F445474

General Info

Members Datasets Scaffolds Average Seq Length
445 263 445 257

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10000592|Ga0075433_100005928
Length 272
Sequence MEASATTAGAGAATALPTWRANAATIGALISRAKNELLRVPGAAIPGVLAPTIFFLGLNGVFGALTHLQGFTTGNYESFIVPVSMLQGAGFTGAAAGVNLARDIEQGWLDRLLVSPAPRWVLLAGTVLAASARALIPATFVFGMALALGAGWPGIDGLLVTYSMVAAMAAVAACWGSMLALHFKSQSAAPLMQAGTMALILTTTAYAPLALLQGWLQDIAWINPVTQVVDAARQGFVGGVTWAGTWPGIVALLGMLTFLGALALREMRRTAV

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
131 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
132 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
133 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
195 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
256 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
260 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
261 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 0
Rhizoplane 13.26
Rhizosphere 83.6
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001259 3300001977 Bacteria 4040
2 JGI24740J21852_10011313 3300001979 Unclassified 3402
3 JGI24748J21848_1000797 3300002074 Bacteria 3413
4 JGI24034J26672_10001618 3300002239 Bacteria 3012
5 JGI24742J22300_10003774 3300002244 Bacteria 2462
6 JGI25406J46586_10062672 3300003203 Unclassified 1194
7 Ga0070658_10092915 3300005327 Bacteria 2488
8 Ga0070683_100005586 3300005329 Bacteria 10503
9 Ga0070683_100008571 3300005329 Bacteria 8691
10 Ga0070683_100104319 3300005329 Bacteria 2672
11 Ga0070670_100028946 3300005331 Bacteria 4768
12 Ga0070677_10000028 3300005333 Bacteria 43011
13 Ga0068869_100217205 3300005334 Bacteria 1514
14 Ga0070680_100006526 3300005336 Bacteria 8871
15 Ga0070682_100000023 3300005337 Bacteria 206016
16 Ga0070682_100157082 3300005337 Bacteria 1567
17 Ga0068868_100000351 3300005338 Bacteria 31294
18 Ga0070660_100002123 3300005339 Bacteria 13674
19 Ga0070660_100189424 3300005339 Bacteria 1666
20 Ga0070691_10000004 3300005341 Bacteria 80156
21 Ga0070691_10005608 3300005341 Bacteria 5716
22 Ga0070661_100000004 3300005344 Bacteria 243876
23 Ga0070668_100189977 3300005347 Bacteria 1682
24 Ga0070675_100000050 3300005354 Bacteria 72016
25 Ga0070674_100000002 3300005356 Bacteria 271088
26 Ga0070674_100000205 3300005356 Bacteria 28334
27 Ga0070673_100000987 3300005364 Bacteria 16156
28 Ga0070688_100000161 3300005365 Bacteria 35812
29 Ga0070688_100006324 3300005365 Bacteria 6324
30 Ga0070659_100278149 3300005366 Bacteria 1392
31 Ga0070667_100341737 3300005367 Bacteria 1354
32 Ga0070710_10071173 3300005437 Bacteria 2005
33 Ga0070701_10125460 3300005438 Bacteria 1452
34 Ga0070700_100038776 3300005441 Bacteria 2906
35 Ga0070700_100062125 3300005441 Bacteria 2359
36 Ga0070694_100283840 3300005444 Bacteria 1263
37 Ga0070662_100000001 3300005457 Bacteria 317995
38 Ga0070681_10013258 3300005458 Bacteria 8190
39 Ga0068867_100000078 3300005459 Bacteria 59729
40 Ga0070685_10000010 3300005466 Bacteria 146946
41 Ga0070685_10000061 3300005466 Bacteria 63408
42 Ga0070707_100727732 3300005468 Unclassified 955
43 Ga0070684_100013485 3300005535 Bacteria 6593
44 Ga0070684_100444549 3300005535 Bacteria 1198
45 Ga0068853_100107665 3300005539 Bacteria 2472
46 Ga0068853_100136810 3300005539 Bacteria 2197
47 Ga0070695_100119455 3300005545 Unclassified 1801
48 Ga0070693_100000422 3300005547 Bacteria 19196
49 Ga0070665_100000022 3300005548 Bacteria 379286
50 Ga0070704_100028971 3300005549 Unclassified 3691
51 Ga0068855_100186729 3300005563 Bacteria 2341
52 Ga0070664_100134665 3300005564 Bacteria 2172
53 Ga0068854_100053492 3300005578 Bacteria 2900
54 Ga0068856_100445386 3300005614 Bacteria 1316
55 Ga0068856_100600323 3300005614 Bacteria 1122
56 Ga0068852_100000966 3300005616 Bacteria 18875
57 Ga0068852_100030860 3300005616 Bacteria 4417
58 Ga0068852_100229317 3300005616 Bacteria 1770
59 Ga0068864_100000090 3300005618 Bacteria 96213
60 Ga0068866_10000005 3300005718 Bacteria 196339
61 Ga0068866_10010280 3300005718 Bacteria 4008
62 Ga0068863_100000261 3300005841 Bacteria 55053
63 Ga0068863_100007352 3300005841 Bacteria 10782
64 Ga0068858_100000046 3300005842 Bacteria 127519
65 Ga0068858_100001140 3300005842 Bacteria 27503
66 Ga0068860_100015536 3300005843 Bacteria 7433
67 Ga0081455_10128327 3300005937 Bacteria 1987
68 Ga0081540_1000868 3300005983 Bacteria 27372
69 Ga0081539_10000776 3300005985 Bacteria 62705
70 Ga0081539_10027966 3300005985 Bacteria 3556
71 Ga0075365_10002854 3300006038 Bacteria 8676
72 Ga0075363_100053793 3300006048 Bacteria 2152
73 Ga0070715_10000008 3300006163 Bacteria 189899
74 Ga0070712_100000841 3300006175 Bacteria 18240
75 Ga0075428_100121117 3300006844 Bacteria 2849
76 Ga0075430_100006738 3300006846 Bacteria 9687
77 Ga0075431_100000075 3300006847 Bacteria 57994
78 Ga0075433_10000592 3300006852 Bacteria 24054
79 Ga0075433_10226495 3300006852 Bacteria 1660
80 Ga0075434_100078162 3300006871 Bacteria 3304
81 Ga0075434_100212267 3300006871 Bacteria 1955
82 Ga0068865_100000499 3300006881 Bacteria 22000
83 Ga0075435_100172797 3300007076 Bacteria 1824
84 Ga0111539_10067363 3300009094 Bacteria 4228
85 Ga0105245_10000040 3300009098 Bacteria 144005
86 Ga0105245_10000857 3300009098 Bacteria 27591
87 Ga0105245_10066634 3300009098 Bacteria 3259
88 Ga0114129_10003100 3300009147 Bacteria 23306
89 Ga0114129_10019623 3300009147 Bacteria 9622
90 Ga0114129_10282989 3300009147 Bacteria 2215
91 Ga0114129_10322137 3300009147 Bacteria 2054
92 Ga0114129_10470043 3300009147 Bacteria 1647
93 Ga0114129_10536683 3300009147 Bacteria 1523
94 Ga0105243_10473172 3300009148 Unclassified 1181
95 Ga0105242_10000063 3300009176 Bacteria 74721
96 Ga0105242_10000378 3300009176 Bacteria 35439
97 Ga0105242_10029978 3300009176 Bacteria 4342
98 Ga0105242_10143498 3300009176 Bacteria 2075
99 Ga0105242_10240810 3300009176 Bacteria 1626
100 Ga0105242_10330425 3300009176 Bacteria 1401
101 Ga0105248_10000037 3300009177 Bacteria 180751
102 Ga0105238_10000033 3300009551 Bacteria 172981
103 Ga0105249_10000218 3300009553 Bacteria 65480
104 Ga0105249_10133628 3300009553 Bacteria 2371
105 Ga0105239_10979681 3300010375 Bacteria 972
106 Ga0157371_10023113 3300013102 Bacteria 4547
107 Ga0157370_10012447 3300013104 Bacteria 8821
108 Ga0157370_10032132 3300013104 Bacteria 5128
109 Ga0157369_10001730 3300013105 Bacteria 26528
110 Ga0157374_10001797 3300013296 Bacteria 18046
111 Ga0157374_10143838 3300013296 Bacteria 2316
112 Ga0157374_10610696 3300013296 Bacteria 1101
113 Ga0157378_10138077 3300013297 Bacteria 2262
114 Ga0157372_10148932 3300013307 Bacteria 2700
115 Ga0157375_10000365 3300013308 Bacteria 41388
116 Ga0157375_10003564 3300013308 Bacteria 13514
117 Ga0157380_10001943 3300014326 Bacteria 13750
118 Ga0157379_10061309 3300014968 Bacteria 3363
119 Ga0157376_10068628 3300014969 Bacteria 3003
120 Ga0163161_10000064 3300017792 Bacteria 108508
121 Ga0163161_10083512 3300017792 Bacteria 2354
122 Ga0163161_10186545 3300017792 Bacteria 1592
123 Ga0207682_10000041 3300025893 Bacteria 52338
124 Ga0207642_10000005 3300025899 Bacteria 401934
125 Ga0207642_10022315 3300025899 Bacteria 2508
126 Ga0207710_10000384 3300025900 Bacteria 30192
127 Ga0207685_10000012 3300025905 Bacteria 189900
128 Ga0207705_10021210 3300025909 Bacteria 4633
129 Ga0207707_10009995 3300025912 Bacteria 8232
130 Ga0207693_10001350 3300025915 Bacteria 21696
131 Ga0207663_10130957 3300025916 Bacteria 1733
132 Ga0207660_10070777 3300025917 Bacteria 2536
133 Ga0207657_10009237 3300025919 Bacteria 9938
134 Ga0207657_10034342 3300025919 Bacteria 4562
135 Ga0207657_10182334 3300025919 Bacteria 1697
136 Ga0207649_10000003 3300025920 Bacteria 388908
137 Ga0207652_10000232 3300025921 Bacteria 58473
138 Ga0207646_10632870 3300025922 Unclassified 959
139 Ga0207694_10000012 3300025924 Bacteria 411218
140 Ga0207659_10000055 3300025926 Bacteria 74252
141 Ga0207687_10000095 3300025927 Bacteria 64664
142 Ga0207687_10000128 3300025927 Bacteria 50603
143 Ga0207687_10378994 3300025927 Unclassified 1158
144 Ga0207700_10000003 3300025928 Bacteria 500797
145 Ga0207664_10038372 3300025929 Bacteria 3714
146 Ga0207690_10014985 3300025932 Bacteria 4694
147 Ga0207690_10207509 3300025932 Bacteria 1492
148 Ga0207706_10000003 3300025933 Bacteria 345011
149 Ga0207686_10000230 3300025934 Bacteria 42566
150 Ga0207686_10013041 3300025934 Bacteria 4589
151 Ga0207686_10231454 3300025934 Bacteria 1340
152 Ga0207669_10000003 3300025937 Bacteria 252239
153 Ga0207669_10000021 3300025937 Bacteria 100327
154 Ga0207704_10000104 3300025938 Bacteria 46614
155 Ga0207704_10366863 3300025938 Unclassified 1126
156 Ga0207711_10000011 3300025941 Bacteria 518817
157 Ga0207689_10180505 3300025942 Bacteria 1741
158 Ga0207661_10001136 3300025944 Bacteria 17743
159 Ga0207661_10005761 3300025944 Bacteria 8736
160 Ga0207661_10034490 3300025944 Bacteria 3936
161 Ga0207661_10125336 3300025944 Bacteria 2193
162 Ga0207679_10109184 3300025945 Bacteria 2180
163 Ga0207667_10152415 3300025949 Bacteria 2379
164 Ga0207651_10005482 3300025960 Bacteria 6522
165 Ga0207712_10000027 3300025961 Bacteria 263739
166 Ga0207640_10040127 3300025981 Bacteria 2967
167 Ga0207658_10054310 3300025986 Bacteria 2964
168 Ga0207677_10000304 3300026023 Bacteria 36147
169 Ga0207677_10043799 3300026023 Bacteria 2978
170 Ga0207703_10000020 3300026035 Bacteria 251603
171 Ga0207703_10000042 3300026035 Bacteria 161459
172 Ga0207639_10029523 3300026041 Bacteria 4015
173 Ga0207639_10078164 3300026041 Bacteria 2611
174 Ga0207708_10084246 3300026075 Bacteria 2444
175 Ga0207708_10196192 3300026075 Bacteria 1609
176 Ga0207641_10000062 3300026088 Bacteria 159982
177 Ga0207641_10009398 3300026088 Bacteria 8058
178 Ga0207648_10000457 3300026089 Bacteria 45386
179 Ga0207676_10000016 3300026095 Bacteria 311561
180 Ga0207676_10505650 3300026095 Archaea 1148
181 Ga0207675_100099281 3300026118 Bacteria 2742
182 Ga0207675_100419352 3300026118 Unclassified 1321
183 Ga0207683_10443825 3300026121 Bacteria 1196
184 Ga0207698_10000015 3300026142 Bacteria 207368
185 Ga0207698_10207237 3300026142 Bacteria 1761
186 Ga0207698_10572265 3300026142 Bacteria 1110
187 Ga0207428_10031765 3300027907 Bacteria 4351
188 Ga0268266_10000029 3300028379 Bacteria 424015
189 Ga0268265_10134739 3300028380 Bacteria 2059
190 Ga0268264_10009671 3300028381 Bacteria 7986
191 Ga0268264_10319011 3300028381 Bacteria 1469
192 Ga0265337_1000167 3300028556 Bacteria 34055
193 Ga0265326_10000452 3300028558 Bacteria 16152
194 Ga0265326_10022348 3300028558 Bacteria 1812
195 Ga0265319_1000010 3300028563 Bacteria 188773
196 Ga0265322_10000005 3300028654 Bacteria 246112
197 Ga0265336_10008363 3300028666 Bacteria 3632
198 Ga0265338_10000287 3300028800 Bacteria 90818
199 Ga0265324_10000183 3300029957 Bacteria 48185
200 Ga0265328_10000354 3300031239 Bacteria 21630
201 Ga0265320_10000010 3300031240 Bacteria 250501
202 Ga0265329_10012376 3300031242 Bacteria 3066
203 Ga0265339_10128840 3300031249 Bacteria 1295
204 Ga0265331_10000217 3300031250 Bacteria 69142
205 Ga0265331_10024443 3300031250 Bacteria 3056
206 Ga0265327_10000040 3300031251 Bacteria 291052
207 Ga0265316_10042903 3300031344 Bacteria 3611
208 Ga0307408_100052144 3300031548 Bacteria 2950
209 Ga0265314_10000578 3300031711 Bacteria 46350
210 Ga0307405_10058375 3300031731 Bacteria 2428
211 Ga0307413_10005808 3300031824 Bacteria 5558
212 Ga0307413_10157266 3300031824 Bacteria 1592
213 Ga0307410_10008656 3300031852 Bacteria 5657
214 Ga0307410_10036241 3300031852 Bacteria 3210
215 Ga0307406_10059408 3300031901 Bacteria 2461
216 Ga0307406_10075721 3300031901 Bacteria 2221
217 Ga0307407_10005664 3300031903 Bacteria 5451
218 Ga0307409_100036987 3300031995 Bacteria 3594
219 Ga0307409_100081293 3300031995 Bacteria 2618
220 Ga0307409_100121892 3300031995 Bacteria 2210
221 Ga0307416_100001812 3300032002 Bacteria 11871
222 Ga0307416_100325582 3300032002 Bacteria 1541
223 Ga0307414_10122640 3300032004 Bacteria 2001
224 Ga0307411_10074365 3300032005 Bacteria 2315
225 Ga0307411_10141076 3300032005 Bacteria 1777
226 Ga0307415_100003542 3300032126 Bacteria 7963
227 Ga0307415_100156353 3300032126 Bacteria 1761
228 Ga0307415_100327033 3300032126 Unclassified 1281
229 Ga0373933_0157019 3300035724 Bacteria 1443
230 Ga0373933_0400017 3300035724 Unclassified 896
231 Ga0373937_0036966 3300036401 Bacteria 4450
232 Ga0373937_0130728 3300036401 Bacteria 2345
233 Ga0395899_0109438 3300037312 Bacteria 1988
234 Ga0395899_0161620 3300037312 Bacteria 1582
235 Ga0395900_0038561 3300037418 Bacteria 4925
236 Ga0395900_0043777 3300037418 Bacteria 4614
237 Ga0395900_0202809 3300037418 Bacteria 2006
238 Ga0395898_0697935 3300037466 Bacteria 957
239 Ga0395905_0005597 3300037471 Bacteria 12798
240 Ga0395905_0081287 3300037471 Unclassified 3037
241 Ga0395901_0004576 3300038443 Bacteria 13969
242 Ga0395901_0068454 3300038443 Bacteria 3698
243 Ga0395901_0091005 3300038443 Bacteria 3193
244 Ga0451789_0935175 3300041443 Bacteria 1357
245 Ga0451853_0533972 3300041512 Bacteria 5410
246 Ga0451853_2930316 3300041512 Bacteria 1002
247 Ga0466966_0188929 3300044684 Unclassified 1248
248 Ga0466963_0000141 3300044694 Bacteria 28151
249 Ga0466963_0049417 3300044694 Bacteria 2781
250 Ga0466963_0187322 3300044694 Bacteria 1445
251 Ga0466957_0142864 3300044842 Bacteria 1543
252 Ga0466960_0000018 3300044901 Bacteria 55572
253 Ga0466960_0005364 3300044901 Bacteria 5074
254 Ga0466960_0122986 3300044901 Unclassified 1361
255 Ga0466960_0154677 3300044901 Bacteria 1228
256 Ga0466958_0031592 3300045836 Bacteria 3148
257 Ga0466967_0000002 3300045976 Bacteria 219994
258 Ga0466967_0164715 3300045976 Bacteria 2083
259 Ga0495592_0002645 3300046454 Bacteria 12664
260 Ga0495592_0065671 3300046454 Bacteria 2656
261 Ga0495592_0259418 3300046454 Bacteria 1145
262 Ga0495603_0000102 3300046455 Bacteria 40074
263 Ga0495603_0004342 3300046455 Bacteria 8457
264 Ga0495629_0007304 3300046459 Bacteria 8139
265 Ga0495629_0017370 3300046459 Bacteria 5156
266 Ga0495629_0102099 3300046459 Bacteria 2001
267 Ga0495629_0126403 3300046459 Bacteria 1781
268 Ga0495641_0000004 3300046461 Bacteria 210501
269 Ga0495651_0026834 3300046462 Bacteria 4485
270 Ga0495653_0081411 3300046463 Bacteria 2393
271 Ga0495582_0000003 3300046473 Bacteria 168880
272 Ga0495639_0003050 3300046475 Bacteria 7293
273 Ga0495662_0000069 3300046476 Bacteria 36219
274 Ga0495662_0005283 3300046476 Bacteria 6470
275 Ga0495608_0000754 3300046511 Bacteria 22642
276 Ga0495608_0066973 3300046511 Bacteria 2350
277 Ga0495608_0082516 3300046511 Bacteria 2087
278 Ga0495618_0000004 3300046514 Bacteria 245690
279 Ga0495620_0000041 3300046515 Bacteria 112605
280 Ga0495628_0027139 3300046516 Bacteria 4662
281 Ga0495628_0034467 3300046516 Bacteria 4071
282 Ga0495628_0147717 3300046516 Bacteria 1791
283 Ga0495628_0192837 3300046516 Bacteria 1538
284 Ga0495630_0000026 3300046517 Bacteria 147084
285 Ga0495630_0020128 3300046517 Bacteria 4916
286 Ga0495643_0115442 3300046522 Bacteria 1361
287 Ga0495644_0001151 3300046523 Bacteria 10849
288 Ga0495652_0000018 3300046529 Bacteria 201634
289 Ga0495652_0005154 3300046529 Bacteria 12351
290 Ga0495652_0076113 3300046529 Bacteria 2785
291 Ga0495640_0015640 3300046533 Bacteria 5702
292 Ga0495586_0000588 3300046535 Bacteria 21115
293 Ga0495587_0001456 3300046536 Bacteria 15786
294 Ga0495598_0103678 3300046537 Bacteria 944
295 Ga0495621_0001513 3300046539 Bacteria 6035
296 Ga0495645_0065649 3300046543 Bacteria 2625
297 Ga0495645_0107165 3300046543 Bacteria 1981
298 Ga0495622_0001307 3300046557 Bacteria 12771
299 Ga0495633_0057302 3300046558 Bacteria 1830
300 Ga0495667_0000038 3300046559 Bacteria 131349
301 Ga0495656_0000466 3300046615 Bacteria 13187
302 Ga0495668_0052075 3300046616 Bacteria 2266
303 Ga0495634_0000002 3300046642 Bacteria 247842
304 Ga0495634_0002310 3300046642 Bacteria 15954
305 Ga0495635_0000005 3300046663 Bacteria 302178
306 Ga0495635_0161858 3300046663 Bacteria 1523
307 Ga0495657_0036524 3300046675 Bacteria 3395
308 Ga0495599_0006190 3300046678 Bacteria 7215
309 Ga0495647_0000005 3300046681 Bacteria 125996
310 Ga0495647_0005013 3300046681 Bacteria 4335
311 Ga0495658_0000001 3300046683 Bacteria 385362
312 Ga0495658_0101271 3300046683 Bacteria 1720
313 Ga0495669_0000609 3300046684 Bacteria 15639
314 Ga0495613_0000233 3300046689 Bacteria 53074
315 Ga0495613_0001632 3300046689 Bacteria 17071
316 Ga0495624_0000347 3300046690 Bacteria 36770
317 Ga0495624_0018953 3300046690 Bacteria 4598
318 Ga0495670_0004497 3300046691 Bacteria 6835
319 Ga0495649_0007318 3300046694 Bacteria 6747
320 Ga0495600_0005828 3300046809 Bacteria 7449
321 Ga0495600_0053795 3300046809 Bacteria 2629
322 Ga0495604_0011043 3300047317 Bacteria 7167
323 Ga0495604_0048820 3300047317 Bacteria 3291
324 Ga0495674_0000039 3300047319 Bacteria 97645
325 Ga0495676_0000499 3300047321 Bacteria 32193
326 Ga0495676_0009604 3300047321 Bacteria 8807
327 Ga0495676_0028517 3300047321 Bacteria 4765
328 Ga0495680_0000007 3300047322 Bacteria 152053
329 Ga0495680_0001001 3300047322 Bacteria 31451
330 Ga0495680_0007824 3300047322 Bacteria 9762
331 Ga0495680_0014672 3300047322 Bacteria 6777
332 Ga0495684_0107545 3300047471 Bacteria 2107
333 Ga0495684_0174745 3300047471 Bacteria 1595
334 Ga0495593_0056497 3300047673 Bacteria 2063
335 Ga0495593_0127009 3300047673 Bacteria 1296
336 Ga0495602_0000034 3300048088 Bacteria 140722
337 Ga0496100_0000001 3300048903 Bacteria 530179
338 Ga0496100_0000024 3300048903 Bacteria 116138
339 Ga0496101_0000028 3300048904 Bacteria 198664
340 Ga0496101_0000072 3300048904 Bacteria 116138
341 Ga0496101_0065821 3300048904 Bacteria 2642
342 Ga0496102_0000129 3300048905 Bacteria 104478
343 Ga0496102_0043196 3300048905 Bacteria 4086
344 Ga0496103_0000087 3300048906 Bacteria 104566
345 Ga0496103_0093012 3300048906 Bacteria 1904
346 Ga0496104_0000008 3300048907 Bacteria 516976
347 Ga0496104_0000230 3300048907 Bacteria 49225
348 Ga0496104_0013318 3300048907 Bacteria 7411
349 Ga0496104_0045172 3300048907 Bacteria 4142
350 Ga0496104_0261315 3300048907 Bacteria 1644
351 Ga0496105_0000003 3300048908 Bacteria 713251
352 Ga0496105_0000051 3300048908 Bacteria 90365
353 Ga0496105_0086328 3300048908 Bacteria 2593
354 Ga0496106_0000040 3300048909 Bacteria 108754
355 Ga0496106_0000042 3300048909 Bacteria 106662
356 Ga0496106_0000134 3300048909 Bacteria 55531
357 Ga0496107_0000002 3300048910 Bacteria 320871
358 Ga0496107_0000025 3300048910 Bacteria 116138
359 Ga0496107_0266219 3300048910 Bacteria 1275
360 Ga0496108_0000004 3300048911 Bacteria 545055
361 Ga0496108_0000005 3300048911 Bacteria 535059
362 Ga0496108_0050716 3300048911 Bacteria 3475
363 Ga0496108_0096646 3300048911 Bacteria 2516
364 Ga0496109_0000002 3300048912 Bacteria 443393
365 Ga0496109_0000013 3300048912 Bacteria 227469
366 Ga0496109_0000221 3300048912 Bacteria 56054
367 Ga0496109_0004919 3300048912 Bacteria 11154
368 Ga0496109_0131834 3300048912 Bacteria 2333
369 Ga0496109_0176412 3300048912 Bacteria 2006
370 Ga0496109_0182829 3300048912 Bacteria 1969
371 Ga0496109_0433151 3300048912 Bacteria 1242
372 Ga0496110_0738674 3300048913 Bacteria 887
373 Ga0496111_0151971 3300048914 Bacteria 1717
374 Ga0496111_0153805 3300048914 Bacteria 1707
375 Ga0496112_0000026 3300048915 Bacteria 144758
376 Ga0496112_0005136 3300048915 Bacteria 11250
377 Ga0496112_0129338 3300048915 Bacteria 2496
378 Ga0496112_0186546 3300048915 Bacteria 2037
379 Ga0496112_0301912 3300048915 Bacteria 1546
380 Ga0496113_0006103 3300048916 Bacteria 7601
381 Ga0496113_0010457 3300048916 Bacteria 6135
382 Ga0496113_0145200 3300048916 Bacteria 1869
383 Ga0496113_0198449 3300048916 Bacteria 1594
384 Ga0496114_0000003 3300048917 Bacteria 630981
385 Ga0496114_0017455 3300048917 Bacteria 5792
386 Ga0496114_0036649 3300048917 Bacteria 4055
387 Ga0496114_0196956 3300048917 Bacteria 1763
388 Ga0496114_0241664 3300048917 Bacteria 1588
389 Ga0496114_0262824 3300048917 Unclassified 1520
390 Ga0496114_0527358 3300048917 Bacteria 1044
391 Ga0496115_0000016 3300048918 Bacteria 187067
392 Ga0496115_0000827 3300048918 Bacteria 22678
393 Ga0496115_0004109 3300048918 Bacteria 10504
394 Ga0496115_0017761 3300048918 Bacteria 5446
395 Ga0496117_0102275 3300048920 Bacteria 1809
396 Ga0496125_0026591 3300048928 Bacteria 5268
397 Ga0501042_0001883 3300049578 Bacteria 12596
398 Ga0501042_0059764 3300049578 Bacteria 2722
399 Ga0501068_0300928 3300049584 Bacteria 1027
400 Ga0501069_0084783 3300049585 Bacteria 1787
401 Ga0501070_0517489 3300049586 Bacteria 957
402 Ga0501072_0414742 3300049588 Bacteria 1068
403 Ga0501074_0028379 3300049590 Bacteria 4056
404 Ga0501074_0068356 3300049590 Bacteria 2554
405 Ga0501221_052708 3300049704 Bacteria 921
406 Ga0501079_0277833 3300049741 Bacteria 1310
407 Ga0501079_0442527 3300049741 Bacteria 1020
408 Ga0501081_0061192 3300049743 Bacteria 2610
409 Ga0501081_0431013 3300049743 Bacteria 978
410 Ga0501045_0261203 3300049824 Bacteria 1289
411 nmdc:mga03n38_118580_c1 3300050490 Unclassified 1298
412 nmdc:mga0yw44_10849_c1 3300050492 Bacteria 4671
413 nmdc:mga0yw44_22111_c1 3300050492 Bacteria 3559
414 nmdc:mga05p37_1124470_c1 3300050507 Bacteria 820
415 nmdc:mga05p37_124027_c1 3300050507 Bacteria 3173
416 nmdc:mga05p37_19763_c1 3300050507 Bacteria 8149
417 nmdc:mga05p37_464964_c1 3300050507 Bacteria 1461
418 nmdc:mga06r32_244_c1 3300050510 Bacteria 44802
419 nmdc:mga08y16_407501_c1 3300050511 Bacteria 1391
420 nmdc:mga08y16_596691_c1 3300050511 Bacteria 1113
421 nmdc:mga0n895_15741_c1 3300050512 Bacteria 6913
422 nmdc:mga0n895_184700_c1 3300050512 Bacteria 2116
423 nmdc:mga0n895_71922_c1 3300050512 Bacteria 3430
424 nmdc:mga0rr50_171055_c1 3300050513 Bacteria 1770
425 nmdc:mga0a205_49937_c1 3300050515 Bacteria 4038
426 nmdc:mga0a205_4_c1 3300050515 Bacteria 168154
427 Ga0495601_0000029 3300053077 Bacteria 111437
428 Ga0495601_0002066 3300053077 Bacteria 11262
429 Ga0495601_0046850 3300053077 Bacteria 2721
430 Ga0495601_0407185 3300053077 Bacteria 881
431 Ga0495612_0001047 3300053078 Bacteria 11336
432 Ga0495655_0000010 3300053083 Bacteria 125615
433 Ga0495655_0004998 3300053083 Bacteria 2312
434 Ga0495595_0000921 3300053084 Bacteria 11343
435 Ga0495595_0017979 3300053084 Bacteria 3048
436 Ga0495595_0093706 3300053084 Bacteria 1443
437 Ga0495619_0000001 3300053085 Bacteria 586054
438 Ga0495619_0000506 3300053085 Bacteria 25971
439 Ga0495619_0002596 3300053085 Bacteria 11799
440 Ga0500556_0000753 3300053104 Bacteria 19339
441 Ga0500614_000156 3300053123 Bacteria 17306
442 Ga0500628_000072 3300053129 Bacteria 26251
443 Ga0500616_0005157 3300053153 Bacteria 8970
444 Ga0500616_0007862 3300053153 Bacteria 6711
445 Ga0530510_0081745 3300061734 Bacteria 2353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0241664 Ga0496114_0241664_253_972 215
2 3300048907 Ga0496104_0261315 Ga0496104_0261315_14_691 224
3 3300048912 Ga0496109_0433151 Ga0496109_0433151_552_1229 224
4 3300048913 Ga0496110_0738674 Ga0496110_0738674_32_709 224
5 3300048917 Ga0496114_0262824 Ga0496114_0262824_11_688 224
6 3300049704 Ga0501221_052708 Ga0501221_052708_192_911 224
7 3300028380 Ga0268265_10134739 Ga0268265_101347392 225
8 3300025919 Ga0207657_10034342 Ga0207657_100343422 227
9 3300048915 Ga0496112_0186546 Ga0496112_0186546_35_766 227
10 3300005327 Ga0070658_10092915 Ga0070658_100929154 228
11 3300014968 Ga0157379_10061309 Ga0157379_100613092 229
12 3300009147 Ga0114129_10536683 Ga0114129_105366832 230
13 3300049584 Ga0501068_0300928 Ga0501068_0300928_197_949 230
14 3300005356 Ga0070674_100000002 Ga0070674_10000000225 232
15 3300009148 Ga0105243_10473172 Ga0105243_104731721 232
16 3300009176 Ga0105242_10029978 Ga0105242_100299784 232
17 3300025934 Ga0207686_10013041 Ga0207686_100130414 232
18 3300025937 Ga0207669_10000003 Ga0207669_10000003270 232
19 3300050507 nmdc:mga05p37_1124470_c1 nmdc:mga05p37_1124470_c1_104_805 232
20 3300044901 Ga0466960_0122986 Ga0466960_0122986_486_1250 235
21 3300044901 Ga0466960_0005364 Ga0466960_0005364_2496_3305 236
22 3300046539 Ga0495621_0001513 Ga0495621_0001513_53_844 236
23 3300048916 Ga0496113_0198449 Ga0496113_0198449_45_836 237
24 3300010375 Ga0105239_10979681 Ga0105239_109796812 238
25 3300031548 Ga0307408_100052144 Ga0307408_1000521443 238
26 3300031731 Ga0307405_10058375 Ga0307405_100583753 238
27 3300031824 Ga0307413_10005808 Ga0307413_100058086 238
28 3300031852 Ga0307410_10008656 Ga0307410_100086566 238
29 3300031901 Ga0307406_10075721 Ga0307406_100757212 238
30 3300031903 Ga0307407_10005664 Ga0307407_100056645 238
31 3300031995 Ga0307409_100036987 Ga0307409_1000369873 238
32 3300032002 Ga0307416_100001812 Ga0307416_1000018127 238
33 3300032005 Ga0307411_10074365 Ga0307411_100743652 238
34 3300032126 Ga0307415_100003542 Ga0307415_1000035427 238
35 3300037312 Ga0395899_0109438 Ga0395899_0109438_185_952 238
36 3300037418 Ga0395900_0038561 Ga0395900_0038561_1886_2653 238
37 3300037471 Ga0395905_0005597 Ga0395905_0005597_11881_12648 238
38 3300048914 Ga0496111_0153805 Ga0496111_0153805_685_1476 239
39 3300048916 Ga0496113_0006103 Ga0496113_0006103_5248_6039 239
40 3300006847 Ga0075431_100000075 Ga0075431_10000007549 240
41 3300006852 Ga0075433_10226495 Ga0075433_102264952 240
42 3300006871 Ga0075434_100078162 Ga0075434_1000781623 240
43 3300006871 Ga0075434_100212267 Ga0075434_1002122672 240
44 3300009147 Ga0114129_10019623 Ga0114129_100196239 240
45 3300009147 Ga0114129_10322137 Ga0114129_103221372 240
46 3300027907 Ga0207428_10031765 Ga0207428_100317657 240
47 3300044684 Ga0466966_0188929 Ga0466966_0188929_17_787 240
48 3300049588 Ga0501072_0414742 Ga0501072_0414742_239_1045 240
49 3300049824 Ga0501045_0261203 Ga0501045_0261203_392_1174 240
50 3300050492 nmdc:mga0yw44_10849_c1 nmdc:mga0yw44_10849_c1_1195_1965 240
51 3300050507 nmdc:mga05p37_124027_c1 nmdc:mga05p37_124027_c1_1339_2109 240
52 3300050510 nmdc:mga06r32_244_c1 nmdc:mga06r32_244_c1_656_1426 240
53 3300050511 nmdc:mga08y16_596691_c1 nmdc:mga08y16_596691_c1_85_855 240
54 3300050512 nmdc:mga0n895_184700_c1 nmdc:mga0n895_184700_c1_804_1574 240
55 3300050512 nmdc:mga0n895_71922_c1 nmdc:mga0n895_71922_c1_1850_2620 240
56 3300050515 nmdc:mga0a205_49937_c1 nmdc:mga0a205_49937_c1_2560_3330 240
57 3300009098 Ga0105245_10066634 Ga0105245_100666343 241
58 3300025927 Ga0207687_10378994 Ga0207687_103789941 241
59 3300048905 Ga0496102_0043196 Ga0496102_0043196_260_1030 241
60 3300048907 Ga0496104_0045172 Ga0496104_0045172_405_1175 241
61 3300048917 Ga0496114_0036649 Ga0496114_0036649_215_985 241
62 3300048918 Ga0496115_0017761 Ga0496115_0017761_1469_2239 241
63 3300028558 Ga0265326_10022348 Ga0265326_100223482 242
64 3300028563 Ga0265319_1000010 Ga0265319_100001064 242
65 3300028800 Ga0265338_10000287 Ga0265338_1000028745 242
66 3300031250 Ga0265331_10024443 Ga0265331_100244432 242
67 3300032126 Ga0307415_100327033 Ga0307415_1003270332 242
68 3300046529 Ga0495652_0000018 Ga0495652_0000018_101027_101818 242
69 3300046536 Ga0495587_0001456 Ga0495587_0001456_1265_2056 242
70 3300046557 Ga0495622_0001307 Ga0495622_0001307_7303_8121 242
71 3300048915 Ga0496112_0301912 Ga0496112_0301912_454_1218 242
72 3300048916 Ga0496113_0145200 Ga0496113_0145200_120_884 242
73 3300049586 Ga0501070_0517489 Ga0501070_0517489_35_808 242
74 3300049590 Ga0501074_0028379 Ga0501074_0028379_2527_3300 242
75 3300049741 Ga0501079_0277833 Ga0501079_0277833_195_989 242
76 3300053085 Ga0495619_0000001 Ga0495619_0000001_426439_427245 242
77 3300005331 Ga0070670_100028946 Ga0070670_1000289465 243
78 3300005333 Ga0070677_10000028 Ga0070677_1000002843 243
79 3300005334 Ga0068869_100217205 Ga0068869_1002172052 243
80 3300005337 Ga0070682_100157082 Ga0070682_1001570822 243
81 3300005437 Ga0070710_10071173 Ga0070710_100711733 243
82 3300005539 Ga0068853_100136810 Ga0068853_1001368103 243
83 3300005614 Ga0068856_100600323 Ga0068856_1006003232 243
84 3300005616 Ga0068852_100000966 Ga0068852_10000096616 243
85 3300006881 Ga0068865_100000499 Ga0068865_10000049914 243
86 3300009177 Ga0105248_10000037 Ga0105248_10000037173 243
87 3300013102 Ga0157371_10023113 Ga0157371_100231132 243
88 3300013104 Ga0157370_10032132 Ga0157370_100321323 243
89 3300025893 Ga0207682_10000041 Ga0207682_1000004154 243
90 3300025938 Ga0207704_10000104 Ga0207704_100001042 243
91 3300025941 Ga0207711_10000011 Ga0207711_10000011370 243
92 3300025942 Ga0207689_10180505 Ga0207689_101805052 243
93 3300026041 Ga0207639_10029523 Ga0207639_100295234 243
94 3300026142 Ga0207698_10000015 Ga0207698_10000015118 243
95 3300041443 Ga0451789_0935175 Ga0451789_0935175_424_1215 243
96 3300046615 Ga0495656_0000466 Ga0495656_0000466_296_1087 243
97 3300046642 Ga0495634_0000002 Ga0495634_0000002_108443_109234 243
98 3300047673 Ga0495593_0056497 Ga0495593_0056497_56_859 243
99 3300048911 Ga0496108_0000005 Ga0496108_0000005_447036_447839 243
100 3300048912 Ga0496109_0000002 Ga0496109_0000002_87253_88056 243
101 3300049743 Ga0501081_0061192 Ga0501081_0061192_423_1175 243
102 3300053083 Ga0495655_0004998 Ga0495655_0004998_42_857 243
103 3300005329 Ga0070683_100005586 Ga0070683_1000055863 244
104 3300005563 Ga0068855_100186729 Ga0068855_1001867292 244
105 3300005616 Ga0068852_100030860 Ga0068852_1000308605 244
106 3300005718 Ga0068866_10010280 Ga0068866_100102803 244
107 3300005841 Ga0068863_100007352 Ga0068863_1000073527 244
108 3300005842 Ga0068858_100000046 Ga0068858_10000004657 244
109 3300005983 Ga0081540_1000868 Ga0081540_10008689 244
110 3300006048 Ga0075363_100053793 Ga0075363_1000537932 244
111 3300006175 Ga0070712_100000841 Ga0070712_1000008414 244
112 3300007076 Ga0075435_100172797 Ga0075435_1001727972 244
113 3300013296 Ga0157374_10610696 Ga0157374_106106962 244
114 3300013308 Ga0157375_10000365 Ga0157375_100003657 244
115 3300025899 Ga0207642_10022315 Ga0207642_100223153 244
116 3300025915 Ga0207693_10001350 Ga0207693_1000135012 244
117 3300025944 Ga0207661_10001136 Ga0207661_100011369 244
118 3300025949 Ga0207667_10152415 Ga0207667_101524152 244
119 3300026035 Ga0207703_10000042 Ga0207703_1000004222 244
120 3300026088 Ga0207641_10009398 Ga0207641_100093989 244
121 3300026142 Ga0207698_10572265 Ga0207698_105722651 244
122 3300046459 Ga0495629_0007304 Ga0495629_0007304_2996_3787 244
123 3300046459 Ga0495629_0017370 Ga0495629_0017370_2913_3704 244
124 3300046462 Ga0495651_0026834 Ga0495651_0026834_2111_2902 244
125 3300046511 Ga0495608_0066973 Ga0495608_0066973_834_1640 244
126 3300046516 Ga0495628_0147717 Ga0495628_0147717_926_1732 244
127 3300046529 Ga0495652_0076113 Ga0495652_0076113_1514_2305 244
128 3300047321 Ga0495676_0028517 Ga0495676_0028517_1412_2203 244
129 3300048905 Ga0496102_0000129 Ga0496102_0000129_101018_101821 244
130 3300048906 Ga0496103_0000087 Ga0496103_0000087_101016_101819 244
131 3300048911 Ga0496108_0050716 Ga0496108_0050716_2630_3436 244
132 3300048912 Ga0496109_0004919 Ga0496109_0004919_62_868 244
133 3300048920 Ga0496117_0102275 Ga0496117_0102275_581_1384 244
134 3300049578 Ga0501042_0059764 Ga0501042_0059764_1431_2234 244
135 3300050490 nmdc:mga03n38_118580_c1 nmdc:mga03n38_118580_c1_369_1148 244
136 3300050513 nmdc:mga0rr50_171055_c1 nmdc:mga0rr50_171055_c1_599_1378 244
137 3300053077 Ga0495601_0046850 Ga0495601_0046850_910_1701 244
138 3300053083 Ga0495655_0000010 Ga0495655_0000010_122063_122866 244
139 3300053129 Ga0500628_000072 Ga0500628_000072_12759_13562 244
140 3300005365 Ga0070688_100000161 Ga0070688_10000016130 245
141 3300005466 Ga0070685_10000061 Ga0070685_1000006159 245
142 3300013105 Ga0157369_10001730 Ga0157369_100017307 245
143 3300047321 Ga0495676_0009604 Ga0495676_0009604_4506_5297 245
144 3300048903 Ga0496100_0000001 Ga0496100_0000001_65415_66206 245
145 3300048904 Ga0496101_0000028 Ga0496101_0000028_65404_66195 245
146 3300048909 Ga0496106_0000134 Ga0496106_0000134_867_1658 245
147 3300048910 Ga0496107_0000002 Ga0496107_0000002_182282_183073 245
148 3300002074 JGI24748J21848_1000797 JGI24748J21848_10007973 246
149 3300002239 JGI24034J26672_10001618 JGI24034J26672_100016183 246
150 3300002244 JGI24742J22300_10003774 JGI24742J22300_100037743 246
151 3300009176 Ga0105242_10143498 Ga0105242_101434983 246
152 3300013104 Ga0157370_10012447 Ga0157370_100124477 246
153 3300044901 Ga0466960_0154677 Ga0466960_0154677_55_837 246
154 3300037471 Ga0395905_0081287 Ga0395905_0081287_948_1694 247
155 3300038443 Ga0395901_0004576 Ga0395901_0004576_5358_6104 247
156 3300046529 Ga0495652_0005154 Ga0495652_0005154_3029_3820 247
157 3300046543 Ga0495645_0065649 Ga0495645_0065649_28_819 247
158 3300036401 Ga0373937_0130728 Ga0373937_0130728_518_1294 248
159 3300053085 Ga0495619_0000506 Ga0495619_0000506_4818_5594 248
160 3300005578 Ga0068854_100053492 Ga0068854_1000534922 249
161 3300009094 Ga0111539_10067363 Ga0111539_100673636 249
162 3300009147 Ga0114129_10470043 Ga0114129_104700432 249
163 3300025981 Ga0207640_10040127 Ga0207640_100401274 249
164 3300026121 Ga0207683_10443825 Ga0207683_104438251 249
165 3300050507 nmdc:mga05p37_464964_c1 nmdc:mga05p37_464964_c1_363_1124 249
166 3300050511 nmdc:mga08y16_407501_c1 nmdc:mga08y16_407501_c1_350_1111 249
167 3300053104 Ga0500556_0000753 Ga0500556_0000753_2769_3527 251
168 3300053153 Ga0500616_0007862 Ga0500616_0007862_5844_6602 251
169 3300005339 Ga0070660_100002123 Ga0070660_10000212314 252
170 3300005438 Ga0070701_10125460 Ga0070701_101254602 252
171 3300005535 Ga0070684_100444549 Ga0070684_1004445492 252
172 3300009147 Ga0114129_10282989 Ga0114129_102829892 252
173 3300013307 Ga0157372_10148932 Ga0157372_101489322 252
174 3300025909 Ga0207705_10021210 Ga0207705_100212101 252
175 3300025919 Ga0207657_10009237 Ga0207657_1000923710 252
176 3300025934 Ga0207686_10000230 Ga0207686_1000023032 252
177 3300025944 Ga0207661_10125336 Ga0207661_101253363 252
178 3300026023 Ga0207677_10043799 Ga0207677_100437993 252
179 3300026095 Ga0207676_10505650 Ga0207676_105056502 252
180 3300028381 Ga0268264_10319011 Ga0268264_103190112 252
181 3300031824 Ga0307413_10157266 Ga0307413_101572662 252
182 3300031852 Ga0307410_10036241 Ga0307410_100362414 252
183 3300031901 Ga0307406_10059408 Ga0307406_100594082 252
184 3300031995 Ga0307409_100081293 Ga0307409_1000812932 252
185 3300031995 Ga0307409_100121892 Ga0307409_1001218922 252
186 3300032002 Ga0307416_100325582 Ga0307416_1003255822 252
187 3300032004 Ga0307414_10122640 Ga0307414_101226402 252
188 3300032005 Ga0307411_10141076 Ga0307411_101410762 252
189 3300032126 Ga0307415_100156353 Ga0307415_1001563532 252
190 3300037312 Ga0395899_0161620 Ga0395899_0161620_594_1358 252
191 3300037418 Ga0395900_0202809 Ga0395900_0202809_314_1078 252
192 3300037466 Ga0395898_0697935 Ga0395898_0697935_145_909 252
193 3300038443 Ga0395901_0091005 Ga0395901_0091005_1802_2566 252
194 3300041512 Ga0451853_2930316 Ga0451853_2930316_126_890 252
195 3300044694 Ga0466963_0187322 Ga0466963_0187322_144_911 252
196 3300044842 Ga0466957_0142864 Ga0466957_0142864_638_1405 252
197 3300044901 Ga0466960_0000018 Ga0466960_0000018_34048_34812 252
198 3300048904 Ga0496101_0065821 Ga0496101_0065821_1542_2306 252
199 3300048906 Ga0496103_0093012 Ga0496103_0093012_1023_1787 252
200 3300048907 Ga0496104_0013318 Ga0496104_0013318_5692_6456 252
201 3300048908 Ga0496105_0086328 Ga0496105_0086328_603_1367 252
202 3300048912 Ga0496109_0176412 Ga0496109_0176412_1209_1973 252
203 3300048912 Ga0496109_0182829 Ga0496109_0182829_776_1540 252
204 3300048914 Ga0496111_0151971 Ga0496111_0151971_414_1178 252
205 3300048915 Ga0496112_0005136 Ga0496112_0005136_6198_6962 252
206 3300048915 Ga0496112_0129338 Ga0496112_0129338_734_1498 252
207 3300048916 Ga0496113_0010457 Ga0496113_0010457_730_1494 252
208 3300048917 Ga0496114_0527358 Ga0496114_0527358_118_882 252
209 3300049585 Ga0501069_0084783 Ga0501069_0084783_287_1051 252
210 3300049590 Ga0501074_0068356 Ga0501074_0068356_231_995 252
211 3300049741 Ga0501079_0442527 Ga0501079_0442527_119_883 252
212 3300049743 Ga0501081_0431013 Ga0501081_0431013_12_788 252
213 3300053153 Ga0500616_0005157 Ga0500616_0005157_7735_8499 252
214 3300061734 Ga0530510_0081745 Ga0530510_0081745_1311_2087 252
215 3300035724 Ga0373933_0400017 Ga0373933_0400017_44_811 253
216 3300001979 JGI24740J21852_10011313 JGI24740J21852_100113132 254
217 3300003203 JGI25406J46586_10062672 JGI25406J46586_100626722 254
218 3300005329 Ga0070683_100008571 Ga0070683_1000085712 254
219 3300005329 Ga0070683_100104319 Ga0070683_1001043193 254
220 3300005336 Ga0070680_100006526 Ga0070680_1000065269 254
221 3300005337 Ga0070682_100000023 Ga0070682_100000023174 254
222 3300005338 Ga0068868_100000351 Ga0068868_10000035122 254
223 3300005339 Ga0070660_100189424 Ga0070660_1001894242 254
224 3300005341 Ga0070691_10000004 Ga0070691_1000000437 254
225 3300005341 Ga0070691_10005608 Ga0070691_100056086 254
226 3300005344 Ga0070661_100000004 Ga0070661_100000004250 254
227 3300005347 Ga0070668_100189977 Ga0070668_1001899772 254
228 3300005354 Ga0070675_100000050 Ga0070675_10000005053 254
229 3300005356 Ga0070674_100000205 Ga0070674_10000020515 254
230 3300005364 Ga0070673_100000987 Ga0070673_10000098714 254
231 3300005365 Ga0070688_100006324 Ga0070688_1000063243 254
232 3300005366 Ga0070659_100278149 Ga0070659_1002781492 254
233 3300005367 Ga0070667_100341737 Ga0070667_1003417372 254
234 3300005441 Ga0070700_100038776 Ga0070700_1000387761 254
235 3300005441 Ga0070700_100062125 Ga0070700_1000621252 254
236 3300005444 Ga0070694_100283840 Ga0070694_1002838402 254
237 3300005457 Ga0070662_100000001 Ga0070662_100000001101 254
238 3300005458 Ga0070681_10013258 Ga0070681_100132586 254
239 3300005459 Ga0068867_100000078 Ga0068867_10000007820 254
240 3300005466 Ga0070685_10000010 Ga0070685_10000010131 254
241 3300005468 Ga0070707_100727732 Ga0070707_1007277321 254
242 3300005535 Ga0070684_100013485 Ga0070684_1000134859 254
243 3300005539 Ga0068853_100107665 Ga0068853_1001076652 254
244 3300005545 Ga0070695_100119455 Ga0070695_1001194551 254
245 3300005547 Ga0070693_100000422 Ga0070693_1000004223 254
246 3300005548 Ga0070665_100000022 Ga0070665_10000002230 254
247 3300005549 Ga0070704_100028971 Ga0070704_1000289712 254
248 3300005564 Ga0070664_100134665 Ga0070664_1001346653 254
249 3300005614 Ga0068856_100445386 Ga0068856_1004453862 254
250 3300005616 Ga0068852_100229317 Ga0068852_1002293172 254
251 3300005618 Ga0068864_100000090 Ga0068864_10000009098 254
252 3300005718 Ga0068866_10000005 Ga0068866_1000000515 254
253 3300005841 Ga0068863_100000261 Ga0068863_10000026131 254
254 3300005842 Ga0068858_100001140 Ga0068858_1000011402 254
255 3300005843 Ga0068860_100015536 Ga0068860_1000155364 254
256 3300005937 Ga0081455_10128327 Ga0081455_101283272 254
257 3300005985 Ga0081539_10000776 Ga0081539_100007766 254
258 3300005985 Ga0081539_10027966 Ga0081539_100279664 254
259 3300006038 Ga0075365_10002854 Ga0075365_100028544 254
260 3300006163 Ga0070715_10000008 Ga0070715_1000000858 254
261 3300006844 Ga0075428_100121117 Ga0075428_1001211172 254
262 3300006846 Ga0075430_100006738 Ga0075430_1000067386 254
263 3300006852 Ga0075433_10000592 Ga0075433_100005928 254
264 3300009098 Ga0105245_10000040 Ga0105245_1000004023 254
265 3300009098 Ga0105245_10000857 Ga0105245_100008579 254
266 3300009147 Ga0114129_10003100 Ga0114129_100031007 254
267 3300009176 Ga0105242_10000063 Ga0105242_1000006332 254
268 3300009176 Ga0105242_10000378 Ga0105242_1000037835 254
269 3300009176 Ga0105242_10240810 Ga0105242_102408102 254
270 3300009176 Ga0105242_10330425 Ga0105242_103304252 254
271 3300009551 Ga0105238_10000033 Ga0105238_10000033142 254
272 3300009553 Ga0105249_10000218 Ga0105249_1000021853 254
273 3300009553 Ga0105249_10133628 Ga0105249_101336282 254
274 3300013296 Ga0157374_10001797 Ga0157374_1000179710 254
275 3300013296 Ga0157374_10143838 Ga0157374_101438382 254
276 3300013297 Ga0157378_10138077 Ga0157378_101380772 254
277 3300013308 Ga0157375_10003564 Ga0157375_100035646 254
278 3300014326 Ga0157380_10001943 Ga0157380_1000194310 254
279 3300014969 Ga0157376_10068628 Ga0157376_100686284 254
280 3300017792 Ga0163161_10000064 Ga0163161_10000064101 254
281 3300017792 Ga0163161_10083512 Ga0163161_100835122 254
282 3300017792 Ga0163161_10186545 Ga0163161_101865452 254
283 3300025899 Ga0207642_10000005 Ga0207642_10000005219 254
284 3300025900 Ga0207710_10000384 Ga0207710_100003843 254
285 3300025905 Ga0207685_10000012 Ga0207685_1000001258 254
286 3300025912 Ga0207707_10009995 Ga0207707_100099954 254
287 3300025916 Ga0207663_10130957 Ga0207663_101309572 254
288 3300025917 Ga0207660_10070777 Ga0207660_100707772 254
289 3300025919 Ga0207657_10182334 Ga0207657_101823342 254
290 3300025920 Ga0207649_10000003 Ga0207649_100000039 254
291 3300025921 Ga0207652_10000232 Ga0207652_1000023224 254
292 3300025922 Ga0207646_10632870 Ga0207646_106328702 254
293 3300025924 Ga0207694_10000012 Ga0207694_10000012143 254
294 3300025926 Ga0207659_10000055 Ga0207659_1000005555 254
295 3300025927 Ga0207687_10000095 Ga0207687_1000009532 254
296 3300025927 Ga0207687_10000128 Ga0207687_1000012843 254
297 3300025928 Ga0207700_10000003 Ga0207700_10000003161 254
298 3300025929 Ga0207664_10038372 Ga0207664_100383722 254
299 3300025932 Ga0207690_10014985 Ga0207690_100149855 254
300 3300025932 Ga0207690_10207509 Ga0207690_102075092 254
301 3300025933 Ga0207706_10000003 Ga0207706_10000003227 254
302 3300025934 Ga0207686_10231454 Ga0207686_102314542 254
303 3300025937 Ga0207669_10000021 Ga0207669_100000218 254
304 3300025938 Ga0207704_10366863 Ga0207704_103668632 254
305 3300025944 Ga0207661_10005761 Ga0207661_100057613 254
306 3300025944 Ga0207661_10034490 Ga0207661_100344902 254
307 3300025945 Ga0207679_10109184 Ga0207679_101091842 254
308 3300025960 Ga0207651_10005482 Ga0207651_100054826 254
309 3300025961 Ga0207712_10000027 Ga0207712_10000027246 254
310 3300025986 Ga0207658_10054310 Ga0207658_100543103 254
311 3300026023 Ga0207677_10000304 Ga0207677_1000030428 254
312 3300026035 Ga0207703_10000020 Ga0207703_1000002084 254
313 3300026041 Ga0207639_10078164 Ga0207639_100781643 254
314 3300026075 Ga0207708_10084246 Ga0207708_100842463 254
315 3300026075 Ga0207708_10196192 Ga0207708_101961922 254
316 3300026088 Ga0207641_10000062 Ga0207641_10000062149 254
317 3300026089 Ga0207648_10000457 Ga0207648_1000045726 254
318 3300026095 Ga0207676_10000016 Ga0207676_10000016312 254
319 3300026118 Ga0207675_100099281 Ga0207675_1000992812 254
320 3300026118 Ga0207675_100419352 Ga0207675_1004193522 254
321 3300026142 Ga0207698_10207237 Ga0207698_102072372 254
322 3300028379 Ga0268266_10000029 Ga0268266_10000029419 254
323 3300028381 Ga0268264_10009671 Ga0268264_100096714 254
324 3300028556 Ga0265337_1000167 Ga0265337_100016723 254
325 3300028558 Ga0265326_10000452 Ga0265326_1000045222 254
326 3300028654 Ga0265322_10000005 Ga0265322_10000005145 254
327 3300028666 Ga0265336_10008363 Ga0265336_100083632 254
328 3300029957 Ga0265324_10000183 Ga0265324_1000018328 254
329 3300031239 Ga0265328_10000354 Ga0265328_1000035413 254
330 3300031240 Ga0265320_10000010 Ga0265320_10000010191 254
331 3300031242 Ga0265329_10012376 Ga0265329_100123762 254
332 3300031249 Ga0265339_10128840 Ga0265339_101288402 254
333 3300031250 Ga0265331_10000217 Ga0265331_1000021753 254
334 3300031251 Ga0265327_10000040 Ga0265327_10000040115 254
335 3300031344 Ga0265316_10042903 Ga0265316_100429033 254
336 3300031711 Ga0265314_10000578 Ga0265314_1000057837 254
337 3300035724 Ga0373933_0157019 Ga0373933_0157019_207_998 254
338 3300036401 Ga0373937_0036966 Ga0373937_0036966_1782_2573 254
339 3300037418 Ga0395900_0043777 Ga0395900_0043777_2183_2953 254
340 3300038443 Ga0395901_0068454 Ga0395901_0068454_2297_3067 254
341 3300041512 Ga0451853_0533972 Ga0451853_0533972_1046_1837 254
342 3300044694 Ga0466963_0000141 Ga0466963_0000141_2783_3574 254
343 3300044694 Ga0466963_0049417 Ga0466963_0049417_1718_2524 254
344 3300045836 Ga0466958_0031592 Ga0466958_0031592_256_1047 254
345 3300045976 Ga0466967_0000002 Ga0466967_0000002_14330_15121 254
346 3300045976 Ga0466967_0164715 Ga0466967_0164715_354_1151 254
347 3300046454 Ga0495592_0002645 Ga0495592_0002645_6138_6929 254
348 3300046454 Ga0495592_0065671 Ga0495592_0065671_656_1447 254
349 3300046454 Ga0495592_0259418 Ga0495592_0259418_284_1075 254
350 3300046455 Ga0495603_0000102 Ga0495603_0000102_37971_38762 254
351 3300046455 Ga0495603_0004342 Ga0495603_0004342_2957_3748 254
352 3300046459 Ga0495629_0102099 Ga0495629_0102099_951_1742 254
353 3300046459 Ga0495629_0126403 Ga0495629_0126403_648_1436 254
354 3300046461 Ga0495641_0000004 Ga0495641_0000004_93698_94489 254
355 3300046463 Ga0495653_0081411 Ga0495653_0081411_808_1599 254
356 3300046473 Ga0495582_0000003 Ga0495582_0000003_13551_14342 254
357 3300046475 Ga0495639_0003050 Ga0495639_0003050_1494_2285 254
358 3300046476 Ga0495662_0000069 Ga0495662_0000069_20993_21784 254
359 3300046476 Ga0495662_0005283 Ga0495662_0005283_1282_2097 254
360 3300046511 Ga0495608_0000754 Ga0495608_0000754_7800_8591 254
361 3300046511 Ga0495608_0082516 Ga0495608_0082516_565_1356 254
362 3300046514 Ga0495618_0000004 Ga0495618_0000004_240403_241194 254
363 3300046515 Ga0495620_0000041 Ga0495620_0000041_27558_28349 254
364 3300046516 Ga0495628_0027139 Ga0495628_0027139_3306_4097 254
365 3300046516 Ga0495628_0034467 Ga0495628_0034467_55_846 254
366 3300046516 Ga0495628_0192837 Ga0495628_0192837_32_823 254
367 3300046517 Ga0495630_0000026 Ga0495630_0000026_108982_109773 254
368 3300046517 Ga0495630_0020128 Ga0495630_0020128_2020_2811 254
369 3300046522 Ga0495643_0115442 Ga0495643_0115442_490_1281 254
370 3300046523 Ga0495644_0001151 Ga0495644_0001151_4333_5124 254
371 3300046533 Ga0495640_0015640 Ga0495640_0015640_3975_4766 254
372 3300046535 Ga0495586_0000588 Ga0495586_0000588_4321_5112 254
373 3300046537 Ga0495598_0103678 Ga0495598_0103678_108_899 254
374 3300046543 Ga0495645_0107165 Ga0495645_0107165_1176_1967 254
375 3300046558 Ga0495633_0057302 Ga0495633_0057302_926_1717 254
376 3300046559 Ga0495667_0000038 Ga0495667_0000038_28379_29170 254
377 3300046616 Ga0495668_0052075 Ga0495668_0052075_510_1301 254
378 3300046642 Ga0495634_0002310 Ga0495634_0002310_11864_12652 254
379 3300046663 Ga0495635_0000005 Ga0495635_0000005_10161_10952 254
380 3300046663 Ga0495635_0161858 Ga0495635_0161858_517_1308 254
381 3300046675 Ga0495657_0036524 Ga0495657_0036524_961_1752 254
382 3300046678 Ga0495599_0006190 Ga0495599_0006190_3896_4687 254
383 3300046681 Ga0495647_0000005 Ga0495647_0000005_78984_79775 254
384 3300046681 Ga0495647_0005013 Ga0495647_0005013_1450_2241 254
385 3300046683 Ga0495658_0000001 Ga0495658_0000001_158069_158860 254
386 3300046683 Ga0495658_0101271 Ga0495658_0101271_195_986 254
387 3300046684 Ga0495669_0000609 Ga0495669_0000609_7862_8653 254
388 3300046689 Ga0495613_0000233 Ga0495613_0000233_47766_48581 254
389 3300046689 Ga0495613_0001632 Ga0495613_0001632_1491_2282 254
390 3300046690 Ga0495624_0000347 Ga0495624_0000347_31535_32326 254
391 3300046690 Ga0495624_0018953 Ga0495624_0018953_35_826 254
392 3300046691 Ga0495670_0004497 Ga0495670_0004497_2822_3613 254
393 3300046694 Ga0495649_0007318 Ga0495649_0007318_1930_2721 254
394 3300046809 Ga0495600_0005828 Ga0495600_0005828_4504_5295 254
395 3300046809 Ga0495600_0053795 Ga0495600_0053795_1481_2296 254
396 3300047317 Ga0495604_0011043 Ga0495604_0011043_1353_2168 254
397 3300047317 Ga0495604_0048820 Ga0495604_0048820_1028_1843 254
398 3300047319 Ga0495674_0000039 Ga0495674_0000039_70732_71544 254
399 3300047321 Ga0495676_0000499 Ga0495676_0000499_4302_5093 254
400 3300047322 Ga0495680_0000007 Ga0495680_0000007_146604_147395 254
401 3300047322 Ga0495680_0001001 Ga0495680_0001001_2952_3743 254
402 3300047322 Ga0495680_0007824 Ga0495680_0007824_5560_6351 254
403 3300047322 Ga0495680_0014672 Ga0495680_0014672_3301_4092 254
404 3300047471 Ga0495684_0107545 Ga0495684_0107545_763_1554 254
405 3300047471 Ga0495684_0174745 Ga0495684_0174745_425_1216 254
406 3300047673 Ga0495593_0127009 Ga0495593_0127009_258_1049 254
407 3300048088 Ga0495602_0000034 Ga0495602_0000034_64999_65814 254
408 3300048903 Ga0496100_0000024 Ga0496100_0000024_92816_93607 254
409 3300048904 Ga0496101_0000072 Ga0496101_0000072_22532_23323 254
410 3300048907 Ga0496104_0000008 Ga0496104_0000008_139188_139979 254
411 3300048907 Ga0496104_0000230 Ga0496104_0000230_27585_28376 254
412 3300048908 Ga0496105_0000003 Ga0496105_0000003_139188_139979 254
413 3300048908 Ga0496105_0000051 Ga0496105_0000051_47908_48699 254
414 3300048909 Ga0496106_0000040 Ga0496106_0000040_85432_86223 254
415 3300048909 Ga0496106_0000042 Ga0496106_0000042_70680_71474 254
416 3300048910 Ga0496107_0000025 Ga0496107_0000025_92816_93607 254
417 3300048910 Ga0496107_0266219 Ga0496107_0266219_464_1258 254
418 3300048911 Ga0496108_0000004 Ga0496108_0000004_455502_456293 254
419 3300048911 Ga0496108_0096646 Ga0496108_0096646_123_929 254
420 3300048912 Ga0496109_0000013 Ga0496109_0000013_137943_138734 254
421 3300048912 Ga0496109_0000221 Ga0496109_0000221_32497_33303 254
422 3300048912 Ga0496109_0131834 Ga0496109_0131834_1465_2256 254
423 3300048915 Ga0496112_0000026 Ga0496112_0000026_48291_49082 254
424 3300048917 Ga0496114_0000003 Ga0496114_0000003_476685_477476 254
425 3300048917 Ga0496114_0017455 Ga0496114_0017455_2284_3075 254
426 3300048917 Ga0496114_0196956 Ga0496114_0196956_494_1285 254
427 3300048918 Ga0496115_0000016 Ga0496115_0000016_20127_20918 254
428 3300048918 Ga0496115_0000827 Ga0496115_0000827_19094_19885 254
429 3300048918 Ga0496115_0004109 Ga0496115_0004109_1635_2426 254
430 3300048928 Ga0496125_0026591 Ga0496125_0026591_291_1082 254
431 3300049578 Ga0501042_0001883 Ga0501042_0001883_2672_3463 254
432 3300050492 nmdc:mga0yw44_22111_c1 nmdc:mga0yw44_22111_c1_1204_1983 254
433 3300050507 nmdc:mga05p37_19763_c1 nmdc:mga05p37_19763_c1_5674_6444 254
434 3300050512 nmdc:mga0n895_15741_c1 nmdc:mga0n895_15741_c1_3624_4394 254
435 3300050515 nmdc:mga0a205_4_c1 nmdc:mga0a205_4_c1_111291_112109 254
436 3300053077 Ga0495601_0000029 Ga0495601_0000029_105989_106804 254
437 3300053077 Ga0495601_0002066 Ga0495601_0002066_9645_10436 254
438 3300053077 Ga0495601_0407185 Ga0495601_0407185_48_851 254
439 3300053078 Ga0495612_0001047 Ga0495612_0001047_9893_10684 254
440 3300053084 Ga0495595_0000921 Ga0495595_0000921_6197_6988 254
441 3300053084 Ga0495595_0017979 Ga0495595_0017979_1154_1969 254
442 3300053084 Ga0495595_0093706 Ga0495595_0093706_372_1163 254
443 3300053085 Ga0495619_0002596 Ga0495619_0002596_10779_11570 254
444 3300053123 Ga0500614_000156 Ga0500614_000156_2735_3526 254
445 3300001977 JGI24746J21847_1001259 JGI24746J21847_10012593 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

24

237

0.86

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

47

265

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p05-assembly1.cif.gz_A cryo-em structure of pdr5 from saccharomyces cerevisiae in inward-facing conformation with adp/atp and rhodamine 6g 0.6966 9 250
7jr7-assembly1.cif.gz_A cryo-em structure of abcg5/g8 in complex with fab 2e10 and 11f4 0.6738 5 251
6jbh-assembly1.cif.gz_D cryo-em structure and transport mechanism of a wall teichoic acid abc transporter 0.6695 4 248
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.6693 6 249
8ce1-assembly1.cif.gz_B cytochrome c maturation complex ccmabcd 0.669 9 255
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8443 58 249 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7939 37 246 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7842 50 247 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6626 37 246 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6514 58 249 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A7V9PNA8-F1-model_v4 ABC transporter permease 0.9843 5 255 GO:0043190
GO:0140359
AF-A0A2E4MTG2-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9734 9 255 GO:0043190
GO:0140359
AF-A0A6I2YCN7-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9732 5 252 GO:0043190
GO:0140359
AF-A0A7V9PNA8-F1-model_v4 ABC transporter permease 0.9691 5 255 GO:0043190
GO:0140359
AF-A0A7W0L2I0-F1-model_v4 Transport permease protein 0.969 5 249 GO:0043190
GO:0140359

Feature Viewer

pLDDT pTM Quality
91.78 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map