F445463

General Info

Members Datasets Scaffolds Average Seq Length
445 261 890 139

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10055607|Ga0081455_100556075
Length 149
Sequence MQWAALIAWIVTAAGGFVLLAIWLSRGGMRQASAAGSRIRPPLILTHFLLAAIGLVIWIIYVATDSDALAWVAFVLLAVVAVLGFTMFAIWFKRRQRGPVAATGVTGNPGSSETPPEQHFPVPIVGLHGLLAVTTVVLVFLTAVGVGES

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
186 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
190 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
191 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
192 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 1.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 5.84
Rhizosphere 93.26
Stem 0
Stem Tuber 0
Unclassified 8.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10055607 3300005937 Unclassified 3366
2 JGI24750J21931_1071581 3300002070 Bacteria 567
3 JGI24748J21848_1022459 3300002074 Bacteria 764
4 JGI24744J21845_10001080 3300002077 Bacteria 5278
5 JGI24742J22300_10014214 3300002244 Bacteria 1337
6 JGI25407J50210_10004534 3300003373 Bacteria 3379
7 JGI25407J50210_10015909 3300003373 Bacteria 1946
8 Ga0070658_10902802 3300005327 Bacteria 768
9 Ga0070676_10025893 3300005328 Bacteria 3319
10 Ga0070683_100019464 3300005329 Bacteria 6030
11 Ga0070683_100053144 3300005329 Bacteria 3754
12 Ga0070683_100126865 3300005329 Bacteria 2412
13 Ga0070683_100143570 3300005329 Bacteria 2262
14 Ga0070683_100733253 3300005329 Unclassified 947
15 Ga0070690_100059848 3300005330 Bacteria 2450
16 Ga0070670_101203760 3300005331 Unclassified 692
17 Ga0070677_10230563 3300005333 Bacteria 909
18 Ga0068869_100005658 3300005334 Bacteria 7878
19 Ga0070666_10071993 3300005335 Bacteria 2353
20 Ga0070680_100003059 3300005336 Bacteria 12409
21 Ga0070680_100067921 3300005336 Bacteria 2925
22 Ga0070680_100378089 3300005336 Bacteria 1206
23 Ga0070680_100867254 3300005336 Bacteria 778
24 Ga0070682_100011895 3300005337 Bacteria 4977
25 Ga0070682_100074808 3300005337 Bacteria 2176
26 Ga0070682_100206443 3300005337 Bacteria 1389
27 Ga0068868_100002895 3300005338 Bacteria 11909
28 Ga0068868_100062945 3300005338 Bacteria 2942
29 Ga0070660_100058857 3300005339 Bacteria 2979
30 Ga0070660_100288101 3300005339 Unclassified 1345
31 Ga0070691_10010173 3300005341 Bacteria 4288
32 Ga0070691_10041923 3300005341 Bacteria 2165
33 Ga0070687_100410173 3300005343 Bacteria 891
34 Ga0070661_100164923 3300005344 Bacteria 1679
35 Ga0070661_100771261 3300005344 Bacteria 787
36 Ga0070692_10005260 3300005345 Bacteria 5494
37 Ga0070692_10107423 3300005345 Bacteria 1539
38 Ga0070668_100054279 3300005347 Bacteria 3091
39 Ga0070668_100133666 3300005347 Bacteria 1993
40 Ga0070675_100001135 3300005354 Bacteria 19218
41 Ga0070671_100079027 3300005355 Bacteria 2749
42 Ga0070671_100377090 3300005355 Bacteria 1212
43 Ga0070674_100013708 3300005356 Bacteria 5017
44 Ga0070673_100052465 3300005364 Bacteria 3199
45 Ga0070688_100003462 3300005365 Bacteria 8125
46 Ga0070659_100015081 3300005366 Bacteria 5780
47 Ga0070659_100030323 3300005366 Bacteria 4185
48 Ga0070659_100145547 3300005366 Bacteria 1930
49 Ga0070667_100068747 3300005367 Bacteria 3014
50 Ga0070703_10005516 3300005406 Bacteria 3540
51 Ga0070709_10011789 3300005434 Bacteria 4881
52 Ga0070713_100038367 3300005436 Bacteria 3881
53 Ga0070710_10012298 3300005437 Bacteria 4246
54 Ga0070701_10000803 3300005438 Bacteria 11211
55 Ga0070711_100021760 3300005439 Bacteria 4149
56 Ga0070705_100009877 3300005440 Bacteria 4760
57 Ga0070705_101738057 3300005440 Unclassified 528
58 Ga0070700_100006875 3300005441 Bacteria 6107
59 Ga0070694_100015695 3300005444 Bacteria 4761
60 Ga0070663_100032446 3300005455 Bacteria 3600
61 Ga0070663_100189392 3300005455 Bacteria 1600
62 Ga0070663_100299892 3300005455 Bacteria 1286
63 Ga0070678_100000298 3300005456 Bacteria 23008
64 Ga0070662_100023915 3300005457 Bacteria 4203
65 Ga0070662_100344214 3300005457 Bacteria 1220
66 Ga0070681_10001806 3300005458 Bacteria 19256
67 Ga0070681_10131155 3300005458 Bacteria 2438
68 Ga0068867_100005763 3300005459 Bacteria 8787
69 Ga0070707_100390936 3300005468 Bacteria 1351
70 Ga0070679_100001483 3300005530 Bacteria 20820
71 Ga0070679_100064077 3300005530 Bacteria 3663
72 Ga0070679_100161171 3300005530 Bacteria 2217
73 Ga0070679_101499673 3300005530 Bacteria 621
74 Ga0070684_100246325 3300005535 Bacteria 1633
75 Ga0070684_100765132 3300005535 Unclassified 902
76 Ga0068853_100110021 3300005539 Bacteria 2447
77 Ga0070672_100030974 3300005543 Bacteria 4024
78 Ga0070686_100003608 3300005544 Bacteria 8490
79 Ga0070686_101409398 3300005544 Bacteria 585
80 Ga0070696_100003638 3300005546 Bacteria 10270
81 Ga0070693_100483476 3300005547 Bacteria 875
82 Ga0070665_100090600 3300005548 Bacteria 3064
83 Ga0070704_100622810 3300005549 Bacteria 950
84 Ga0070664_100000400 3300005564 Bacteria 32343
85 Ga0070664_100241135 3300005564 Bacteria 1623
86 Ga0068857_100002630 3300005577 Bacteria 14736
87 Ga0068857_100006782 3300005577 Bacteria 9855
88 Ga0068854_100425181 3300005578 Bacteria 1104
89 Ga0068854_100699463 3300005578 Bacteria 875
90 Ga0068856_100107808 3300005614 Bacteria 2781
91 Ga0068856_100111121 3300005614 Bacteria 2738
92 Ga0068856_102094434 3300005614 Bacteria 575
93 Ga0070702_100121862 3300005615 Bacteria 1634
94 Ga0068852_100024006 3300005616 Bacteria 4920
95 Ga0068852_100105362 3300005616 Bacteria 2555
96 Ga0068864_101582865 3300005618 Bacteria 659
97 Ga0068866_10001810 3300005718 Bacteria 8989
98 Ga0068866_10111626 3300005718 Bacteria 1526
99 Ga0068861_100018118 3300005719 Bacteria 5009
100 Ga0068858_100494127 3300005842 Bacteria 1182
101 Ga0068860_100189561 3300005843 Bacteria 1990
102 Ga0068862_100008428 3300005844 Bacteria 8528
103 Ga0081455_10020175 3300005937 Bacteria 6286
104 Ga0081455_10046730 3300005937 Bacteria 3753
105 Ga0081538_10001129 3300005981 Bacteria 28267
106 Ga0081538_10012516 3300005981 Bacteria 6798
107 Ga0081540_1013909 3300005983 Bacteria 5196
108 Ga0097621_100050282 3300006237 Bacteria 3389
109 Ga0068871_100043530 3300006358 Bacteria 3606
110 Ga0068871_101017052 3300006358 Bacteria 772
111 Ga0075428_100151791 3300006844 Bacteria 2517
112 Ga0075428_100275890 3300006844 Bacteria 1809
113 Ga0075428_101191317 3300006844 Bacteria 803
114 Ga0075430_100012099 3300006846 Bacteria 7347
115 Ga0075431_100062280 3300006847 Bacteria 3850
116 Ga0075431_100196064 3300006847 Bacteria 2068
117 Ga0075431_100768313 3300006847 Bacteria 938
118 Ga0075433_10004745 3300006852 Bacteria 10602
119 Ga0075433_11086491 3300006852 Bacteria 696
120 Ga0075434_100038448 3300006871 Bacteria 4739
121 Ga0075429_100132797 3300006880 Bacteria 2178
122 Ga0068865_100013845 3300006881 Bacteria 5113
123 Ga0068865_100202360 3300006881 Bacteria 1542
124 Ga0075436_100001277 3300006914 Bacteria 17097
125 Ga0075435_100004760 3300007076 Bacteria 9373
126 Ga0105240_10252718 3300009093 Bacteria 2038
127 Ga0111539_10002981 3300009094 Bacteria 22454
128 Ga0111539_10029430 3300009094 Bacteria 6689
129 Ga0111539_10210902 3300009094 Bacteria 2263
130 Ga0111539_10319060 3300009094 Bacteria 1808
131 Ga0111539_10592555 3300009094 Bacteria 1291
132 Ga0105245_10001349 3300009098 Bacteria 22261
133 Ga0105245_10002841 3300009098 Bacteria 15569
134 Ga0105247_10082771 3300009101 Bacteria 2026
135 Ga0114129_10140452 3300009147 Bacteria 3311
136 Ga0114129_10366381 3300009147 Bacteria 1906
137 Ga0105243_10303537 3300009148 Bacteria 1448
138 Ga0105241_10007253 3300009174 Bacteria 8160
139 Ga0105242_10040927 3300009176 Bacteria 3735
140 Ga0105248_10019172 3300009177 Bacteria 7568
141 Ga0105238_10191969 3300009551 Bacteria 2018
142 Ga0105249_10006881 3300009553 Bacteria 9914
143 Ga0105249_10147908 3300009553 Bacteria 2259
144 Ga0105239_10024778 3300010375 Bacteria 6609
145 Ga0105239_10281847 3300010375 Bacteria 1871
146 Ga0105246_10026974 3300011119 Bacteria 3759
147 Ga0105246_10253410 3300011119 Bacteria 1398
148 Ga0157316_1017464 3300012510 Bacteria 749
149 Ga0157371_10766500 3300013102 Bacteria 725
150 Ga0157370_10082486 3300013104 Bacteria 3024
151 Ga0157369_10134486 3300013105 Bacteria 2618
152 Ga0157374_10001529 3300013296 Bacteria 19473
153 Ga0157374_11530158 3300013296 Bacteria 691
154 Ga0157378_10009090 3300013297 Bacteria 8650
155 Ga0163162_10131287 3300013306 Bacteria 2614
156 Ga0157372_10071546 3300013307 Bacteria 3906
157 Ga0157372_11547889 3300013307 Unclassified 764
158 Ga0157375_10026838 3300013308 Bacteria 5375
159 Ga0157375_10360860 3300013308 Bacteria 1619
160 Ga0157377_10001729 3300014745 Bacteria 9527
161 Ga0157377_10112851 3300014745 Bacteria 1636
162 Ga0157376_10003374 3300014969 Bacteria 10996
163 Ga0163161_10075062 3300017792 Bacteria 2481
164 Ga0206356_10664330 3300020070 Bacteria 1302
165 Ga0206349_1947055 3300020075 Bacteria 1668
166 Ga0206353_10409082 3300020082 Bacteria 1691
167 Ga0207692_10058558 3300025898 Bacteria 1985
168 Ga0207642_10003337 3300025899 Bacteria 5053
169 Ga0207688_10066163 3300025901 Bacteria 2043
170 Ga0207680_10121813 3300025903 Bacteria 1707
171 Ga0207647_10010166 3300025904 Bacteria 6650
172 Ga0207699_10125099 3300025906 Bacteria 1668
173 Ga0207645_10020872 3300025907 Bacteria 4280
174 Ga0207705_11300284 3300025909 Bacteria 555
175 Ga0207654_10257456 3300025911 Bacteria 1172
176 Ga0207707_10003853 3300025912 Bacteria 13298
177 Ga0207707_10162399 3300025912 Unclassified 1953
178 Ga0207707_10322627 3300025912 Bacteria 1333
179 Ga0207695_10314458 3300025913 Bacteria 1456
180 Ga0207693_10000306 3300025915 Bacteria 45797
181 Ga0207663_10159275 3300025916 Bacteria 1591
182 Ga0207660_10007448 3300025917 Bacteria 7085
183 Ga0207660_10011378 3300025917 Bacteria 5788
184 Ga0207660_10743781 3300025917 Bacteria 800
185 Ga0207660_11181849 3300025917 Bacteria 623
186 Ga0207657_10008130 3300025919 Bacteria 10696
187 Ga0207657_10057141 3300025919 Bacteria 3364
188 Ga0207657_10467236 3300025919 Unclassified 990
189 Ga0207649_10032938 3300025920 Bacteria 3092
190 Ga0207649_10244727 3300025920 Bacteria 1289
191 Ga0207649_10641316 3300025920 Bacteria 820
192 Ga0207652_10001450 3300025921 Bacteria 20983
193 Ga0207652_10363242 3300025921 Bacteria 1307
194 Ga0207652_10544852 3300025921 Bacteria 1043
195 Ga0207646_11714731 3300025922 Unclassified 539
196 Ga0207694_10158307 3300025924 Bacteria 1828
197 Ga0207659_10006654 3300025926 Bacteria 7100
198 Ga0207687_10010887 3300025927 Bacteria 5942
199 Ga0207687_10016574 3300025927 Bacteria 4840
200 Ga0207700_10151014 3300025928 Bacteria 1919
201 Ga0207644_10861332 3300025931 Bacteria 759
202 Ga0207644_10974500 3300025931 Bacteria 711
203 Ga0207690_10034116 3300025932 Bacteria 3277
204 Ga0207690_10228134 3300025932 Bacteria 1428
205 Ga0207706_10027698 3300025933 Bacteria 5066
206 Ga0207706_10784068 3300025933 Bacteria 810
207 Ga0207686_10005717 3300025934 Bacteria 6668
208 Ga0207709_10004236 3300025935 Bacteria 8318
209 Ga0207670_10104431 3300025936 Bacteria 2029
210 Ga0207669_10007277 3300025937 Bacteria 5106
211 Ga0207704_10131060 3300025938 Bacteria 1736
212 Ga0207704_10169784 3300025938 Bacteria 1563
213 Ga0207665_10477567 3300025939 Bacteria 960
214 Ga0207691_10009554 3300025940 Bacteria 9307
215 Ga0207711_10025253 3300025941 Bacteria 4985
216 Ga0207689_10003886 3300025942 Bacteria 13615
217 Ga0207661_10012505 3300025944 Bacteria 6169
218 Ga0207661_10061786 3300025944 Bacteria 3028
219 Ga0207679_10003251 3300025945 Bacteria 10038
220 Ga0207679_10154968 3300025945 Bacteria 1869
221 Ga0207667_10328829 3300025949 Bacteria 1561
222 Ga0207712_10009257 3300025961 Bacteria 6233
223 Ga0207712_10112550 3300025961 Bacteria 2044
224 Ga0207668_10066828 3300025972 Bacteria 2550
225 Ga0207668_10252084 3300025972 Bacteria 1434
226 Ga0207640_10117662 3300025981 Bacteria 1897
227 Ga0207640_10161112 3300025981 Bacteria 1660
228 Ga0207658_10106111 3300025986 Bacteria 2211
229 Ga0207677_10023659 3300026023 Bacteria 3799
230 Ga0207677_10362437 3300026023 Bacteria 1218
231 Ga0207703_10447792 3300026035 Bacteria 1206
232 Ga0207703_11898625 3300026035 Bacteria 572
233 Ga0207639_10112880 3300026041 Bacteria 2218
234 Ga0207678_10008788 3300026067 Bacteria 8888
235 Ga0207678_10051074 3300026067 Bacteria 3570
236 Ga0207708_10001178 3300026075 Bacteria 19667
237 Ga0207708_10009145 3300026075 Bacteria 7332
238 Ga0207702_10125308 3300026078 Bacteria 2305
239 Ga0207702_10256265 3300026078 Bacteria 1645
240 Ga0207702_10842881 3300026078 Bacteria 907
241 Ga0207641_11300181 3300026088 Bacteria 728
242 Ga0207648_10000413 3300026089 Bacteria 47529
243 Ga0207676_11101674 3300026095 Bacteria 785
244 Ga0207674_10002109 3300026116 Bacteria 25169
245 Ga0207674_10005625 3300026116 Bacteria 14858
246 Ga0207674_10051305 3300026116 Bacteria 4210
247 Ga0207675_100022492 3300026118 Bacteria 5870
248 Ga0207683_10000598 3300026121 Bacteria 33267
249 Ga0207698_10020907 3300026142 Bacteria 4516
250 Ga0207428_10010358 3300027907 Bacteria 8333
251 Ga0268266_10230354 3300028379 Bacteria 1706
252 Ga0268265_10048131 3300028380 Bacteria 3199
253 Ga0268265_10084019 3300028380 Bacteria 2523
254 Ga0268264_10106006 3300028381 Bacteria 2453
255 Ga0307405_10496971 3300031731 Bacteria 977
256 Ga0307406_10190808 3300031901 Bacteria 1500
257 Ga0307407_10738712 3300031903 Bacteria 744
258 Ga0307409_100015022 3300031995 Bacteria 5064
259 Ga0307416_100076367 3300032002 Bacteria 2808
260 Ga0307416_100082630 3300032002 Bacteria 2722
261 Ga0307416_100648748 3300032002 Unclassified 1140
262 Ga0307415_100084050 3300032126 Bacteria 2283
263 Ga0373926_0212848 3300035083 Bacteria 745
264 Ga0373936_0120992 3300035113 Bacteria 1118
265 Ga0373945_0001806 3300035116 Bacteria 6608
266 Ga0373945_0003705 3300035116 Bacteria 4819
267 Ga0373945_0178001 3300035116 Bacteria 874
268 Ga0373943_0006617 3300035170 Bacteria 5196
269 Ga0373943_0033343 3300035170 Bacteria 2452
270 Ga0373943_0125693 3300035170 Bacteria 1367
271 Ga0373935_0236247 3300035692 Bacteria 1274
272 Ga0373947_0013047 3300035725 Bacteria 4764
273 Ga0373947_0015034 3300035725 Bacteria 4443
274 Ga0373947_0056280 3300035725 Bacteria 2377
275 Ga0373937_0306283 3300036401 Bacteria 1502
276 Ga0373925_0006938 3300037068 Bacteria 8287
277 Ga0373925_0106026 3300037068 Bacteria 2166
278 Ga0373925_0708153 3300037068 Unclassified 830
279 Ga0395899_0000775 3300037312 Bacteria 31562
280 Ga0395899_0002400 3300037312 Bacteria 15216
281 Ga0395899_0095227 3300037312 Bacteria 2154
282 Ga0395899_0329963 3300037312 Unclassified 1025
283 Ga0395899_0372186 3300037312 Unclassified 951
284 Ga0395899_0423013 3300037312 Unclassified 877
285 Ga0395899_0445277 3300037312 Unclassified 849
286 Ga0395900_0004308 3300037418 Bacteria 15090
287 Ga0395900_0006507 3300037418 Bacteria 12170
288 Ga0395900_0023193 3300037418 Bacteria 6352
289 Ga0395900_0026771 3300037418 Bacteria 5902
290 Ga0395900_0052637 3300037418 Bacteria 4191
291 Ga0395900_0116241 3300037418 Bacteria 2745
292 Ga0395900_0173009 3300037418 Bacteria 2197
293 Ga0395900_0218057 3300037418 Bacteria 1924
294 Ga0395900_0353738 3300037418 Bacteria 1442
295 Ga0395900_0433751 3300037418 Unclassified 1273
296 Ga0395900_0500684 3300037418 Unclassified 1165
297 Ga0395898_0002328 3300037466 Bacteria 22664
298 Ga0395898_0010278 3300037466 Bacteria 9794
299 Ga0395898_0025905 3300037466 Bacteria 5905
300 Ga0395898_0047018 3300037466 Bacteria 4237
301 Ga0395898_0063673 3300037466 Bacteria 3578
302 Ga0395898_0161418 3300037466 Bacteria 2144
303 Ga0395898_0303308 3300037466 Unclassified 1523
304 Ga0395898_0446341 3300037466 Bacteria 1232
305 Ga0395898_0624995 3300037466 Bacteria 1020
306 Ga0395898_0816594 3300037466 Bacteria 872
307 Ga0395898_1302873 3300037466 Unclassified 656
308 Ga0395905_0004036 3300037471 Bacteria 15409
309 Ga0395905_0007567 3300037471 Bacteria 10792
310 Ga0395905_0212306 3300037471 Bacteria 1813
311 Ga0395905_0261421 3300037471 Bacteria 1616
312 Ga0395905_0364239 3300037471 Bacteria 1338
313 Ga0395905_0438508 3300037471 Bacteria 1203
314 Ga0395905_0932357 3300037471 Bacteria 771
315 Ga0395905_1068637 3300037471 Unclassified 710
316 Ga0395905_1317331 3300037471 Unclassified 626
317 Ga0395901_0005281 3300038443 Bacteria 13048
318 Ga0395901_0023993 3300038443 Bacteria 6257
319 Ga0395901_0031712 3300038443 Bacteria 5448
320 Ga0395901_0038841 3300038443 Bacteria 4923
321 Ga0395901_0109315 3300038443 Bacteria 2903
322 Ga0395901_0130490 3300038443 Bacteria 2641
323 Ga0395901_0135207 3300038443 Bacteria 2591
324 Ga0395901_0526704 3300038443 Bacteria 1200
325 Ga0395901_0835052 3300038443 Bacteria 908
326 Ga0395901_0932217 3300038443 Unclassified 848
327 Ga0395901_0961788 3300038443 Bacteria 832
328 Ga0395901_1411163 3300038443 Unclassified 654
329 Ga0242420_102931 3300038996 Bacteria 609
330 Ga0451845_0320849 3300041501 Bacteria 1099
331 Ga0451853_0486903 3300041512 Unclassified 631
332 Ga0451853_3356639 3300041512 Bacteria 1935
333 Ga0439448_0027296 3300042005 Bacteria 1798
334 Ga0439448_0299516 3300042005 Unclassified 571
335 Ga0439455_0033945 3300042012 Bacteria 1282
336 Ga0439463_138980 3300042016 Bacteria 629
337 Ga0439458_0005488 3300042157 Bacteria 2851
338 Ga0439460_0355046 3300042461 Unclassified 517
339 Ga0466963_0204035 3300044694 Bacteria 1383
340 Ga0466964_0001629 3300044706 Bacteria 7747
341 Ga0466964_0003459 3300044706 Bacteria 5763
342 Ga0466959_0402651 3300045049 Bacteria 930
343 Ga0451576_0006071 3300045051 Bacteria 14903
344 Ga0451576_1958970 3300045051 Bacteria 604
345 Ga0466967_0010359 3300045976 Bacteria 6988
346 Ga0466967_0029845 3300045976 Bacteria 4569
347 Ga0466967_0085919 3300045976 Bacteria 2849
348 Ga0466967_0119945 3300045976 Bacteria 2428
349 Ga0466967_0150822 3300045976 Bacteria 2172
350 Ga0466967_0176629 3300045976 Bacteria 2012
351 Ga0466967_0338774 3300045976 Bacteria 1454
352 Ga0495592_0195267 3300046454 Bacteria 1369
353 Ga0495603_0000062 3300046455 Bacteria 46880
354 Ga0495603_0177288 3300046455 Unclassified 1234
355 Ga0495629_0266374 3300046459 Bacteria 1177
356 Ga0495641_0001703 3300046461 Bacteria 18371
357 Ga0495653_0272225 3300046463 Bacteria 1115
358 Ga0495580_0459954 3300046472 Bacteria 853
359 Ga0495582_0040605 3300046473 Bacteria 2563
360 Ga0495582_0065172 3300046473 Bacteria 2013
361 Ga0495664_0056062 3300046477 Bacteria 2344
362 Ga0495584_0156782 3300046491 Bacteria 1157
363 Ga0495618_0140991 3300046514 Bacteria 1542
364 Ga0495628_0312325 3300046516 Bacteria 1161
365 Ga0495630_0076996 3300046517 Bacteria 2514
366 Ga0495644_0221589 3300046523 Unclassified 731
367 Ga0495666_0301818 3300046526 Unclassified 724
368 Ga0495640_0046969 3300046533 Bacteria 2989
369 Ga0495586_0478177 3300046535 Bacteria 718
370 Ga0495668_0353367 3300046616 Unclassified 807
371 Ga0495635_0042942 3300046663 Bacteria 3121
372 Ga0495659_0206081 3300046664 Bacteria 808
373 Ga0495588_0017942 3300046674 Bacteria 3445
374 Ga0495588_0073192 3300046674 Bacteria 1784
375 Ga0495658_0002343 3300046683 Bacteria 9569
376 Ga0495658_0012151 3300046683 Unclassified 4350
377 Ga0495658_0082314 3300046683 Bacteria 1891
378 Ga0495613_0238916 3300046689 Bacteria 1271
379 Ga0495613_0380228 3300046689 Bacteria 966
380 Ga0495624_0040287 3300046690 Bacteria 2992
381 Ga0495624_0440314 3300046690 Bacteria 781
382 Ga0495589_0454847 3300046794 Unclassified 586
383 Ga0495674_0013932 3300047319 Bacteria 7543
384 Ga0495676_0000253 3300047321 Bacteria 43107
385 Ga0495676_0048101 3300047321 Bacteria 3442
386 Ga0495676_0086536 3300047321 Bacteria 2358
387 Ga0495684_0059023 3300047471 Unclassified 2922
388 Ga0495593_0061107 3300047673 Bacteria 1971
389 Ga0496100_0211523 3300048903 Bacteria 1418
390 Ga0496100_1625135 3300048903 Bacteria 511
391 Ga0496101_0046567 3300048904 Bacteria 3110
392 Ga0496102_0025530 3300048905 Bacteria 5260
393 Ga0496102_1562320 3300048905 Bacteria 578
394 Ga0496103_0022324 3300048906 Bacteria 3810
395 Ga0496105_0271169 3300048908 Bacteria 1370
396 Ga0496106_0007531 3300048909 Bacteria 8052
397 Ga0496106_0090153 3300048909 Bacteria 2366
398 Ga0496107_0069326 3300048910 Bacteria 2559
399 Ga0496109_0008143 3300048912 Bacteria 8890
400 Ga0496109_0014065 3300048912 Bacteria 6958
401 Ga0496109_0095741 3300048912 Bacteria 2749
402 Ga0496110_0004716 3300048913 Bacteria 10608
403 Ga0496110_0113081 3300048913 Bacteria 2441
404 Ga0496110_0769470 3300048913 Bacteria 867
405 Ga0496110_1549374 3300048913 Bacteria 573
406 Ga0496111_0015545 3300048914 Bacteria 5227
407 Ga0496111_0070089 3300048914 Bacteria 2550
408 Ga0496111_0117945 3300048914 Bacteria 1959
409 Ga0496111_0339446 3300048914 Bacteria 1112
410 Ga0496112_0005979 3300048915 Bacteria 10617
411 Ga0496112_0612247 3300048915 Bacteria 1020
412 Ga0496114_0003556 3300048917 Bacteria 11965
413 Ga0496114_0856457 3300048917 Bacteria 789
414 Ga0496115_0070249 3300048918 Bacteria 2838
415 Ga0501038_0006617 3300049574 Bacteria 10718
416 Ga0501040_1081846 3300049576 Unclassified 582
417 Ga0501048_0753025 3300049582 Bacteria 700
418 Ga0501067_0064013 3300049583 Bacteria 2036
419 nmdc:mga0yw44_545494_c1 3300050492 Unclassified 787
420 nmdc:mga05p37_6638_c1 3300050507 Bacteria 13649
421 nmdc:mga05p37_94035_c1 3300050507 Bacteria 3693
422 nmdc:mga09592_327452_c1 3300050508 Bacteria 1327
423 nmdc:mga0qj67_114795_c1 3300050509 Bacteria 2175
424 nmdc:mga06r32_326072_c1 3300050510 Bacteria 1521
425 nmdc:mga06r32_329894_c1 3300050510 Bacteria 1511
426 nmdc:mga08y16_138391_c1 3300050511 Bacteria 2531
427 nmdc:mga08y16_17874_c1 3300050511 Bacteria 7469
428 nmdc:mga08y16_190793_c1 3300050511 Bacteria 2125
429 nmdc:mga08y16_234113_c1 3300050511 Bacteria 1899
430 nmdc:mga08y16_30314_c1 3300050511 Bacteria 5694
431 nmdc:mga0n895_5031_c1 3300050512 Bacteria 10971
432 nmdc:mga0rr50_2915_c1 3300050513 Bacteria 9765
433 nmdc:mga0rr50_979586_c1 3300050513 Unclassified 721
434 nmdc:mga08x19_6093_c1 3300050514 Bacteria 7128
435 nmdc:mga0a205_147421_c1 3300050515 Bacteria 2253
436 nmdc:mga0a205_7751_c1 3300050515 Bacteria 9747
437 Ga0495601_0001860 3300053077 Bacteria 11755
438 Ga0495612_0004386 3300053078 Bacteria 5854
439 Ga0495595_0084551 3300053084 Bacteria 1516
440 Ga0495619_0102084 3300053085 Bacteria 1953
441 Ga0501084_1678607 3300054114 Unclassified 531
442 Ga0587066_213865 3300059490 Bacteria 513
443 Ga0587073_0154870 3300059492 Unclassified 651
444 Ga0587128_163385 3300059630 Bacteria 515
445 Ga0530510_0209785 3300061734 Bacteria 1447
446 Ga0081455_10055607
447 JGI24750J21931_1071581
448 JGI24748J21848_1022459
449 JGI24744J21845_10001080
450 JGI24742J22300_10014214
451 JGI25407J50210_10004534
452 JGI25407J50210_10015909
453 Ga0070658_10902802
454 Ga0070676_10025893
455 Ga0070683_100019464
456 Ga0070683_100053144
457 Ga0070683_100126865
458 Ga0070683_100143570
459 Ga0070683_100733253
460 Ga0070690_100059848
461 Ga0070670_101203760
462 Ga0070677_10230563
463 Ga0068869_100005658
464 Ga0070666_10071993
465 Ga0070680_100003059
466 Ga0070680_100067921
467 Ga0070680_100378089
468 Ga0070680_100867254
469 Ga0070682_100011895
470 Ga0070682_100074808
471 Ga0070682_100206443
472 Ga0068868_100002895
473 Ga0068868_100062945
474 Ga0070660_100058857
475 Ga0070660_100288101
476 Ga0070691_10010173
477 Ga0070691_10041923
478 Ga0070687_100410173
479 Ga0070661_100164923
480 Ga0070661_100771261
481 Ga0070692_10005260
482 Ga0070692_10107423
483 Ga0070668_100054279
484 Ga0070668_100133666
485 Ga0070675_100001135
486 Ga0070671_100079027
487 Ga0070671_100377090
488 Ga0070674_100013708
489 Ga0070673_100052465
490 Ga0070688_100003462
491 Ga0070659_100015081
492 Ga0070659_100030323
493 Ga0070659_100145547
494 Ga0070667_100068747
495 Ga0070703_10005516
496 Ga0070709_10011789
497 Ga0070713_100038367
498 Ga0070710_10012298
499 Ga0070701_10000803
500 Ga0070711_100021760
501 Ga0070705_100009877
502 Ga0070705_101738057
503 Ga0070700_100006875
504 Ga0070694_100015695
505 Ga0070663_100032446
506 Ga0070663_100189392
507 Ga0070663_100299892
508 Ga0070678_100000298
509 Ga0070662_100023915
510 Ga0070662_100344214
511 Ga0070681_10001806
512 Ga0070681_10131155
513 Ga0068867_100005763
514 Ga0070707_100390936
515 Ga0070679_100001483
516 Ga0070679_100064077
517 Ga0070679_100161171
518 Ga0070679_101499673
519 Ga0070684_100246325
520 Ga0070684_100765132
521 Ga0068853_100110021
522 Ga0070672_100030974
523 Ga0070686_100003608
524 Ga0070686_101409398
525 Ga0070696_100003638
526 Ga0070693_100483476
527 Ga0070665_100090600
528 Ga0070704_100622810
529 Ga0070664_100000400
530 Ga0070664_100241135
531 Ga0068857_100002630
532 Ga0068857_100006782
533 Ga0068854_100425181
534 Ga0068854_100699463
535 Ga0068856_100107808
536 Ga0068856_100111121
537 Ga0068856_102094434
538 Ga0070702_100121862
539 Ga0068852_100024006
540 Ga0068852_100105362
541 Ga0068864_101582865
542 Ga0068866_10001810
543 Ga0068866_10111626
544 Ga0068861_100018118
545 Ga0068858_100494127
546 Ga0068860_100189561
547 Ga0068862_100008428
548 Ga0081455_10020175
549 Ga0081455_10046730
550 Ga0081538_10001129
551 Ga0081538_10012516
552 Ga0081540_1013909
553 Ga0097621_100050282
554 Ga0068871_100043530
555 Ga0068871_101017052
556 Ga0075428_100151791
557 Ga0075428_100275890
558 Ga0075428_101191317
559 Ga0075430_100012099
560 Ga0075431_100062280
561 Ga0075431_100196064
562 Ga0075431_100768313
563 Ga0075433_10004745
564 Ga0075433_11086491
565 Ga0075434_100038448
566 Ga0075429_100132797
567 Ga0068865_100013845
568 Ga0068865_100202360
569 Ga0075436_100001277
570 Ga0075435_100004760
571 Ga0105240_10252718
572 Ga0111539_10002981
573 Ga0111539_10029430
574 Ga0111539_10210902
575 Ga0111539_10319060
576 Ga0111539_10592555
577 Ga0105245_10001349
578 Ga0105245_10002841
579 Ga0105247_10082771
580 Ga0114129_10140452
581 Ga0114129_10366381
582 Ga0105243_10303537
583 Ga0105241_10007253
584 Ga0105242_10040927
585 Ga0105248_10019172
586 Ga0105238_10191969
587 Ga0105249_10006881
588 Ga0105249_10147908
589 Ga0105239_10024778
590 Ga0105239_10281847
591 Ga0105246_10026974
592 Ga0105246_10253410
593 Ga0157316_1017464
594 Ga0157371_10766500
595 Ga0157370_10082486
596 Ga0157369_10134486
597 Ga0157374_10001529
598 Ga0157374_11530158
599 Ga0157378_10009090
600 Ga0163162_10131287
601 Ga0157372_10071546
602 Ga0157372_11547889
603 Ga0157375_10026838
604 Ga0157375_10360860
605 Ga0157377_10001729
606 Ga0157377_10112851
607 Ga0157376_10003374
608 Ga0163161_10075062
609 Ga0206356_10664330
610 Ga0206349_1947055
611 Ga0206353_10409082
612 Ga0207692_10058558
613 Ga0207642_10003337
614 Ga0207688_10066163
615 Ga0207680_10121813
616 Ga0207647_10010166
617 Ga0207699_10125099
618 Ga0207645_10020872
619 Ga0207705_11300284
620 Ga0207654_10257456
621 Ga0207707_10003853
622 Ga0207707_10162399
623 Ga0207707_10322627
624 Ga0207695_10314458
625 Ga0207693_10000306
626 Ga0207663_10159275
627 Ga0207660_10007448
628 Ga0207660_10011378
629 Ga0207660_10743781
630 Ga0207660_11181849
631 Ga0207657_10008130
632 Ga0207657_10057141
633 Ga0207657_10467236
634 Ga0207649_10032938
635 Ga0207649_10244727
636 Ga0207649_10641316
637 Ga0207652_10001450
638 Ga0207652_10363242
639 Ga0207652_10544852
640 Ga0207646_11714731
641 Ga0207694_10158307
642 Ga0207659_10006654
643 Ga0207687_10010887
644 Ga0207687_10016574
645 Ga0207700_10151014
646 Ga0207644_10861332
647 Ga0207644_10974500
648 Ga0207690_10034116
649 Ga0207690_10228134
650 Ga0207706_10027698
651 Ga0207706_10784068
652 Ga0207686_10005717
653 Ga0207709_10004236
654 Ga0207670_10104431
655 Ga0207669_10007277
656 Ga0207704_10131060
657 Ga0207704_10169784
658 Ga0207665_10477567
659 Ga0207691_10009554
660 Ga0207711_10025253
661 Ga0207689_10003886
662 Ga0207661_10012505
663 Ga0207661_10061786
664 Ga0207679_10003251
665 Ga0207679_10154968
666 Ga0207667_10328829
667 Ga0207712_10009257
668 Ga0207712_10112550
669 Ga0207668_10066828
670 Ga0207668_10252084
671 Ga0207640_10117662
672 Ga0207640_10161112
673 Ga0207658_10106111
674 Ga0207677_10023659
675 Ga0207677_10362437
676 Ga0207703_10447792
677 Ga0207703_11898625
678 Ga0207639_10112880
679 Ga0207678_10008788
680 Ga0207678_10051074
681 Ga0207708_10001178
682 Ga0207708_10009145
683 Ga0207702_10125308
684 Ga0207702_10256265
685 Ga0207702_10842881
686 Ga0207641_11300181
687 Ga0207648_10000413
688 Ga0207676_11101674
689 Ga0207674_10002109
690 Ga0207674_10005625
691 Ga0207674_10051305
692 Ga0207675_100022492
693 Ga0207683_10000598
694 Ga0207698_10020907
695 Ga0207428_10010358
696 Ga0268266_10230354
697 Ga0268265_10048131
698 Ga0268265_10084019
699 Ga0268264_10106006
700 Ga0307405_10496971
701 Ga0307406_10190808
702 Ga0307407_10738712
703 Ga0307409_100015022
704 Ga0307416_100076367
705 Ga0307416_100082630
706 Ga0307416_100648748
707 Ga0307415_100084050
708 Ga0373926_0212848
709 Ga0373936_0120992
710 Ga0373945_0001806
711 Ga0373945_0003705
712 Ga0373945_0178001
713 Ga0373943_0006617
714 Ga0373943_0033343
715 Ga0373943_0125693
716 Ga0373935_0236247
717 Ga0373947_0013047
718 Ga0373947_0015034
719 Ga0373947_0056280
720 Ga0373937_0306283
721 Ga0373925_0006938
722 Ga0373925_0106026
723 Ga0373925_0708153
724 Ga0395899_0000775
725 Ga0395899_0002400
726 Ga0395899_0095227
727 Ga0395899_0329963
728 Ga0395899_0372186
729 Ga0395899_0423013
730 Ga0395899_0445277
731 Ga0395900_0004308
732 Ga0395900_0006507
733 Ga0395900_0023193
734 Ga0395900_0026771
735 Ga0395900_0052637
736 Ga0395900_0116241
737 Ga0395900_0173009
738 Ga0395900_0218057
739 Ga0395900_0353738
740 Ga0395900_0433751
741 Ga0395900_0500684
742 Ga0395898_0002328
743 Ga0395898_0010278
744 Ga0395898_0025905
745 Ga0395898_0047018
746 Ga0395898_0063673
747 Ga0395898_0161418
748 Ga0395898_0303308
749 Ga0395898_0446341
750 Ga0395898_0624995
751 Ga0395898_0816594
752 Ga0395898_1302873
753 Ga0395905_0004036
754 Ga0395905_0007567
755 Ga0395905_0212306
756 Ga0395905_0261421
757 Ga0395905_0364239
758 Ga0395905_0438508
759 Ga0395905_0932357
760 Ga0395905_1068637
761 Ga0395905_1317331
762 Ga0395901_0005281
763 Ga0395901_0023993
764 Ga0395901_0031712
765 Ga0395901_0038841
766 Ga0395901_0109315
767 Ga0395901_0130490
768 Ga0395901_0135207
769 Ga0395901_0526704
770 Ga0395901_0835052
771 Ga0395901_0932217
772 Ga0395901_0961788
773 Ga0395901_1411163
774 Ga0242420_102931
775 Ga0451845_0320849
776 Ga0451853_0486903
777 Ga0451853_3356639
778 Ga0439448_0027296
779 Ga0439448_0299516
780 Ga0439455_0033945
781 Ga0439463_138980
782 Ga0439458_0005488
783 Ga0439460_0355046
784 Ga0466963_0204035
785 Ga0466964_0001629
786 Ga0466964_0003459
787 Ga0466959_0402651
788 Ga0451576_0006071
789 Ga0451576_1958970
790 Ga0466967_0010359
791 Ga0466967_0029845
792 Ga0466967_0085919
793 Ga0466967_0119945
794 Ga0466967_0150822
795 Ga0466967_0176629
796 Ga0466967_0338774
797 Ga0495592_0195267
798 Ga0495603_0000062
799 Ga0495603_0177288
800 Ga0495629_0266374
801 Ga0495641_0001703
802 Ga0495653_0272225
803 Ga0495580_0459954
804 Ga0495582_0040605
805 Ga0495582_0065172
806 Ga0495664_0056062
807 Ga0495584_0156782
808 Ga0495618_0140991
809 Ga0495628_0312325
810 Ga0495630_0076996
811 Ga0495644_0221589
812 Ga0495666_0301818
813 Ga0495640_0046969
814 Ga0495586_0478177
815 Ga0495668_0353367
816 Ga0495635_0042942
817 Ga0495659_0206081
818 Ga0495588_0017942
819 Ga0495588_0073192
820 Ga0495658_0002343
821 Ga0495658_0012151
822 Ga0495658_0082314
823 Ga0495613_0238916
824 Ga0495613_0380228
825 Ga0495624_0040287
826 Ga0495624_0440314
827 Ga0495589_0454847
828 Ga0495674_0013932
829 Ga0495676_0000253
830 Ga0495676_0048101
831 Ga0495676_0086536
832 Ga0495684_0059023
833 Ga0495593_0061107
834 Ga0496100_0211523
835 Ga0496100_1625135
836 Ga0496101_0046567
837 Ga0496102_0025530
838 Ga0496102_1562320
839 Ga0496103_0022324
840 Ga0496105_0271169
841 Ga0496106_0007531
842 Ga0496106_0090153
843 Ga0496107_0069326
844 Ga0496109_0008143
845 Ga0496109_0014065
846 Ga0496109_0095741
847 Ga0496110_0004716
848 Ga0496110_0113081
849 Ga0496110_0769470
850 Ga0496110_1549374
851 Ga0496111_0015545
852 Ga0496111_0070089
853 Ga0496111_0117945
854 Ga0496111_0339446
855 Ga0496112_0005979
856 Ga0496112_0612247
857 Ga0496114_0003556
858 Ga0496114_0856457
859 Ga0496115_0070249
860 Ga0501038_0006617
861 Ga0501040_1081846
862 Ga0501048_0753025
863 Ga0501067_0064013
864 nmdc:mga0yw44_545494_c1
865 nmdc:mga05p37_6638_c1
866 nmdc:mga05p37_94035_c1
867 nmdc:mga09592_327452_c1
868 nmdc:mga0qj67_114795_c1
869 nmdc:mga06r32_326072_c1
870 nmdc:mga06r32_329894_c1
871 nmdc:mga08y16_138391_c1
872 nmdc:mga08y16_17874_c1
873 nmdc:mga08y16_190793_c1
874 nmdc:mga08y16_234113_c1
875 nmdc:mga08y16_30314_c1
876 nmdc:mga0n895_5031_c1
877 nmdc:mga0rr50_2915_c1
878 nmdc:mga0rr50_979586_c1
879 nmdc:mga08x19_6093_c1
880 nmdc:mga0a205_147421_c1
881 nmdc:mga0a205_7751_c1
882 Ga0495601_0001860
883 Ga0495612_0004386
884 Ga0495595_0084551
885 Ga0495619_0102084
886 Ga0501084_1678607
887 Ga0587066_213865
888 Ga0587073_0154870
889 Ga0587128_163385
890 Ga0530510_0209785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vju-assembly1.cif.gz_A de novo photosynthetic reaction center protein variant equipped with his-tyr h-bond, heme b, and cd(ii) ions 0.6744 2 130
7rro-assembly1.cif.gz_A0 structure of the 48-nm repeat doublet microtubule from bovine tracheal cilia 0.6729 2 96
8d9p-assembly1.cif.gz_A de novo photosynthetic reaction center protein equipped with heme b and mn(ii) cations 0.6598 2 130
6jpa-assembly1.cif.gz_E rabbit cav1.1-verapamil complex 0.6462 41 133
5vju-assembly1.cif.gz_A de novo photosynthetic reaction center protein variant equipped with his-tyr h-bond, heme b, and cd(ii) ions 0.6276 2 130
ID Description Score Start End Superfamily
af_Q4DAD0_1_175_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7419 2 135 1.20.140.150
af_Q4DAD0_1_175_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7074 2 135 1.20.140.150
af_Q10268_5_188_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7007 42 135 1.20.140.150
af_A0A2R8Q812_6_212_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6971 42 133 1.20.140.150
af_A6NFC5_6_204_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6864 42 135 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A7Y5X4G2-F1-model_v4 DUF2269 family protein 0.9346 1 138 GO:0016020
AF-A0A7Y5X4G2-F1-model_v4 DUF2269 family protein 0.9277 1 138 GO:0016020
AF-A0A4U5X5N3-F1-model_v4 DUF2269 family protein 0.9196 1 138 GO:0016020
AF-A0A7V9BCI6-F1-model_v4 Uncharacterized protein 0.9141 1 137 GO:0016020
AF-A0A7V9BCI6-F1-model_v4 Uncharacterized protein 0.9074 1 137 GO:0016020

Map