F445492

General Info

Members Datasets Scaffolds Average Seq Length
445 285 426 140

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10073969|Ga0105248_100739694
Length 162
Sequence LTVPPVAAMVAAGRGESGAGAMTDLPETSGARSLGEIASYHAHVYYDPAATRAEAERLRTWIGERFSVTLGRWHDVKVGPHDQAMYQVAFAREVFPDLVPWLMLNHGRLSVLVHPNTTNPRRDHLADPIWIGPALAVHADKLPEHSELEAAPAPNTSPTLRP

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
3 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
4 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
5 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
6 2904699407
7 2906610324
8 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
9 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
10 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
11 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
12 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
13 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
14 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
70 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
135 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
136 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
157 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
175 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
176 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
177 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
214 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
253 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
262 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
263 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
264 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
265 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
266 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
267 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
268 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
271 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
272 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
273 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
274 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
275 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
276 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
277 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
278 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
279 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
280 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
281 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
282 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
283 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
284 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
285 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.49
Metatranscriptomes 0.68
Isolates 3.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.16
Nodule 4.49
Rhizoplane 7.87
Rhizosphere 63.82
Stem 0
Stem Tuber 0
Unclassified 9.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10423421 3300005293 Bacteria 846
2 Ga0070683_100101130 3300005329 Bacteria 2714
3 Ga0070680_101223515 3300005336 Bacteria 650
4 Ga0070682_100058498 3300005337 Bacteria 2431
5 Ga0070682_100299244 3300005337 Bacteria 1180
6 Ga0068868_100009479 3300005338 Bacteria 7011
7 Ga0068868_100401824 3300005338 Bacteria 1182
8 Ga0068868_101183526 3300005338 Bacteria 706
9 Ga0070660_101769625 3300005339 Bacteria 526
10 Ga0070689_101596766 3300005340 Bacteria 592
11 Ga0070687_100383457 3300005343 Bacteria 917
12 Ga0070668_100097206 3300005347 Bacteria 2328
13 Ga0070671_100791171 3300005355 Bacteria 825
14 Ga0070671_100846012 3300005355 Bacteria 798
15 Ga0070671_101529624 3300005355 Bacteria 591
16 Ga0070674_100173066 3300005356 Bacteria 1648
17 Ga0070674_100359666 3300005356 Bacteria 1178
18 Ga0070688_100051288 3300005365 Bacteria 2574
19 Ga0070667_101392877 3300005367 Bacteria 658
20 Ga0070714_100062425 3300005435 Bacteria 3202
21 Ga0070714_101077046 3300005435 Bacteria 783
22 Ga0070713_100064529 3300005436 Bacteria 3074
23 Ga0070713_100114574 3300005436 Bacteria 2355
24 Ga0070710_10204687 3300005437 Bacteria 1248
25 Ga0070711_100035068 3300005439 Bacteria 3351
26 Ga0070708_100207938 3300005445 Bacteria 1833
27 Ga0070663_100025740 3300005455 Bacteria 3975
28 Ga0070663_100085680 3300005455 Bacteria 2325
29 Ga0070663_100242743 3300005455 Bacteria 1423
30 Ga0070663_100731575 3300005455 Bacteria 843
31 Ga0070663_101447115 3300005455 Bacteria 610
32 Ga0070678_100214800 3300005456 Bacteria 1596
33 Ga0070678_100909241 3300005456 Bacteria 805
34 Ga0070678_102342555 3300005456 Bacteria 507
35 Ga0070681_10121663 3300005458 Bacteria 2544
36 Ga0070681_10542311 3300005458 Bacteria 1077
37 Ga0070679_100016478 3300005530 Bacteria 7131
38 Ga0070679_100728471 3300005530 Bacteria 934
39 Ga0070679_101750600 3300005530 Bacteria 570
40 Ga0070684_100062555 3300005535 Bacteria 3260
41 Ga0070684_100250530 3300005535 Bacteria 1619
42 Ga0070684_100545821 3300005535 Bacteria 1075
43 Ga0068853_100413526 3300005539 Bacteria 1264
44 Ga0068853_100680899 3300005539 Bacteria 980
45 Ga0068853_101028121 3300005539 Bacteria 794
46 Ga0068853_101370335 3300005539 Bacteria 684
47 Ga0068853_101770216 3300005539 Bacteria 599
48 Ga0070672_100279899 3300005543 Bacteria 1410
49 Ga0070693_100122484 3300005547 Bacteria 1615
50 Ga0070693_100198708 3300005547 Bacteria 1301
51 Ga0070665_100034649 3300005548 Bacteria 5078
52 Ga0070665_100056456 3300005548 Bacteria 3936
53 Ga0070665_100332646 3300005548 Bacteria 1524
54 Ga0070665_100672139 3300005548 Bacteria 1049
55 Ga0068855_100077435 3300005563 Bacteria 3858
56 Ga0070664_100050577 3300005564 Bacteria 3518
57 Ga0070664_100090557 3300005564 Bacteria 2647
58 Ga0068857_100255596 3300005577 Bacteria 1607
59 Ga0068854_100120150 3300005578 Bacteria 1994
60 Ga0068856_100303659 3300005614 Bacteria 1614
61 Ga0068856_100314617 3300005614 Bacteria 1583
62 Ga0068852_100058058 3300005616 Bacteria 3350
63 Ga0068852_100103550 3300005616 Bacteria 2574
64 Ga0068852_100549064 3300005616 Bacteria 1155
65 Ga0068864_100442215 3300005618 Bacteria 1242
66 Ga0068866_10281874 3300005718 Bacteria 1030
67 Ga0068866_10578946 3300005718 Bacteria 755
68 Ga0068863_100044445 3300005841 Bacteria 4217
69 Ga0068863_101363107 3300005841 Bacteria 717
70 Ga0068858_100751889 3300005842 Bacteria 950
71 Ga0068858_100919054 3300005842 Bacteria 856
72 Ga0068860_100000135 3300005843 Bacteria 120265
73 Ga0081455_10077863 3300005937 Bacteria 2726
74 Ga0081538_10055572 3300005981 Bacteria 2329
75 Ga0081540_1006530 3300005983 Bacteria 8472
76 Ga0081540_1049223 3300005983 Bacteria 2104
77 Ga0081540_1070113 3300005983 Unclassified 1625
78 Ga0081540_1082347 3300005983 Bacteria 1444
79 Ga0081539_10034446 3300005985 Bacteria 3062
80 Ga0075365_10001096 3300006038 Bacteria 11780
81 Ga0075365_10030500 3300006038 Bacteria 3454
82 Ga0075365_10043087 3300006038 Bacteria 2953
83 Ga0075365_10048537 3300006038 Bacteria 2795
84 Ga0075365_10082161 3300006038 Bacteria 2184
85 Ga0075365_10253300 3300006038 Bacteria 1237
86 Ga0075365_10680959 3300006038 Bacteria 727
87 Ga0075368_10116587 3300006042 Bacteria 1104
88 Ga0075363_100047766 3300006048 Bacteria 2274
89 Ga0075364_10068654 3300006051 Bacteria 2331
90 Ga0075364_10417615 3300006051 Bacteria 916
91 Ga0075432_10017477 3300006058 Bacteria 2447
92 Ga0070712_100078247 3300006175 Bacteria 2387
93 Ga0075367_10038683 3300006178 Bacteria 2777
94 Ga0075367_10071359 3300006178 Bacteria 2089
95 Ga0075367_10164934 3300006178 Bacteria 1378
96 Ga0075369_10074129 3300006186 Bacteria 1501
97 Ga0075369_10300648 3300006186 Bacteria 749
98 Ga0097621_100034861 3300006237 Bacteria 4017
99 Ga0097621_100195212 3300006237 Bacteria 1755
100 Ga0097621_100936534 3300006237 Bacteria 808
101 Ga0097621_101029499 3300006237 Bacteria 771
102 Ga0075370_10019137 3300006353 Bacteria 3725
103 Ga0075370_10107685 3300006353 Bacteria 1617
104 Ga0068871_100137171 3300006358 Bacteria 2078
105 Ga0068871_100248111 3300006358 Bacteria 1550
106 Ga0068865_100215045 3300006881 Bacteria 1500
107 Ga0099825_1030153 3300006941 Bacteria 2431
108 Ga0099822_1007120 3300006943 Bacteria 14505
109 Ga0105245_10009440 3300009098 Bacteria 8508
110 Ga0105247_10004773 3300009101 Bacteria 8633
111 Ga0105247_10209790 3300009101 Bacteria 1313
112 Ga0105247_10548312 3300009101 Bacteria 850
113 Ga0105243_10672200 3300009148 Bacteria 1006
114 Ga0105241_10348985 3300009174 Bacteria 1284
115 Ga0105241_10624660 3300009174 Bacteria 976
116 Ga0105242_10194595 3300009176 Bacteria 1797
117 Ga0105248_10045447 3300009177 Bacteria 4925
118 Ga0105248_10073969 3300009177 Bacteria 3830
119 Ga0105237_10117488 3300009545 Bacteria 2653
120 Ga0105237_10500984 3300009545 Bacteria 1221
121 Ga0105237_11369205 3300009545 Bacteria 714
122 Ga0105238_10152595 3300009551 Bacteria 2285
123 Ga0105238_10270007 3300009551 Bacteria 1681
124 Ga0105238_10461986 3300009551 Bacteria 1267
125 Ga0105238_10594827 3300009551 Bacteria 1114
126 Ga0105238_11256100 3300009551 Bacteria 766
127 Ga0105249_10389612 3300009553 Bacteria 1421
128 Ga0099796_10091360 3300010159 Bacteria 1132
129 Ga0099796_10128523 3300010159 Bacteria 980
130 Ga0105239_10073958 3300010375 Bacteria 3746
131 Ga0105239_10093154 3300010375 Bacteria 3326
132 Ga0105239_10243895 3300010375 Bacteria 2017
133 Ga0105246_10091504 3300011119 Bacteria 2193
134 Ga0105246_10336439 3300011119 Bacteria 1232
135 Ga0105246_10779972 3300011119 Bacteria 846
136 Ga0157369_10002654 3300013105 Bacteria 21358
137 Ga0157374_10100928 3300013296 Bacteria 2767
138 Ga0157378_10034647 3300013297 Bacteria 4465
139 Ga0163162_10050431 3300013306 Bacteria 4174
140 Ga0163162_10277633 3300013306 Bacteria 1807
141 Ga0157372_10115973 3300013307 Bacteria 3071
142 Ga0157375_10026957 3300013308 Bacteria 5364
143 Ga0157375_10933961 3300013308 Bacteria 1010
144 Ga0163163_10006739 3300014325 Bacteria 10065
145 Ga0163163_10136913 3300014325 Bacteria 2490
146 Ga0163163_10239251 3300014325 Bacteria 1865
147 Ga0157380_10274344 3300014326 Bacteria 1539
148 Ga0157380_11355030 3300014326 Bacteria 760
149 Ga0157380_11370266 3300014326 Unclassified 757
150 Ga0157377_10162667 3300014745 Bacteria 1389
151 Ga0157379_10187014 3300014968 Bacteria 1872
152 Ga0157379_10524050 3300014968 Bacteria 1100
153 Ga0157376_10108553 3300014969 Bacteria 2438
154 Ga0157376_11412756 3300014969 Bacteria 728
155 Ga0206356_10214755 3300020070 Bacteria 1212
156 Ga0213872_10076119 3300021361 Bacteria 1510
157 Ga0213874_10030794 3300021377 Bacteria 1548
158 Ga0213876_10247041 3300021384 Bacteria 948
159 Ga0224712_10378100 3300022467 Bacteria 673
160 Ga0209233_1014953 3300025261 Bacteria 2174
161 Ga0209758_1009397 3300025297 Bacteria 6085
162 Ga0209758_1017948 3300025297 Bacteria 3494
163 Ga0207710_10041520 3300025900 Bacteria 2040
164 Ga0207688_10143879 3300025901 Bacteria 1405
165 Ga0207699_10075606 3300025906 Bacteria 2072
166 Ga0207654_10414278 3300025911 Bacteria 939
167 Ga0207707_10008703 3300025912 Bacteria 8808
168 Ga0207707_10016072 3300025912 Bacteria 6527
169 Ga0207695_10145468 3300025913 Bacteria 2315
170 Ga0207671_10287276 3300025914 Bacteria 1298
171 Ga0207671_10583349 3300025914 Bacteria 891
172 Ga0207693_10199556 3300025915 Bacteria 1573
173 Ga0207693_11176369 3300025915 Bacteria 579
174 Ga0207663_10284038 3300025916 Bacteria 1230
175 Ga0207663_10680666 3300025916 Bacteria 813
176 Ga0207652_10203197 3300025921 Bacteria 1783
177 Ga0207652_10883489 3300025921 Bacteria 790
178 Ga0207694_10313122 3300025924 Bacteria 1294
179 Ga0207700_10103457 3300025928 Bacteria 2277
180 Ga0207700_10342819 3300025928 Bacteria 1299
181 Ga0207664_10057187 3300025929 Bacteria 3100
182 Ga0207644_10074539 3300025931 Bacteria 2491
183 Ga0207686_10597573 3300025934 Bacteria 868
184 Ga0207686_10657555 3300025934 Bacteria 830
185 Ga0207709_10219523 3300025935 Bacteria 1370
186 Ga0207669_10168285 3300025937 Bacteria 1557
187 Ga0207669_11080708 3300025937 Bacteria 677
188 Ga0207704_10243649 3300025938 Bacteria 1345
189 Ga0207661_10016193 3300025944 Bacteria 5496
190 Ga0207679_10164750 3300025945 Bacteria 1819
191 Ga0207667_10270684 3300025949 Bacteria 1736
192 Ga0207667_11220349 3300025949 Bacteria 731
193 Ga0207668_10074943 3300025972 Bacteria 2431
194 Ga0207640_10244038 3300025981 Bacteria 1390
195 Ga0207677_10024150 3300026023 Bacteria 3771
196 Ga0207677_11082832 3300026023 Bacteria 730
197 Ga0207703_10556288 3300026035 Bacteria 1082
198 Ga0207639_10105338 3300026041 Bacteria 2288
199 Ga0207639_10342310 3300026041 Bacteria 1333
200 Ga0207639_10905476 3300026041 Bacteria 824
201 Ga0207639_11476185 3300026041 Bacteria 638
202 Ga0207678_10008051 3300026067 Bacteria 9294
203 Ga0207678_10060777 3300026067 Bacteria 3250
204 Ga0207678_10068429 3300026067 Bacteria 3046
205 Ga0207678_10246303 3300026067 Bacteria 1531
206 Ga0207702_10125918 3300026078 Bacteria 2300
207 Ga0207702_10259466 3300026078 Bacteria 1636
208 Ga0207702_10299087 3300026078 Bacteria 1527
209 Ga0207641_10757999 3300026088 Bacteria 958
210 Ga0207676_11278732 3300026095 Bacteria 728
211 Ga0207674_10176221 3300026116 Bacteria 2090
212 Ga0207683_10175114 3300026121 Bacteria 1944
213 Ga0207683_10387046 3300026121 Bacteria 1286
214 Ga0207683_11011728 3300026121 Bacteria 771
215 Ga0207698_10051871 3300026142 Bacteria 3139
216 Ga0207698_10279606 3300026142 Bacteria 1543
217 Ga0207698_10712844 3300026142 Bacteria 999
218 Ga0209589_1000002 3300027357 Bacteria 708598
219 Ga0209489_100002 3300027361 Bacteria 708609
220 Ga0209700_100002 3300027363 Bacteria 708598
221 Ga0207428_10034034 3300027907 Bacteria 4178
222 Ga0268266_10003694 3300028379 Bacteria 15090
223 Ga0268266_10071874 3300028379 Bacteria 2999
224 Ga0268266_10807836 3300028379 Bacteria 906
225 Ga0268264_10000038 3300028381 Bacteria 383623
226 Ga0268264_11220145 3300028381 Bacteria 762
227 Ga0307517_10000124 3300028786 Bacteria 115570
228 Ga0307515_10049656 3300028794 Bacteria 6303
229 Ga0307511_10152782 3300030521 Bacteria 1320
230 Ga0307513_10138368 3300031456 Bacteria 2366
231 Ga0307513_10160247 3300031456 Bacteria 2144
232 Ga0307509_10085524 3300031507 Bacteria 3245
233 Ga0307509_10281016 3300031507 Bacteria 1425
234 Ga0307508_10319396 3300031616 Bacteria 1144
235 Ga0307514_10280967 3300031649 Bacteria 953
236 Ga0307516_10007317 3300031730 Bacteria 12708
237 Ga0307516_10007383 3300031730 Bacteria 12649
238 Ga0307516_10011746 3300031730 Bacteria 9502
239 Ga0307516_10329112 3300031730 Bacteria 1197
240 Ga0307516_10337316 3300031730 Bacteria 1175
241 Ga0307405_10981149 3300031731 Bacteria 720
242 Ga0307406_10319877 3300031901 Bacteria 1200
243 Ga0307412_10127444 3300031911 Bacteria 1843
244 Ga0307416_101093329 3300032002 Bacteria 902
245 Ga0307411_10998341 3300032005 Bacteria 749
246 Ga0307415_100506890 3300032126 Bacteria 1056
247 Ga0307415_101695517 3300032126 Bacteria 609
248 Ga0307507_10026738 3300033179 Bacteria 6207
249 Ga0307510_10019988 3300033180 Bacteria 7842
250 Ga0307510_10321286 3300033180 Bacteria 1005
251 Ga0315911_1000004 3300033442 Bacteria 472637
252 Ga0316215_1025652 3300033544 Bacteria 606
253 Ga0373945_0146590 3300035116 Bacteria 955
254 Ga0373943_0357470 3300035170 Bacteria 838
255 Ga0373946_0119144 3300035171 Bacteria 1203
256 Ga0373946_0398952 3300035171 Bacteria 694
257 Ga0373931_0014177 3300035691 Bacteria 3892
258 Ga0373935_0080888 3300035692 Bacteria 2111
259 Ga0373927_0044100 3300035695 Bacteria 2886
260 Ga0373927_0082502 3300035695 Bacteria 2084
261 Ga0373927_0096916 3300035695 Bacteria 1917
262 Ga0373927_0181322 3300035695 Bacteria 1381
263 Ga0373927_0309142 3300035695 Bacteria 1040
264 Ga0373927_0931372 3300035695 Bacteria 573
265 Ga0373947_1036503 3300035725 Bacteria 559
266 Ga0372808_060860 3300036459 Bacteria 543
267 Ga0373925_0228010 3300037068 Bacteria 1489
268 Ga0395900_0051257 3300037418 Bacteria 4252
269 Ga0395898_0029897 3300037466 Bacteria 5454
270 Ga0395898_0875834 3300037466 Bacteria 837
271 Ga0395901_0905295 3300038443 Bacteria 864
272 Ga0395901_1327581 3300038443 Bacteria 680
273 Ga0436365_0191297 3300039437 Bacteria 921
274 Ga0436365_1281786 3300039437 Bacteria 1003
275 Ga0436365_1725135 3300039437 Bacteria 3983
276 Ga0436361_0391251 3300039447 Bacteria 3624
277 Ga0436363_0070651 3300039450 Bacteria 537
278 Ga0436363_0433273 3300039450 Bacteria 2506
279 Ga0436362_1206612 3300039453 Bacteria 718
280 Ga0439465_0082975 3300041413 Bacteria 1089
281 Ga0451787_295617 3300041441 Bacteria 676
282 Ga0451791_1419379 3300041451 Bacteria 833
283 Ga0451800_0441647 3300041459 Bacteria 791
284 Ga0451853_1660116 3300041512 Bacteria 753
285 Ga0466966_0428339 3300044684 Bacteria 795
286 Ga0466963_0492972 3300044694 Bacteria 865
287 Ga0466964_0561755 3300044706 Bacteria 621
288 Ga0466967_0127975 3300045976 Bacteria 2354
289 Ga0495603_0095351 3300046455 Bacteria 1738
290 Ga0495629_0422351 3300046459 Bacteria 905
291 Ga0495629_0634298 3300046459 Bacteria 713
292 Ga0495638_0134359 3300046460 Bacteria 1451
293 Ga0495638_0476975 3300046460 Bacteria 632
294 Ga0495641_0136498 3300046461 Bacteria 1095
295 Ga0495582_0050235 3300046473 Bacteria 2298
296 Ga0495639_0042249 3300046475 Bacteria 2056
297 Ga0495584_0037069 3300046491 Bacteria 2463
298 Ga0495608_0438937 3300046511 Bacteria 795
299 Ga0495644_0049238 3300046523 Bacteria 1582
300 Ga0495665_0027612 3300046531 Bacteria 3046
301 Ga0495586_0214975 3300046535 Bacteria 1092
302 Ga0495622_0011312 3300046557 Bacteria 4121
303 Ga0495656_0097402 3300046615 Bacteria 1355
304 Ga0495668_0145055 3300046616 Bacteria 1299
305 Ga0495634_0304780 3300046642 Bacteria 962
306 Ga0495625_0085517 3300046660 Bacteria 2189
307 Ga0495659_0320510 3300046664 Bacteria 658
308 Ga0495657_0330468 3300046675 Bacteria 905
309 Ga0495599_0591430 3300046678 Bacteria 647
310 Ga0495647_0341989 3300046681 Bacteria 680
311 Ga0495658_0153635 3300046683 Bacteria 1415
312 Ga0495658_0610358 3300046683 Bacteria 699
313 Ga0495658_1105035 3300046683 Bacteria 505
314 Ga0495669_0071987 3300046684 Bacteria 1577
315 Ga0495613_0408939 3300046689 Bacteria 925
316 Ga0495624_0410759 3300046690 Bacteria 812
317 Ga0495649_0169623 3300046694 Bacteria 1142
318 Ga0495581_0056236 3300047315 Bacteria 2271
319 Ga0495581_0140005 3300047315 Bacteria 1411
320 Ga0495604_0876549 3300047317 Bacteria 562
321 Ga0495674_0118274 3300047319 Bacteria 2241
322 Ga0495672_0022747 3300047320 Bacteria 4068
323 Ga0495676_0805458 3300047321 Bacteria 605
324 Ga0495677_0033796 3300047445 Bacteria 1864
325 Ga0495673_0082230 3300047469 Bacteria 1332
326 Ga0495686_0395568 3300047472 Bacteria 743
327 Ga0495593_0374036 3300047673 Bacteria 712
328 Ga0496100_0012355 3300048903 Bacteria 4893
329 Ga0496101_0166337 3300048904 Bacteria 1693
330 Ga0496101_0477148 3300048904 Bacteria 985
331 Ga0496102_0003231 3300048905 Bacteria 13823
332 Ga0496102_0144548 3300048905 Bacteria 2231
333 Ga0496103_0089130 3300048906 Bacteria 1946
334 Ga0496103_0227029 3300048906 Bacteria 1201
335 Ga0496103_0328917 3300048906 Bacteria 983
336 Ga0496104_0067184 3300048907 Bacteria 3405
337 Ga0496104_0216155 3300048907 Bacteria 1828
338 Ga0496105_0047792 3300048908 Bacteria 3531
339 Ga0496105_0061167 3300048908 Bacteria 3107
340 Ga0496105_0544956 3300048908 Bacteria 906
341 Ga0496106_0000846 3300048909 Bacteria 22208
342 Ga0496106_0048023 3300048909 Bacteria 3214
343 Ga0496106_0196827 3300048909 Bacteria 1603
344 Ga0496107_0012935 3300048910 Bacteria 5831
345 Ga0496107_0104716 3300048910 Bacteria 2076
346 Ga0496108_0065767 3300048911 Bacteria 3056
347 Ga0496108_0198337 3300048911 Bacteria 1741
348 Ga0496109_0008675 3300048912 Bacteria 8652
349 Ga0496109_0600888 3300048912 Bacteria 1036
350 Ga0496110_0050396 3300048913 Bacteria 3655
351 Ga0496110_0086466 3300048913 Bacteria 2800
352 Ga0496111_0257228 3300048914 Bacteria 1295
353 Ga0496112_0019963 3300048915 Bacteria 6341
354 Ga0496113_0047960 3300048916 Bacteria 3176
355 Ga0496113_0102611 3300048916 Bacteria 2218
356 Ga0496113_0668873 3300048916 Bacteria 830
357 Ga0496114_0004884 3300048917 Bacteria 10442
358 Ga0496115_0002667 3300048918 Bacteria 12802
359 Ga0496115_0373133 3300048918 Bacteria 1161
360 Ga0496117_0030192 3300048920 Bacteria 4163
361 Ga0496118_0005969 3300048921 Bacteria 13587
362 Ga0496121_0000099 3300048924 Bacteria 200160
363 Ga0496121_0085559 3300048924 Bacteria 2481
364 Ga0496121_0192628 3300048924 Bacteria 1460
365 Ga0496124_0004730 3300048927 Bacteria 15715
366 Ga0496125_0220966 3300048928 Bacteria 1221
367 Ga0496126_0006199 3300048929 Bacteria 13378
368 Ga0496126_0074638 3300048929 Bacteria 3011
369 Ga0496126_0190586 3300048929 Bacteria 1737
370 Ga0496126_0713897 3300048929 Bacteria 778
371 Ga0495682_0279193 3300049460 Bacteria 590
372 Ga0501042_0183199 3300049578 Bacteria 1511
373 Ga0501067_0108645 3300049583 Bacteria 1542
374 Ga0501071_0327068 3300049587 Bacteria 1165
375 Ga0501073_0698816 3300049589 Bacteria 700
376 Ga0501076_0140141 3300049592 Bacteria 1964
377 Ga0501079_0699230 3300049741 Bacteria 798
378 Ga0501035_0182643 3300049822 Bacteria 1807
379 Ga0501044_0167456 3300049823 Bacteria 2171
380 nmdc:mga03683_348339_c1 3300050489 Bacteria 701
381 nmdc:mga03n38_10440_c1 3300050490 Bacteria 3416
382 nmdc:mga03n38_178599_c1 3300050490 Bacteria 1086
383 nmdc:mga03n38_30187_c1 3300050490 Bacteria 2276
384 nmdc:mga00v17_251140_c1 3300050491 Bacteria 1147
385 nmdc:mga00v17_66831_c1 3300050491 Bacteria 2220
386 nmdc:mga0yw44_10911_c1 3300050492 Bacteria 4658
387 nmdc:mga0yw44_370116_c1 3300050492 Bacteria 967
388 nmdc:mga06z11_207028_c1 3300050494 Bacteria 1142
389 nmdc:mga06z11_207311_c1 3300050494 Bacteria 1141
390 nmdc:mga06z11_301135_c1 3300050494 Bacteria 953
391 nmdc:mga06z11_48930_c1 3300050494 Bacteria 2154
392 nmdc:mga04h51_3126_c1 3300050495 Bacteria 3994
393 nmdc:mga07m45_4680_c1 3300050496 Bacteria 6717
394 nmdc:mga07m45_67326_c1 3300050496 Bacteria 2035
395 nmdc:mga0sz30_503550_c1 3300050516 Bacteria 545
396 Ga0495601_0594352 3300053077 Bacteria 710
397 Ga0495612_0054462 3300053078 Bacteria 1648
398 Ga0500635_0012677 3300053080 Bacteria 2428
399 Ga0495595_0012629 3300053084 Bacteria 3554
400 Ga0495619_0004132 3300053085 Bacteria 9278
401 Ga0495619_0465465 3300053085 Bacteria 871
402 Ga0500647_0298472 3300053091 Bacteria 690
403 Ga0500651_0423997 3300053093 Bacteria 744
404 Ga0500566_0050480 3300053094 Bacteria 2382
405 Ga0500566_0067401 3300053094 Bacteria 2015
406 Ga0500648_123471 3300053097 Bacteria 1415
407 Ga0500554_001888 3300053102 Bacteria 4056
408 Ga0500595_000660 3300053119 Bacteria 20694
409 Ga0500595_012400 3300053119 Bacteria 3298
410 Ga0500597_063843 3300053120 Bacteria 1585
411 Ga0500559_0154134 3300053136 Bacteria 1079
412 Ga0500568_0049672 3300053139 Bacteria 1655
413 Ga0500573_0262438 3300053140 Bacteria 883
414 Ga0500577_0058641 3300053142 Bacteria 1473
415 Ga0500590_234296 3300053148 Bacteria 745
416 Ga0500603_052099 3300053150 Bacteria 1123
417 Ga0500603_057075 3300053150 Bacteria 1083
418 Ga0500604_0196082 3300053151 Bacteria 694
419 Ga0500627_0339019 3300053158 Bacteria 650
420 Ga0500638_084153 3300053162 Bacteria 1507
421 Ga0500636_0105937 3300053177 Bacteria 1593
422 Ga0500636_0106914 3300053177 Bacteria 1585
423 Ga0500636_0178780 3300053177 Bacteria 1141
424 Ga0500637_0001532 3300053178 Bacteria 9873
425 Ga0500596_004903 3300053735 Bacteria 2408
426 Ga0500661_001928 3300055283 Bacteria 3914

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2524023228 2524539670 132
2 iso_pu_bacteria 2791355197 2793073907 132
3 iso_pu_bacteria 2904699407 2904710967 132
4 iso_pu_bacteria 2906610324 2906615880 132
5 iso_pu_bacteria 2906635258 2906639790 132
6 iso_pu_bacteria 2906660503 2906662040 132
7 iso_pu_bacteria 2935630451 2935630993 132
8 iso_pu_bacteria 2941507105 2941507645 132
9 iso_pu_bacteria 2941515067 2941516072 132
10 iso_pu_bacteria 2941523033 2941523220 132
11 iso_pu_bacteria 8006933436 8006934580 132
12 iso_pu_bacteria 8006973647 8006974550 132
13 iso_pu_bacteria 8019555841 8019564088 132
14 iso_pu_bacteria 8019565922 8019574163 132
15 3300006038 Ga0075365_10082161 Ga0075365_100821613 133
16 3300005718 Ga0068866_10281874 Ga0068866_102818742 134
17 3300006941 Ga0099825_1030153 Ga0099825_10301532 136
18 3300006943 Ga0099822_1007120 Ga0099822_100712010 136
19 3300021377 Ga0213874_10030794 Ga0213874_100307943 136
20 3300025261 Ga0209233_1014953 Ga0209233_10149532 136
21 3300027357 Ga0209589_1000002 Ga0209589_100000292 136
22 3300027361 Ga0209489_100002 Ga0209489_10000292 136
23 3300027363 Ga0209700_100002 Ga0209700_10000292 136
24 3300032002 Ga0307416_101093329 Ga0307416_1010933292 136
25 3300033442 Ga0315911_1000004 Ga0315911_1000004268 136
26 3300039437 Ga0436365_1281786 Ga0436365_1281786_133_543 136
27 3300039450 Ga0436363_0433273 Ga0436363_0433273_1672_2082 136
28 3300048929 Ga0496126_0190586 Ga0496126_0190586_12_422 136
29 iso_pu_bacteria 8056689827 8056695663 136
30 3300005937 Ga0081455_10077863 Ga0081455_100778633 137
31 3300005983 Ga0081540_1049223 Ga0081540_10492232 137
32 3300014326 Ga0157380_11370266 Ga0157380_113702662 137
33 iso_pu_bacteria 2513237101 2513696446 137
34 iso_pu_bacteria 2721755755 2723842950 137
35 iso_pu_bacteria 2879110137 2879114291 137
36 iso_pu_bacteria 2922386360 2922390109 137
37 3300005329 Ga0070683_100101130 Ga0070683_1001011303 138
38 3300005336 Ga0070680_101223515 Ga0070680_1012235151 138
39 3300005337 Ga0070682_100299244 Ga0070682_1002992441 138
40 3300005338 Ga0068868_100401824 Ga0068868_1004018242 138
41 3300005355 Ga0070671_101529624 Ga0070671_1015296241 138
42 3300005356 Ga0070674_100359666 Ga0070674_1003596662 138
43 3300005365 Ga0070688_100051288 Ga0070688_1000512882 138
44 3300005435 Ga0070714_100062425 Ga0070714_1000624253 138
45 3300005436 Ga0070713_100064529 Ga0070713_1000645293 138
46 3300005436 Ga0070713_100114574 Ga0070713_1001145743 138
47 3300005437 Ga0070710_10204687 Ga0070710_102046872 138
48 3300005439 Ga0070711_100035068 Ga0070711_1000350681 138
49 3300005456 Ga0070678_102342555 Ga0070678_1023425551 138
50 3300005458 Ga0070681_10121663 Ga0070681_101216632 138
51 3300005458 Ga0070681_10542311 Ga0070681_105423112 138
52 3300005530 Ga0070679_100016478 Ga0070679_1000164785 138
53 3300005530 Ga0070679_100728471 Ga0070679_1007284712 138
54 3300005530 Ga0070679_101750600 Ga0070679_1017506001 138
55 3300005535 Ga0070684_100062555 Ga0070684_1000625552 138
56 3300005535 Ga0070684_100545821 Ga0070684_1005458211 138
57 3300005539 Ga0068853_101370335 Ga0068853_1013703351 138
58 3300005563 Ga0068855_100077435 Ga0068855_1000774353 138
59 3300005577 Ga0068857_100255596 Ga0068857_1002555961 138
60 3300005578 Ga0068854_100120150 Ga0068854_1001201501 138
61 3300005614 Ga0068856_100303659 Ga0068856_1003036592 138
62 3300005614 Ga0068856_100314617 Ga0068856_1003146172 138
63 3300005616 Ga0068852_100058058 Ga0068852_1000580582 138
64 3300006038 Ga0075365_10001096 Ga0075365_100010964 138
65 3300006175 Ga0070712_100078247 Ga0070712_1000782473 138
66 3300006178 Ga0075367_10038683 Ga0075367_100386832 138
67 3300009174 Ga0105241_10348985 Ga0105241_103489852 138
68 3300009174 Ga0105241_10624660 Ga0105241_106246602 138
69 3300009545 Ga0105237_10500984 Ga0105237_105009842 138
70 3300009551 Ga0105238_10270007 Ga0105238_102700072 138
71 3300009553 Ga0105249_10389612 Ga0105249_103896122 138
72 3300013105 Ga0157369_10002654 Ga0157369_1000265414 138
73 3300013307 Ga0157372_10115973 Ga0157372_101159731 138
74 3300014325 Ga0163163_10239251 Ga0163163_102392512 138
75 3300014969 Ga0157376_11412756 Ga0157376_114127562 138
76 3300020070 Ga0206356_10214755 Ga0206356_102147552 138
77 3300021384 Ga0213876_10247041 Ga0213876_102470412 138
78 3300022467 Ga0224712_10378100 Ga0224712_103781001 138
79 3300025906 Ga0207699_10075606 Ga0207699_100756062 138
80 3300025911 Ga0207654_10414278 Ga0207654_104142782 138
81 3300025912 Ga0207707_10008703 Ga0207707_1000870311 138
82 3300025912 Ga0207707_10016072 Ga0207707_100160724 138
83 3300025913 Ga0207695_10145468 Ga0207695_101454682 138
84 3300025914 Ga0207671_10287276 Ga0207671_102872762 138
85 3300025915 Ga0207693_10199556 Ga0207693_101995562 138
86 3300025916 Ga0207663_10680666 Ga0207663_106806662 138
87 3300025921 Ga0207652_10203197 Ga0207652_102031971 138
88 3300025921 Ga0207652_10883489 Ga0207652_108834892 138
89 3300025924 Ga0207694_10313122 Ga0207694_103131222 138
90 3300025928 Ga0207700_10103457 Ga0207700_101034572 138
91 3300025928 Ga0207700_10342819 Ga0207700_103428192 138
92 3300025929 Ga0207664_10057187 Ga0207664_100571873 138
93 3300025944 Ga0207661_10016193 Ga0207661_100161932 138
94 3300025949 Ga0207667_10270684 Ga0207667_102706842 138
95 3300025981 Ga0207640_10244038 Ga0207640_102440382 138
96 3300026023 Ga0207677_11082832 Ga0207677_110828323 138
97 3300026041 Ga0207639_10105338 Ga0207639_101053383 138
98 3300026041 Ga0207639_11476185 Ga0207639_114761851 138
99 3300026078 Ga0207702_10125918 Ga0207702_101259182 138
100 3300026078 Ga0207702_10259466 Ga0207702_102594662 138
101 3300026116 Ga0207674_10176221 Ga0207674_101762213 138
102 3300026142 Ga0207698_10279606 Ga0207698_102796062 138
103 3300035171 Ga0373946_0119144 Ga0373946_0119144_720_1136 138
104 3300035695 Ga0373927_0044100 Ga0373927_0044100_1280_1696 138
105 3300035695 Ga0373927_0309142 Ga0373927_0309142_168_584 138
106 3300035695 Ga0373927_0931372 Ga0373927_0931372_44_460 138
107 3300035725 Ga0373947_1036503 Ga0373947_1036503_82_498 138
108 3300037418 Ga0395900_0051257 Ga0395900_0051257_1974_2390 138
109 3300037466 Ga0395898_0029897 Ga0395898_0029897_4368_4784 138
110 3300037466 Ga0395898_0875834 Ga0395898_0875834_109_525 138
111 3300038443 Ga0395901_0905295 Ga0395901_0905295_349_765 138
112 3300038443 Ga0395901_1327581 Ga0395901_1327581_245_661 138
113 3300039437 Ga0436365_0191297 Ga0436365_0191297_319_735 138
114 3300039437 Ga0436365_1725135 Ga0436365_1725135_2256_2672 138
115 3300039450 Ga0436363_0070651 Ga0436363_0070651_38_460 138
116 3300039453 Ga0436362_1206612 Ga0436362_1206612_173_589 138
117 3300044684 Ga0466966_0428339 Ga0466966_0428339_93_509 138
118 3300044694 Ga0466963_0492972 Ga0466963_0492972_138_554 138
119 3300044706 Ga0466964_0561755 Ga0466964_0561755_11_427 138
120 3300045976 Ga0466967_0127975 Ga0466967_0127975_1741_2157 138
121 3300046455 Ga0495603_0095351 Ga0495603_0095351_938_1354 138
122 3300046531 Ga0495665_0027612 Ga0495665_0027612_465_881 138
123 3300046642 Ga0495634_0304780 Ga0495634_0304780_474_890 138
124 3300046681 Ga0495647_0341989 Ga0495647_0341989_54_470 138
125 3300046683 Ga0495658_0153635 Ga0495658_0153635_862_1278 138
126 3300047315 Ga0495581_0140005 Ga0495581_0140005_181_597 138
127 3300047317 Ga0495604_0876549 Ga0495604_0876549_116_532 138
128 3300047320 Ga0495672_0022747 Ga0495672_0022747_1802_2218 138
129 3300048929 Ga0496126_0713897 Ga0496126_0713897_323_739 138
130 3300049587 Ga0501071_0327068 Ga0501071_0327068_447_863 138
131 3300050490 nmdc:mga03n38_178599_c1 nmdc:mga03n38_178599_c1_586_1002 138
132 3300050491 nmdc:mga00v17_251140_c1 nmdc:mga00v17_251140_c1_128_544 138
133 3300050494 nmdc:mga06z11_48930_c1 nmdc:mga06z11_48930_c1_437_853 138
134 3300053078 Ga0495612_0054462 Ga0495612_0054462_1060_1476 138
135 3300053085 Ga0495619_0465465 Ga0495619_0465465_383_799 138
136 3300005338 Ga0068868_101183526 Ga0068868_1011835261 139
137 3300005539 Ga0068853_100680899 Ga0068853_1006808992 139
138 3300005841 Ga0068863_100044445 Ga0068863_1000444452 139
139 3300005842 Ga0068858_100919054 Ga0068858_1009190542 139
140 3300005843 Ga0068860_100000135 Ga0068860_100000135104 139
141 3300005983 Ga0081540_1070113 Ga0081540_10701133 139
142 3300006186 Ga0075369_10300648 Ga0075369_103006482 139
143 3300006237 Ga0097621_100195212 Ga0097621_1001952122 139
144 3300006358 Ga0068871_100248111 Ga0068871_1002481112 139
145 3300009101 Ga0105247_10004773 Ga0105247_1000477310 139
146 3300011119 Ga0105246_10091504 Ga0105246_100915043 139
147 3300025900 Ga0207710_10041520 Ga0207710_100415202 139
148 3300025915 Ga0207693_11176369 Ga0207693_111763692 139
149 3300025916 Ga0207663_10284038 Ga0207663_102840382 139
150 3300026035 Ga0207703_10556288 Ga0207703_105562882 139
151 3300026088 Ga0207641_10757999 Ga0207641_107579991 139
152 3300028381 Ga0268264_10000038 Ga0268264_10000038180 139
153 3300028381 Ga0268264_11220145 Ga0268264_112201452 139
154 3300030521 Ga0307511_10152782 Ga0307511_101527822 139
155 3300031507 Ga0307509_10281016 Ga0307509_102810161 139
156 3300031616 Ga0307508_10319396 Ga0307508_103193962 139
157 3300031730 Ga0307516_10007383 Ga0307516_1000738314 139
158 3300031730 Ga0307516_10329112 Ga0307516_103291122 139
159 3300031730 Ga0307516_10337316 Ga0307516_103373162 139
160 3300031901 Ga0307406_10319877 Ga0307406_103198772 139
161 3300032126 Ga0307415_101695517 Ga0307415_1016955171 139
162 3300033179 Ga0307507_10026738 Ga0307507_100267386 139
163 3300033180 Ga0307510_10321286 Ga0307510_103212862 139
164 3300035116 Ga0373945_0146590 Ga0373945_0146590_42_461 139
165 3300035171 Ga0373946_0398952 Ga0373946_0398952_112_531 139
166 3300035692 Ga0373935_0080888 Ga0373935_0080888_826_1245 139
167 3300046459 Ga0495629_0422351 Ga0495629_0422351_44_463 139
168 3300046461 Ga0495641_0136498 Ga0495641_0136498_424_843 139
169 3300046557 Ga0495622_0011312 Ga0495622_0011312_581_1000 139
170 3300046678 Ga0495599_0591430 Ga0495599_0591430_195_614 139
171 3300046683 Ga0495658_0610358 Ga0495658_0610358_43_462 139
172 3300048906 Ga0496103_0227029 Ga0496103_0227029_392_811 139
173 3300048909 Ga0496106_0000846 Ga0496106_0000846_6334_6753 139
174 3300048920 Ga0496117_0030192 Ga0496117_0030192_541_960 139
175 3300048921 Ga0496118_0005969 Ga0496118_0005969_2495_2914 139
176 3300048924 Ga0496121_0000099 Ga0496121_0000099_114159_114578 139
177 3300048924 Ga0496121_0192628 Ga0496121_0192628_583_1002 139
178 3300048927 Ga0496124_0004730 Ga0496124_0004730_11151_11570 139
179 3300048929 Ga0496126_0006199 Ga0496126_0006199_1669_2088 139
180 3300048929 Ga0496126_0074638 Ga0496126_0074638_699_1118 139
181 3300053080 Ga0500635_0012677 Ga0500635_0012677_724_1143 139
182 3300053091 Ga0500647_0298472 Ga0500647_0298472_162_581 139
183 3300053094 Ga0500566_0067401 Ga0500566_0067401_1191_1610 139
184 3300053097 Ga0500648_123471 Ga0500648_123471_202_621 139
185 3300053136 Ga0500559_0154134 Ga0500559_0154134_281_700 139
186 3300053140 Ga0500573_0262438 Ga0500573_0262438_165_584 139
187 3300053148 Ga0500590_234296 Ga0500590_234296_169_588 139
188 3300053150 Ga0500603_052099 Ga0500603_052099_240_659 139
189 3300053162 Ga0500638_084153 Ga0500638_084153_122_541 139
190 3300053177 Ga0500636_0105937 Ga0500636_0105937_947_1366 139
191 3300053177 Ga0500636_0106914 Ga0500636_0106914_222_641 139
192 3300053735 Ga0500596_004903 Ga0500596_004903_1690_2109 139
193 3300005337 Ga0070682_100058498 Ga0070682_1000584982 140
194 3300005338 Ga0068868_100009479 Ga0068868_1000094794 140
195 3300005339 Ga0070660_101769625 Ga0070660_1017696251 140
196 3300005355 Ga0070671_100791171 Ga0070671_1007911711 140
197 3300005455 Ga0070663_100085680 Ga0070663_1000856804 140
198 3300005456 Ga0070678_100214800 Ga0070678_1002148001 140
199 3300005535 Ga0070684_100250530 Ga0070684_1002505302 140
200 3300005547 Ga0070693_100122484 Ga0070693_1001224842 140
201 3300005564 Ga0070664_100050577 Ga0070664_1000505774 140
202 3300005616 Ga0068852_100103550 Ga0068852_1001035504 140
203 3300005618 Ga0068864_100442215 Ga0068864_1004422152 140
204 3300005842 Ga0068858_100751889 Ga0068858_1007518893 140
205 3300006237 Ga0097621_100034861 Ga0097621_1000348614 140
206 3300006358 Ga0068871_100137171 Ga0068871_1001371713 140
207 3300006881 Ga0068865_100215045 Ga0068865_1002150452 140
208 3300009098 Ga0105245_10009440 Ga0105245_100094409 140
209 3300009101 Ga0105247_10209790 Ga0105247_102097902 140
210 3300009176 Ga0105242_10194595 Ga0105242_101945951 140
211 3300009551 Ga0105238_10461986 Ga0105238_104619862 140
212 3300010375 Ga0105239_10073958 Ga0105239_100739584 140
213 3300011119 Ga0105246_10336439 Ga0105246_103364391 140
214 3300011119 Ga0105246_10779972 Ga0105246_107799721 140
215 3300013296 Ga0157374_10100928 Ga0157374_101009283 140
216 3300013297 Ga0157378_10034647 Ga0157378_100346474 140
217 3300013306 Ga0163162_10050431 Ga0163162_100504314 140
218 3300013308 Ga0157375_10026957 Ga0157375_100269576 140
219 3300014325 Ga0163163_10006739 Ga0163163_100067396 140
220 3300014745 Ga0157377_10162667 Ga0157377_101626672 140
221 3300014968 Ga0157379_10524050 Ga0157379_105240502 140
222 3300014969 Ga0157376_10108553 Ga0157376_101085532 140
223 3300021361 Ga0213872_10076119 Ga0213872_100761192 140
224 3300025934 Ga0207686_10657555 Ga0207686_106575551 140
225 3300025938 Ga0207704_10243649 Ga0207704_102436492 140
226 3300026023 Ga0207677_10024150 Ga0207677_100241504 140
227 3300026041 Ga0207639_10342310 Ga0207639_103423102 140
228 3300026067 Ga0207678_10060777 Ga0207678_100607774 140
229 3300026078 Ga0207702_10299087 Ga0207702_102990874 140
230 3300026121 Ga0207683_11011728 Ga0207683_110117281 140
231 3300026142 Ga0207698_10051871 Ga0207698_100518713 140
232 3300031731 Ga0307405_10981149 Ga0307405_109811492 140
233 3300032005 Ga0307411_10998341 Ga0307411_109983411 140
234 3300039447 Ga0436361_0391251 Ga0436361_0391251_1250_1672 140
235 3300041441 Ga0451787_295617 Ga0451787_295617_49_471 140
236 3300041459 Ga0451800_0441647 Ga0451800_0441647_238_660 140
237 3300046675 Ga0495657_0330468 Ga0495657_0330468_255_677 140
238 3300048903 Ga0496100_0012355 Ga0496100_0012355_3980_4402 140
239 3300048905 Ga0496102_0003231 Ga0496102_0003231_10392_10814 140
240 3300048907 Ga0496104_0067184 Ga0496104_0067184_214_636 140
241 3300048908 Ga0496105_0061167 Ga0496105_0061167_1812_2234 140
242 3300048909 Ga0496106_0196827 Ga0496106_0196827_797_1219 140
243 3300048910 Ga0496107_0012935 Ga0496107_0012935_703_1125 140
244 3300048911 Ga0496108_0065767 Ga0496108_0065767_2079_2501 140
245 3300048912 Ga0496109_0008675 Ga0496109_0008675_5184_5606 140
246 3300048913 Ga0496110_0086466 Ga0496110_0086466_1904_2326 140
247 3300048916 Ga0496113_0102611 Ga0496113_0102611_1435_1857 140
248 3300048917 Ga0496114_0004884 Ga0496114_0004884_9397_9819 140
249 3300048918 Ga0496115_0002667 Ga0496115_0002667_5429_5851 140
250 3300053093 Ga0500651_0423997 Ga0500651_0423997_146_568 140
251 3300053094 Ga0500566_0050480 Ga0500566_0050480_477_899 140
252 3300053102 Ga0500554_001888 Ga0500554_001888_2550_2972 140
253 3300053119 Ga0500595_000660 Ga0500595_000660_16805_17227 140
254 3300053150 Ga0500603_057075 Ga0500603_057075_527_949 140
255 3300053177 Ga0500636_0178780 Ga0500636_0178780_236_658 140
256 3300053178 Ga0500637_0001532 Ga0500637_0001532_8933_9355 140
257 3300055283 Ga0500661_001928 Ga0500661_001928_2643_3065 140
258 3300005293 Ga0065715_10423421 Ga0065715_104234211 141
259 3300005340 Ga0070689_101596766 Ga0070689_1015967661 141
260 3300005343 Ga0070687_100383457 Ga0070687_1003834572 141
261 3300005347 Ga0070668_100097206 Ga0070668_1000972064 141
262 3300005355 Ga0070671_100846012 Ga0070671_1008460122 141
263 3300005356 Ga0070674_100173066 Ga0070674_1001730662 141
264 3300005367 Ga0070667_101392877 Ga0070667_1013928771 141
265 3300005435 Ga0070714_101077046 Ga0070714_1010770461 141
266 3300005445 Ga0070708_100207938 Ga0070708_1002079382 141
267 3300005455 Ga0070663_100025740 Ga0070663_1000257404 141
268 3300005455 Ga0070663_100242743 Ga0070663_1002427432 141
269 3300005455 Ga0070663_100731575 Ga0070663_1007315752 141
270 3300005455 Ga0070663_101447115 Ga0070663_1014471151 141
271 3300005456 Ga0070678_100909241 Ga0070678_1009092411 141
272 3300005539 Ga0068853_100413526 Ga0068853_1004135262 141
273 3300005539 Ga0068853_101028121 Ga0068853_1010281211 141
274 3300005539 Ga0068853_101770216 Ga0068853_1017702161 141
275 3300005543 Ga0070672_100279899 Ga0070672_1002798992 141
276 3300005547 Ga0070693_100198708 Ga0070693_1001987082 141
277 3300005548 Ga0070665_100034649 Ga0070665_1000346492 141
278 3300005548 Ga0070665_100056456 Ga0070665_1000564564 141
279 3300005548 Ga0070665_100332646 Ga0070665_1003326461 141
280 3300005548 Ga0070665_100672139 Ga0070665_1006721392 141
281 3300005564 Ga0070664_100090557 Ga0070664_1000905572 141
282 3300005616 Ga0068852_100549064 Ga0068852_1005490642 141
283 3300005718 Ga0068866_10578946 Ga0068866_105789462 141
284 3300005841 Ga0068863_101363107 Ga0068863_1013631071 141
285 3300005981 Ga0081538_10055572 Ga0081538_100555722 141
286 3300005983 Ga0081540_1006530 Ga0081540_10065302 141
287 3300005983 Ga0081540_1082347 Ga0081540_10823471 141
288 3300005985 Ga0081539_10034446 Ga0081539_100344464 141
289 3300006038 Ga0075365_10030500 Ga0075365_100305001 141
290 3300006038 Ga0075365_10043087 Ga0075365_100430875 141
291 3300006038 Ga0075365_10048537 Ga0075365_100485374 141
292 3300006038 Ga0075365_10253300 Ga0075365_102533002 141
293 3300006038 Ga0075365_10680959 Ga0075365_106809592 141
294 3300006042 Ga0075368_10116587 Ga0075368_101165872 141
295 3300006048 Ga0075363_100047766 Ga0075363_1000477666 141
296 3300006051 Ga0075364_10068654 Ga0075364_100686542 141
297 3300006051 Ga0075364_10417615 Ga0075364_104176152 141
298 3300006058 Ga0075432_10017477 Ga0075432_100174773 141
299 3300006178 Ga0075367_10071359 Ga0075367_100713593 141
300 3300006178 Ga0075367_10164934 Ga0075367_101649344 141
301 3300006186 Ga0075369_10074129 Ga0075369_100741292 141
302 3300006237 Ga0097621_100936534 Ga0097621_1009365342 141
303 3300006237 Ga0097621_101029499 Ga0097621_1010294991 141
304 3300006353 Ga0075370_10019137 Ga0075370_100191372 141
305 3300006353 Ga0075370_10107685 Ga0075370_101076852 141
306 3300009101 Ga0105247_10548312 Ga0105247_105483122 141
307 3300009148 Ga0105243_10672200 Ga0105243_106722002 141
308 3300009177 Ga0105248_10045447 Ga0105248_100454477 141
309 3300009177 Ga0105248_10073969 Ga0105248_100739694 141
310 3300009545 Ga0105237_10117488 Ga0105237_101174883 141
311 3300009545 Ga0105237_11369205 Ga0105237_113692051 141
312 3300009551 Ga0105238_10152595 Ga0105238_101525954 141
313 3300009551 Ga0105238_10594827 Ga0105238_105948271 141
314 3300009551 Ga0105238_11256100 Ga0105238_112561001 141
315 3300010159 Ga0099796_10091360 Ga0099796_100913602 141
316 3300010159 Ga0099796_10128523 Ga0099796_101285232 141
317 3300010375 Ga0105239_10093154 Ga0105239_100931543 141
318 3300010375 Ga0105239_10243895 Ga0105239_102438952 141
319 3300013306 Ga0163162_10277633 Ga0163162_102776332 141
320 3300013308 Ga0157375_10933961 Ga0157375_109339612 141
321 3300014325 Ga0163163_10136913 Ga0163163_101369131 141
322 3300014326 Ga0157380_10274344 Ga0157380_102743443 141
323 3300014326 Ga0157380_11355030 Ga0157380_113550302 141
324 3300014968 Ga0157379_10187014 Ga0157379_101870143 141
325 3300025297 Ga0209758_1009397 Ga0209758_10093975 141
326 3300025297 Ga0209758_1017948 Ga0209758_10179482 141
327 3300025901 Ga0207688_10143879 Ga0207688_101438792 141
328 3300025914 Ga0207671_10583349 Ga0207671_105833492 141
329 3300025931 Ga0207644_10074539 Ga0207644_100745392 141
330 3300025934 Ga0207686_10597573 Ga0207686_105975731 141
331 3300025935 Ga0207709_10219523 Ga0207709_102195232 141
332 3300025937 Ga0207669_10168285 Ga0207669_101682853 141
333 3300025937 Ga0207669_11080708 Ga0207669_110807081 141
334 3300025945 Ga0207679_10164750 Ga0207679_101647503 141
335 3300025949 Ga0207667_11220349 Ga0207667_112203492 141
336 3300025972 Ga0207668_10074943 Ga0207668_100749434 141
337 3300026041 Ga0207639_10905476 Ga0207639_109054761 141
338 3300026067 Ga0207678_10008051 Ga0207678_100080516 141
339 3300026067 Ga0207678_10068429 Ga0207678_100684295 141
340 3300026067 Ga0207678_10246303 Ga0207678_102463032 141
341 3300026095 Ga0207676_11278732 Ga0207676_112787321 141
342 3300026121 Ga0207683_10175114 Ga0207683_101751142 141
343 3300026121 Ga0207683_10387046 Ga0207683_103870462 141
344 3300026142 Ga0207698_10712844 Ga0207698_107128442 141
345 3300027907 Ga0207428_10034034 Ga0207428_100340346 141
346 3300028379 Ga0268266_10003694 Ga0268266_1000369410 141
347 3300028379 Ga0268266_10071874 Ga0268266_100718744 141
348 3300028379 Ga0268266_10807836 Ga0268266_108078361 141
349 3300028786 Ga0307517_10000124 Ga0307517_1000012431 141
350 3300028794 Ga0307515_10049656 Ga0307515_100496562 141
351 3300031456 Ga0307513_10138368 Ga0307513_101383682 141
352 3300031456 Ga0307513_10160247 Ga0307513_101602472 141
353 3300031507 Ga0307509_10085524 Ga0307509_100855242 141
354 3300031649 Ga0307514_10280967 Ga0307514_102809672 141
355 3300031730 Ga0307516_10007317 Ga0307516_1000731710 141
356 3300031730 Ga0307516_10011746 Ga0307516_100117466 141
357 3300031911 Ga0307412_10127444 Ga0307412_101274442 141
358 3300032126 Ga0307415_100506890 Ga0307415_1005068902 141
359 3300033180 Ga0307510_10019988 Ga0307510_100199888 141
360 3300033544 Ga0316215_1025652 Ga0316215_10256521 141
361 3300035170 Ga0373943_0357470 Ga0373943_0357470_254_679 141
362 3300035691 Ga0373931_0014177 Ga0373931_0014177_1862_2350 141
363 3300035695 Ga0373927_0082502 Ga0373927_0082502_1561_1986 141
364 3300035695 Ga0373927_0096916 Ga0373927_0096916_120_545 141
365 3300035695 Ga0373927_0181322 Ga0373927_0181322_226_651 141
366 3300036459 Ga0372808_060860 Ga0372808_060860_59_484 141
367 3300037068 Ga0373925_0228010 Ga0373925_0228010_223_654 141
368 3300041413 Ga0439465_0082975 Ga0439465_0082975_16_441 141
369 3300041451 Ga0451791_1419379 Ga0451791_1419379_222_647 141
370 3300041512 Ga0451853_1660116 Ga0451853_1660116_106_531 141
371 3300046459 Ga0495629_0634298 Ga0495629_0634298_208_633 141
372 3300046460 Ga0495638_0134359 Ga0495638_0134359_402_827 141
373 3300046460 Ga0495638_0476975 Ga0495638_0476975_137_562 141
374 3300046473 Ga0495582_0050235 Ga0495582_0050235_1640_2065 141
375 3300046475 Ga0495639_0042249 Ga0495639_0042249_1406_1831 141
376 3300046491 Ga0495584_0037069 Ga0495584_0037069_1668_2093 141
377 3300046511 Ga0495608_0438937 Ga0495608_0438937_10_435 141
378 3300046523 Ga0495644_0049238 Ga0495644_0049238_202_639 141
379 3300046535 Ga0495586_0214975 Ga0495586_0214975_90_515 141
380 3300046615 Ga0495656_0097402 Ga0495656_0097402_683_1120 141
381 3300046616 Ga0495668_0145055 Ga0495668_0145055_647_1072 141
382 3300046660 Ga0495625_0085517 Ga0495625_0085517_102_527 141
383 3300046664 Ga0495659_0320510 Ga0495659_0320510_216_641 141
384 3300046683 Ga0495658_1105035 Ga0495658_1105035_29_454 141
385 3300046684 Ga0495669_0071987 Ga0495669_0071987_65_490 141
386 3300046689 Ga0495613_0408939 Ga0495613_0408939_110_592 141
387 3300046690 Ga0495624_0410759 Ga0495624_0410759_113_538 141
388 3300046694 Ga0495649_0169623 Ga0495649_0169623_556_981 141
389 3300047315 Ga0495581_0056236 Ga0495581_0056236_247_729 141
390 3300047319 Ga0495674_0118274 Ga0495674_0118274_1040_1465 141
391 3300047321 Ga0495676_0805458 Ga0495676_0805458_165_590 141
392 3300047445 Ga0495677_0033796 Ga0495677_0033796_612_1037 141
393 3300047469 Ga0495673_0082230 Ga0495673_0082230_531_956 141
394 3300047472 Ga0495686_0395568 Ga0495686_0395568_188_613 141
395 3300047673 Ga0495593_0374036 Ga0495593_0374036_276_701 141
396 3300048904 Ga0496101_0166337 Ga0496101_0166337_28_516 141
397 3300048904 Ga0496101_0477148 Ga0496101_0477148_404_829 141
398 3300048905 Ga0496102_0144548 Ga0496102_0144548_1328_1816 141
399 3300048906 Ga0496103_0089130 Ga0496103_0089130_367_792 141
400 3300048906 Ga0496103_0328917 Ga0496103_0328917_234_659 141
401 3300048907 Ga0496104_0216155 Ga0496104_0216155_715_1140 141
402 3300048908 Ga0496105_0047792 Ga0496105_0047792_1770_2258 141
403 3300048908 Ga0496105_0544956 Ga0496105_0544956_86_550 141
404 3300048909 Ga0496106_0048023 Ga0496106_0048023_477_965 141
405 3300048910 Ga0496107_0104716 Ga0496107_0104716_109_534 141
406 3300048911 Ga0496108_0198337 Ga0496108_0198337_321_809 141
407 3300048912 Ga0496109_0600888 Ga0496109_0600888_155_580 141
408 3300048913 Ga0496110_0050396 Ga0496110_0050396_1962_2450 141
409 3300048914 Ga0496111_0257228 Ga0496111_0257228_580_1068 141
410 3300048915 Ga0496112_0019963 Ga0496112_0019963_1827_2315 141
411 3300048916 Ga0496113_0047960 Ga0496113_0047960_1549_2037 141
412 3300048916 Ga0496113_0668873 Ga0496113_0668873_294_719 141
413 3300048918 Ga0496115_0373133 Ga0496115_0373133_128_553 141
414 3300048924 Ga0496121_0085559 Ga0496121_0085559_704_1129 141
415 3300048928 Ga0496125_0220966 Ga0496125_0220966_242_667 141
416 3300049460 Ga0495682_0279193 Ga0495682_0279193_101_526 141
417 3300049578 Ga0501042_0183199 Ga0501042_0183199_39_464 141
418 3300049583 Ga0501067_0108645 Ga0501067_0108645_1010_1435 141
419 3300049589 Ga0501073_0698816 Ga0501073_0698816_195_620 141
420 3300049592 Ga0501076_0140141 Ga0501076_0140141_1354_1779 141
421 3300049741 Ga0501079_0699230 Ga0501079_0699230_276_701 141
422 3300049822 Ga0501035_0182643 Ga0501035_0182643_175_600 141
423 3300049823 Ga0501044_0167456 Ga0501044_0167456_205_630 141
424 3300050489 nmdc:mga03683_348339_c1 nmdc:mga03683_348339_c1_227_652 141
425 3300050490 nmdc:mga03n38_10440_c1 nmdc:mga03n38_10440_c1_2513_2938 141
426 3300050490 nmdc:mga03n38_30187_c1 nmdc:mga03n38_30187_c1_765_1190 141
427 3300050491 nmdc:mga00v17_66831_c1 nmdc:mga00v17_66831_c1_1270_1695 141
428 3300050492 nmdc:mga0yw44_10911_c1 nmdc:mga0yw44_10911_c1_2965_3390 141
429 3300050492 nmdc:mga0yw44_370116_c1 nmdc:mga0yw44_370116_c1_415_840 141
430 3300050494 nmdc:mga06z11_207028_c1 nmdc:mga06z11_207028_c1_445_870 141
431 3300050494 nmdc:mga06z11_207311_c1 nmdc:mga06z11_207311_c1_677_1102 141
432 3300050494 nmdc:mga06z11_301135_c1 nmdc:mga06z11_301135_c1_305_730 141
433 3300050495 nmdc:mga04h51_3126_c1 nmdc:mga04h51_3126_c1_414_839 141
434 3300050496 nmdc:mga07m45_4680_c1 nmdc:mga07m45_4680_c1_193_618 141
435 3300050496 nmdc:mga07m45_67326_c1 nmdc:mga07m45_67326_c1_293_718 141
436 3300050516 nmdc:mga0sz30_503550_c1 nmdc:mga0sz30_503550_c1_11_436 141
437 3300053077 Ga0495601_0594352 Ga0495601_0594352_61_486 141
438 3300053084 Ga0495595_0012629 Ga0495595_0012629_1309_1734 141
439 3300053085 Ga0495619_0004132 Ga0495619_0004132_2970_3395 141
440 3300053119 Ga0500595_012400 Ga0500595_012400_1810_2235 141
441 3300053120 Ga0500597_063843 Ga0500597_063843_813_1238 141
442 3300053139 Ga0500568_0049672 Ga0500568_0049672_368_793 141
443 3300053142 Ga0500577_0058641 Ga0500577_0058641_751_1176 141
444 3300053151 Ga0500604_0196082 Ga0500604_0196082_172_597 141
445 3300053158 Ga0500627_0339019 Ga0500627_0339019_112_537 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08883

DOPA_dioxygen

Dopa 4,5-dioxygenase family

40

141

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2peb-assembly1.cif.gz_B crystal structure of a putative dioxygenase (npun_f1925) from nostoc punctiforme pcc 73102 at 1.46 a resolution 0.9666 10 119
2peb-assembly1.cif.gz_B crystal structure of a putative dioxygenase (npun_f1925) from nostoc punctiforme pcc 73102 at 1.46 a resolution 0.9096 10 119
2p8i-assembly1.cif.gz_A crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.40 a resolution 0.8808 10 119
2p8i-assembly1.cif.gz_A crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.40 a resolution 0.8242 10 119
2bv3-assembly1.cif.gz_A crystal structure of a mutant elongation factor g trapped with a gtp analogue 0.6603 16 92
ID Description Score Start End Superfamily
2pebB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.9656 10 119 3.30.70.1240
2pebB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.9077 10 119 3.30.70.1240
af_Q59TT2_5_125_3.30.70.1240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.9064 10 121 3.30.70.1240
af_A0A1D8PEW7_24_150_3.30.70.1240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.8666 12 124 3.30.70.1240
2p8iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.8656 10 119 3.30.70.1240
ID Description Score Start End GO Terms
AF-A0A537UQ74-F1-model_v4 4,5-dioxygenase 0.9785 28 123 GO:0051213
AF-A0A7Y3M8J0-F1-model_v4 DOPA 4,5-dioxygenase family protein 0.9778 15 119 GO:0051213
AF-A0A433VGC9-F1-model_v4 DOPA 4,5-dioxygenase 0.9773 15 119 GO:0051213
AF-A0A6L7XLN1-F1-model_v4 4,5-dioxygenase 0.977 16 119 GO:0051213
AF-A0A2E3K3Z4-F1-model_v4 4,5-dioxygenase 0.9763 16 120 GO:0051213

Feature Viewer

pLDDT pTM Quality
89.16 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map