 141 |
| 336 | 3300025972 | Ga0207668_10074943 | Ga0207668_100749434 | 141 |
| 337 | 3300026041 | Ga0207639_10905476 | Ga0207639_109054761 | 141 |
| 338 | 3300026067 | Ga0207678_10008051 | Ga0207678_100080516 | 141 |
| 339 | 3300026067 | Ga0207678_10068429 | Ga0207678_100684295 | 141 |
| 340 | 3300026067 | Ga0207678_10246303 | Ga0207678_102463032 | 141 |
| 341 | 3300026095 | Ga0207676_11278732 | Ga0207676_112787321 | 141 |
| 342 | 3300026121 | Ga0207683_10175114 | Ga0207683_101751142 | 141 |
| 343 | 3300026121 | Ga0207683_10387046 | Ga0207683_103870462 | 141 |
| 344 | 3300026142 | Ga0207698_10712844 | Ga0207698_107128442 | 141 |
| 345 | 3300027907 | Ga0207428_10034034 | Ga0207428_100340346 | 141 |
| 346 | 3300028379 | Ga0268266_10003694 | Ga0268266_1000369410 | 141 |
| 347 | 3300028379 | Ga0268266_10071874 | Ga0268266_100718744 | 141 |
| 348 | 3300028379 | Ga0268266_10807836 | Ga0268266_108078361 | 141 |
| 349 | 3300028786 | Ga0307517_10000124 | Ga0307517_1000012431 | 141 |
| 350 | 3300028794 | Ga0307515_10049656 | Ga0307515_100496562 | 141 |
| 351 | 3300031456 | Ga0307513_10138368 | Ga0307513_101383682 | 141 |
| 352 | 3300031456 | Ga0307513_10160247 | Ga0307513_101602472 | 141 |
| 353 | 3300031507 | Ga0307509_10085524 | Ga0307509_100855242 | 141 |
| 354 | 3300031649 | Ga0307514_10280967 | Ga0307514_102809672 | 141 |
| 355 | 3300031730 | Ga0307516_10007317 | Ga0307516_1000731710 | 141 |
| 356 | 3300031730 | Ga0307516_10011746 | Ga0307516_100117466 | 141 |
| 357 | 3300031911 | Ga0307412_10127444 | Ga0307412_101274442 | 141 |
| 358 | 3300032126 | Ga0307415_100506890 | Ga0307415_1005068902 | 141 |
| 359 | 3300033180 | Ga0307510_10019988 | Ga0307510_100199888 | 141 |
| 360 | 3300033544 | Ga0316215_1025652 | Ga0316215_10256521 | 141 |
| 361 | 3300035170 | Ga0373943_0357470 | Ga0373943_0357470_254_679 | 141 |
| 362 | 3300035691 | Ga0373931_0014177 | Ga0373931_0014177_1862_2350 | 141 |
| 363 | 3300035695 | Ga0373927_0082502 | Ga0373927_0082502_1561_1986 | 141 |
| 364 | 3300035695 | Ga0373927_0096916 | Ga0373927_0096916_120_545 | 141 |
| 365 | 3300035695 | Ga0373927_0181322 | Ga0373927_0181322_226_651 | 141 |
| 366 | 3300036459 | Ga0372808_060860 | Ga0372808_060860_59_484 | 141 |
| 367 | 3300037068 | Ga0373925_0228010 | Ga0373925_0228010_223_654 | 141 |
| 368 | 3300041413 | Ga0439465_0082975 | Ga0439465_0082975_16_441 | 141 |
| 369 | 3300041451 | Ga0451791_1419379 | Ga0451791_1419379_222_647 | 141 |
| 370 | 3300041512 | Ga0451853_1660116 | Ga0451853_1660116_106_531 | 141 |
| 371 | 3300046459 | Ga0495629_0634298 | Ga0495629_0634298_208_633 | 141 |
| 372 | 3300046460 | Ga0495638_0134359 | Ga0495638_0134359_402_827 | 141 |
| 373 | 3300046460 | Ga0495638_0476975 | Ga0495638_0476975_137_562 | 141 |
| 374 | 3300046473 | Ga0495582_0050235 | Ga0495582_0050235_1640_2065 | 141 |
| 375 | 3300046475 | Ga0495639_0042249 | Ga0495639_0042249_1406_1831 | 141 |
| 376 | 3300046491 | Ga0495584_0037069 | Ga0495584_0037069_1668_2093 | 141 |
| 377 | 3300046511 | Ga0495608_0438937 | Ga0495608_0438937_10_435 | 141 |
| 378 | 3300046523 | Ga0495644_0049238 | Ga0495644_0049238_202_639 | 141 |
| 379 | 3300046535 | Ga0495586_0214975 | Ga0495586_0214975_90_515 | 141 |
| 380 | 3300046615 | Ga0495656_0097402 | Ga0495656_0097402_683_1120 | 141 |
| 381 | 3300046616 | Ga0495668_0145055 | Ga0495668_0145055_647_1072 | 141 |
| 382 | 3300046660 | Ga0495625_0085517 | Ga0495625_0085517_102_527 | 141 |
| 383 | 3300046664 | Ga0495659_0320510 | Ga0495659_0320510_216_641 | 141 |
| 384 | 3300046683 | Ga0495658_1105035 | Ga0495658_1105035_29_454 | 141 |
| 385 | 3300046684 | Ga0495669_0071987 | Ga0495669_0071987_65_490 | 141 |
| 386 | 3300046689 | Ga0495613_0408939 | Ga0495613_0408939_110_592 | 141 |
| 387 | 3300046690 | Ga0495624_0410759 | Ga0495624_0410759_113_538 | 141 |
| 388 | 3300046694 | Ga0495649_0169623 | Ga0495649_0169623_556_981 | 141 |
| 389 | 3300047315 | Ga0495581_0056236 | Ga0495581_0056236_247_729 | 141 |
| 390 | 3300047319 | Ga0495674_0118274 | Ga0495674_0118274_1040_1465 | 141 |
| 391 | 3300047321 | Ga0495676_0805458 | Ga0495676_0805458_165_590 | 141 |
| 392 | 3300047445 | Ga0495677_0033796 | Ga0495677_0033796_612_1037 | 141 |
| 393 | 3300047469 | Ga0495673_0082230 | Ga0495673_0082230_531_956 | 141 |
| 394 | 3300047472 | Ga0495686_0395568 | Ga0495686_0395568_188_613 | 141 |
| 395 | 3300047673 | Ga0495593_0374036 | Ga0495593_0374036_276_701 | 141 |
| 396 | 3300048904 | Ga0496101_0166337 | Ga0496101_0166337_28_516 | 141 |
| 397 | 3300048904 | Ga0496101_0477148 | Ga0496101_0477148_404_829 | 141 |
| 398 | 3300048905 | Ga0496102_0144548 | Ga0496102_0144548_1328_1816 | 141 |
| 399 | 3300048906 | Ga0496103_0089130 | Ga0496103_0089130_367_792 | 141 |
| 400 | 3300048906 | Ga0496103_0328917 | Ga0496103_0328917_234_659 | 141 |
| 401 | 3300048907 | Ga0496104_0216155 | Ga0496104_0216155_715_1140 | 141 |
| 402 | 3300048908 | Ga0496105_0047792 | Ga0496105_0047792_1770_2258 | 141 |
| 403 | 3300048908 | Ga0496105_0544956 | Ga0496105_0544956_86_550 | 141 |
| 404 | 3300048909 | Ga0496106_0048023 | Ga0496106_0048023_477_965 | 141 |
| 405 | 3300048910 | Ga0496107_0104716 | Ga0496107_0104716_109_534 | 141 |
| 406 | 3300048911 | Ga0496108_0198337 | Ga0496108_0198337_321_809 | 141 |
| 407 | 3300048912 | Ga0496109_0600888 | Ga0496109_0600888_155_580 | 141 |
| 408 | 3300048913 | Ga0496110_0050396 | Ga0496110_0050396_1962_2450 | 141 |
| 409 | 3300048914 | Ga0496111_0257228 | Ga0496111_0257228_580_1068 | 141 |
| 410 | 3300048915 | Ga0496112_0019963 | Ga0496112_0019963_1827_2315 | 141 |
| 411 | 3300048916 | Ga0496113_0047960 | Ga0496113_0047960_1549_2037 | 141 |
| 412 | 3300048916 | Ga0496113_0668873 | Ga0496113_0668873_294_719 | 141 |
| 413 | 3300048918 | Ga0496115_0373133 | Ga0496115_0373133_128_553 | 141 |
| 414 | 3300048924 | Ga0496121_0085559 | Ga0496121_0085559_704_1129 | 141 |
| 415 | 3300048928 | Ga0496125_0220966 | Ga0496125_0220966_242_667 | 141 |
| 416 | 3300049460 | Ga0495682_0279193 | Ga0495682_0279193_101_526 | 141 |
| 417 | 3300049578 | Ga0501042_0183199 | Ga0501042_0183199_39_464 | 141 |
| 418 | 3300049583 | Ga0501067_0108645 | Ga0501067_0108645_1010_1435 | 141 |
| 419 | 3300049589 | Ga0501073_0698816 | Ga0501073_0698816_195_620 | 141 |
| 420 | 3300049592 | Ga0501076_0140141 | Ga0501076_0140141_1354_1779 | 141 |
| 421 | 3300049741 | Ga0501079_0699230 | Ga0501079_0699230_276_701 | 141 |
| 422 | 3300049822 | Ga0501035_0182643 | Ga0501035_0182643_175_600 | 141 |
| 423 | 3300049823 | Ga0501044_0167456 | Ga0501044_0167456_205_630 | 141 |
| 424 | 3300050489 | nmdc:mga03683_348339_c1 | nmdc:mga03683_348339_c1_227_652 | 141 |
| 425 | 3300050490 | nmdc:mga03n38_10440_c1 | nmdc:mga03n38_10440_c1_2513_2938 | 141 |
| 426 | 3300050490 | nmdc:mga03n38_30187_c1 | nmdc:mga03n38_30187_c1_765_1190 | 141 |
| 427 | 3300050491 | nmdc:mga00v17_66831_c1 | nmdc:mga00v17_66831_c1_1270_1695 | 141 |
| 428 | 3300050492 | nmdc:mga0yw44_10911_c1 | nmdc:mga0yw44_10911_c1_2965_3390 | 141 |
| 429 | 3300050492 | nmdc:mga0yw44_370116_c1 | nmdc:mga0yw44_370116_c1_415_840 | 141 |
| 430 | 3300050494 | nmdc:mga06z11_207028_c1 | nmdc:mga06z11_207028_c1_445_870 | 141 |
| 431 | 3300050494 | nmdc:mga06z11_207311_c1 | nmdc:mga06z11_207311_c1_677_1102 | 141 |
| 432 | 3300050494 | nmdc:mga06z11_301135_c1 | nmdc:mga06z11_301135_c1_305_730 | 141 |
| 433 | 3300050495 | nmdc:mga04h51_3126_c1 | nmdc:mga04h51_3126_c1_414_839 | 141 |
| 434 | 3300050496 | nmdc:mga07m45_4680_c1 | nmdc:mga07m45_4680_c1_193_618 | 141 |
| 435 | 3300050496 | nmdc:mga07m45_67326_c1 | nmdc:mga07m45_67326_c1_293_718 | 141 |
| 436 | 3300050516 | nmdc:mga0sz30_503550_c1 | nmdc:mga0sz30_503550_c1_11_436 | 141 |
| 437 | 3300053077 | Ga0495601_0594352 | Ga0495601_0594352_61_486 | 141 |
| 438 | 3300053084 | Ga0495595_0012629 | Ga0495595_0012629_1309_1734 | 141 |
| 439 | 3300053085 | Ga0495619_0004132 | Ga0495619_0004132_2970_3395 | 141 |
| 440 | 3300053119 | Ga0500595_012400 | Ga0500595_012400_1810_2235 | 141 |
| 441 | 3300053120 | Ga0500597_063843 | Ga0500597_063843_813_1238 | 141 |
| 442 | 3300053139 | Ga0500568_0049672 | Ga0500568_0049672_368_793 | 141 |
| 443 | 3300053142 | Ga0500577_0058641 | Ga0500577_0058641_751_1176 | 141 |
| 444 | 3300053151 | Ga0500604_0196082 | Ga0500604_0196082_172_597 | 141 |
| 445 | 3300053158 | Ga0500627_0339019 | Ga0500627_0339019_112_537 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2peb-assembly1.cif.gz_B | crystal structure of a putative dioxygenase (npun_f1925) from nostoc punctiforme pcc 73102 at 1.46 a resolution | 0.9666 | 10 | 119 |
| 2peb-assembly1.cif.gz_B | crystal structure of a putative dioxygenase (npun_f1925) from nostoc punctiforme pcc 73102 at 1.46 a resolution | 0.9096 | 10 | 119 |
| 2p8i-assembly1.cif.gz_A | crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.40 a resolution | 0.8808 | 10 | 119 |
| 2p8i-assembly1.cif.gz_A | crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.40 a resolution | 0.8242 | 10 | 119 |
| 2bv3-assembly1.cif.gz_A | crystal structure of a mutant elongation factor g trapped with a gtp analogue | 0.6603 | 16 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2pebB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains | 0.9656 | 10 | 119 | 3.30.70.1240 |
| 2pebB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains | 0.9077 | 10 | 119 | 3.30.70.1240 |
| af_Q59TT2_5_125_3.30.70.1240 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains | 0.9064 | 10 | 121 | 3.30.70.1240 |
| af_A0A1D8PEW7_24_150_3.30.70.1240 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains | 0.8666 | 12 | 124 | 3.30.70.1240 |
| 2p8iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains | 0.8656 | 10 | 119 | 3.30.70.1240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537UQ74-F1-model_v4 | 4,5-dioxygenase | 0.9785 | 28 | 123 |
GO:0051213
|
| AF-A0A7Y3M8J0-F1-model_v4 | DOPA 4,5-dioxygenase family protein | 0.9778 | 15 | 119 |
GO:0051213
|
| AF-A0A433VGC9-F1-model_v4 | DOPA 4,5-dioxygenase | 0.9773 | 15 | 119 |
GO:0051213
|
| AF-A0A6L7XLN1-F1-model_v4 | 4,5-dioxygenase | 0.977 | 16 | 119 |
GO:0051213
|
| AF-A0A2E3K3Z4-F1-model_v4 | 4,5-dioxygenase | 0.9763 | 16 | 120 |
GO:0051213
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar