F445404

General Info

Members Datasets Scaffolds Average Seq Length
445 329 344 209

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10005014|JGI25153J46596_100050145
Length 246
Sequence MCNGKVANKGDNCQSLTFRRCFGRAMIICSTSMNFVQAVMEKTMGNGIQDVLDIYHAMIETEHNSPRELPPGGRDGGQDQRLRAVGPETGQFINILARSLKAPTILELGTSXGYSGIWLAEAARASGGRLITMEMHXYKSAYARDMAVRAGLAEYVEFXVGDAVQMXGXLSSGIXFVLVDLWKDLYVPCLEAFYPKLNPGAIIVADNMLRPGGDDLKRYGEAVRAKPGISSVLLPVGSGLEVSRFD

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
3 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
4 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
5 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
6 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
7 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
8 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
9 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
10 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
11 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
12 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
13 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
14 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
15 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
16 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
17 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
18 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
19 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
20 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
21 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
22 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
23 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
24 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
25 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
26 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
27 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
28 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
29 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
30 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
31 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
32 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
33 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
34 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
35 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
36 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
37 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
38 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
39 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
40 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
41 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
42 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
43 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
44 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
45 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
46 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
47 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
48 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
49 2791355263 Rhizobium chutanense C5 Isolate Nodule
50 2791355267 Rhizobium sp. L18 Isolate Nodule
51 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
52 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
53 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
54 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
55 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
56 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
57 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
58 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
59 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
60 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
61 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
62 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
63 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
64 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
65 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
66 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
67 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
68 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
69 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
70 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
71 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
72 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
73 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
74 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
75 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
76 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
77 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
78 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
79 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
80 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
81 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
82 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
83 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
84 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
85 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
86 2936381700 Rhizobium chutanense C16 Isolate Unclassified
87 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
88 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
89 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
90 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
91 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
92 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
93 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
94 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
95 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
96 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
97 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
98 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
99 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
100 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
101 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
102 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
103 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
104 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
105 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
106 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
107 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
108 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
109 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
110 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
111 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
112 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
113 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
114 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
115 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
116 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
117 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
118 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
119 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
120 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
121 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
122 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
123 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
124 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
125 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
126 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
127 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
128 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
129 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
130 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
131 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
132 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
133 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
134 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
135 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
136 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
137 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
144 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
151 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
152 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
153 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
154 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
155 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
156 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
157 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
159 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
166 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
169 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
191 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
214 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
215 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
216 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
217 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
218 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
219 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
220 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
221 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
229 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
230 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
233 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
234 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
235 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
236 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
246 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
247 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
248 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
249 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
250 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
251 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
252 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
253 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
254 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
255 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
258 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
269 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
270 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
271 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
272 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
280 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
293 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
294 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
295 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
296 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
297 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
298 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
299 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
300 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
301 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
302 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
303 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
304 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
305 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
306 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
307 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
308 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
311 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
312 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
313 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
315 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
316 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
317 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
318 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
319 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
320 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
321 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
322 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
323 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
324 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
325 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
326 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
327 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
328 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
329 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.08
Metatranscriptomes 0
Isolates 22.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.12
Nodule 15.06
Rhizoplane 3.15
Rhizosphere 46.29
Stem 0
Stem Tuber 0
Unclassified 14.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000327 3300002705 Bacteria 31279
2 JGI25162J39368_1001983 3300002737 Bacteria 9167
3 JGI25158J39367_1000053 3300002739 Bacteria 26622
4 JGI25152J39213_1002422 3300002773 Bacteria 7105
5 JGI25152J39213_1014016 3300002773 Bacteria 1643
6 JGI25150J39212_1003266 3300002774 Bacteria 3825
7 JGI25159J45721_1001345 3300002987 Bacteria 10303
8 JGI25151J46595_10011803 3300003187 Bacteria 4003
9 JGI25165J46597_1001534 3300003214 Bacteria 11512
10 JGI25153J46596_10005014 3300003215 Bacteria 7017
11 JGI25153J46596_10007447 3300003215 Bacteria 5386
12 JGI25153J46596_10022083 3300003215 Bacteria 2356
13 rootH1_10012775 3300003316 Bacteria 3030
14 rootH1_10012775 3300003323 Bacteria 1296
15 JGI25160J50197_1013838 3300003354 Bacteria 2730
16 JGI25160J50197_1026574 3300003354 Bacteria 1593
17 JGI25161J50226_1000134 3300003374 Bacteria 51546
18 JGI25161J50226_1000140 3300003374 Bacteria 50175
19 JGI25161J50226_1000242 3300003374 Bacteria 32920
20 Ga0055539_1006202 3300003752 Bacteria 1532
21 Ga0055526_1000783 3300003771 Bacteria 23705
22 Ga0055524_1039483 3300003775 Bacteria 1218
23 Ga0055524_1050709 3300003775 Bacteria 943
24 Ga0055524_1050715 3300003775 Bacteria 943
25 Ga0055528_1016866 3300003790 Bacteria 2558
26 Ga0055540_1000192 3300003792 Bacteria 58828
27 Ga0055540_1002652 3300003792 Bacteria 9251
28 Ga0055540_1017888 3300003792 Bacteria 1961
29 Ga0055543_1000128 3300004625 Bacteria 63029
30 Ga0065165_1015392 3300005262 Bacteria 2918
31 Ga0070676_10459059 3300005328 Bacteria 897
32 Ga0070683_100111013 3300005329 Bacteria 2587
33 Ga0070683_100312766 3300005329 Bacteria 1495
34 Ga0070670_100629697 3300005331 Bacteria 961
35 Ga0070666_10004913 3300005335 Bacteria 8172
36 Ga0070689_100001813 3300005340 Bacteria 13734
37 Ga0070689_100024599 3300005340 Bacteria 4519
38 Ga0070668_100476896 3300005347 Bacteria 1077
39 Ga0070669_100402960 3300005353 Bacteria 1120
40 Ga0070669_100465988 3300005353 Bacteria 1043
41 Ga0070675_100158190 3300005354 Bacteria 1947
42 Ga0070688_100212225 3300005365 Bacteria 1360
43 Ga0070701_10088804 3300005438 Bacteria 1689
44 Ga0070678_100059507 3300005456 Bacteria 2808
45 Ga0070706_100054996 3300005467 Bacteria 3674
46 Ga0070699_100103652 3300005518 Bacteria 2495
47 Ga0070697_100029183 3300005536 Bacteria 4421
48 Ga0068853_100298705 3300005539 Bacteria 1488
49 Ga0070672_100268812 3300005543 Bacteria 1439
50 Ga0070665_100207300 3300005548 Bacteria 1961
51 Ga0070665_100215436 3300005548 Bacteria 1921
52 Ga0070665_100592539 3300005548 Bacteria 1121
53 Ga0068855_100328273 3300005563 Bacteria 1689
54 Ga0068855_101395170 3300005563 Bacteria 722
55 Ga0070664_100008459 3300005564 Bacteria 8321
56 Ga0068854_100192631 3300005578 Bacteria 1598
57 Ga0068856_100007129 3300005614 Bacteria 10906
58 Ga0068852_100079848 3300005616 Bacteria 2899
59 Ga0068852_100793763 3300005616 Bacteria 961
60 Ga0068859_100033646 3300005617 Bacteria 5148
61 Ga0068859_100247954 3300005617 Bacteria 1871
62 Ga0068870_10374300 3300005840 Bacteria 920
63 Ga0068860_100026634 3300005843 Bacteria 5573
64 Ga0075365_10000344 3300006038 Bacteria 16625
65 Ga0075369_10034711 3300006186 Bacteria 2142
66 Ga0075369_10125972 3300006186 Bacteria 1162
67 Ga0075370_10005738 3300006353 Bacteria 6201
68 Ga0075430_100062534 3300006846 Bacteria 3127
69 Ga0068865_100137972 3300006881 Bacteria 1835
70 Ga0097620_100033645 3300006931 Bacteria 5148
71 Ga0097620_100247981 3300006931 Bacteria 1871
72 Ga0105244_10196320 3300009036 Bacteria 953
73 Ga0105240_10000012 3300009093 Bacteria 496639
74 Ga0105248_10045785 3300009177 Bacteria 4905
75 Ga0105248_10747881 3300009177 Bacteria 1103
76 Ga0105237_10015105 3300009545 Bacteria 8048
77 Ga0105249_10453099 3300009553 Bacteria 1322
78 Ga0123342_1017765 3300009766 Bacteria 5841
79 Ga0105035_100515 3300009988 Bacteria 2393
80 Ga0105239_10026862 3300010375 Bacteria 6336
81 Ga0157370_10005220 3300013104 Bacteria 14636
82 Ga0157369_10302823 3300013105 Bacteria 1663
83 Ga0163162_10008449 3300013306 Bacteria 10044
84 Ga0157375_10024322 3300013308 Bacteria 5604
85 Ga0182008_10127772 3300014497 Bacteria 1266
86 Ga0182005_1003664 3300015265 Bacteria 5151
87 Ga0213872_10023754 3300021361 Bacteria 2820
88 Ga0213871_10000746 3300021441 Bacteria 4804
89 Ga0209436_100029 3300025208 Bacteria 85964
90 Ga0209437_100040 3300025233 Bacteria 448096
91 Ga0207425_1006905 3300025245 Bacteria 3061
92 Ga0207425_1027648 3300025245 Bacteria 1156
93 Ga0209677_100584 3300025253 Bacteria 19941
94 Ga0209759_1000052 3300025256 Bacteria 213964
95 Ga0209129_1007012 3300025258 Bacteria 3466
96 Ga0209129_1012364 3300025258 Bacteria 1965
97 Ga0209129_1023916 3300025258 Bacteria 1082
98 Ga0209233_1000051 3300025261 Bacteria 447617
99 Ga0209233_1000146 3300025261 Bacteria 187269
100 Ga0209673_1004436 3300025273 Bacteria 7521
101 Ga0209673_1068876 3300025273 Bacteria 851
102 Ga0209130_1000472 3300025284 Bacteria 41433
103 Ga0209025_1020677 3300025294 Bacteria 3584
104 Ga0209564_1001299 3300025295 Bacteria 26951
105 Ga0209758_1001861 3300025297 Bacteria 23130
106 Ga0209758_1007792 3300025297 Bacteria 7156
107 Ga0209758_1018477 3300025297 Bacteria 3413
108 Ga0209758_1034730 3300025297 Bacteria 2000
109 Ga0209050_1006618 3300025298 Bacteria 6799
110 Ga0209256_1002853 3300025299 Bacteria 13162
111 Ga0209256_1019085 3300025299 Bacteria 2197
112 Ga0209256_1051338 3300025299 Bacteria 995
113 Ga0207426_1000008 3300025302 Bacteria 848730
114 Ga0207426_1002717 3300025302 Bacteria 10772
115 Ga0207426_1035899 3300025302 Bacteria 1579
116 Ga0207426_1048298 3300025302 Bacteria 1279
117 Ga0209051_1000253 3300025303 Bacteria 90622
118 Ga0209051_1002465 3300025303 Bacteria 13237
119 Ga0209051_1008262 3300025303 Bacteria 5538
120 Ga0209051_1032905 3300025303 Bacteria 1970
121 Ga0209257_1002797 3300025304 Bacteria 16431
122 Ga0209257_1040539 3300025304 Bacteria 1388
123 Ga0207680_10052392 3300025903 Bacteria 2445
124 Ga0207645_10382229 3300025907 Bacteria 945
125 Ga0207684_10087722 3300025910 Bacteria 2651
126 Ga0207695_10000120 3300025913 Bacteria 234247
127 Ga0207695_10089008 3300025913 Bacteria 3105
128 Ga0207671_10000023 3300025914 Bacteria 274756
129 Ga0207681_10252128 3300025923 Bacteria 1378
130 Ga0207659_10124816 3300025926 Bacteria 1978
131 Ga0207659_10653666 3300025926 Bacteria 899
132 Ga0207644_10512033 3300025931 Bacteria 991
133 Ga0207670_10058943 3300025936 Bacteria 2610
134 Ga0207661_10176491 3300025944 Bacteria 1863
135 Ga0207667_10245682 3300025949 Bacteria 1831
136 Ga0207667_10683358 3300025949 Bacteria 1030
137 Ga0207667_10909308 3300025949 Bacteria 871
138 Ga0207640_10167403 3300025981 Bacteria 1634
139 Ga0207640_10298979 3300025981 Bacteria 1272
140 Ga0207703_10255012 3300026035 Bacteria 1583
141 Ga0207639_10135963 3300026041 Bacteria 2041
142 Ga0207639_10480905 3300026041 Bacteria 1132
143 Ga0207702_10013214 3300026078 Bacteria 6866
144 Ga0207702_10345351 3300026078 Bacteria 1423
145 Ga0207683_10152572 3300026121 Bacteria 2085
146 Ga0207698_10188714 3300026142 Bacteria 1834
147 Ga0268266_10019290 3300028379 Bacteria 5808
148 Ga0268266_10188702 3300028379 Bacteria 1881
149 Ga0268265_10140130 3300028380 Bacteria 2024
150 Ga0265326_10024651 3300028558 Bacteria 1717
151 Ga0265334_10027775 3300028573 Bacteria 2277
152 Ga0265338_10009406 3300028800 Bacteria 11659
153 Ga0265338_10178720 3300028800 Bacteria 1620
154 Ga0265338_10214084 3300028800 Bacteria 1444
155 Ga0265327_10032816 3300031251 Bacteria 2903
156 Ga0307408_100287581 3300031548 Bacteria 1371
157 Ga0265314_10232125 3300031711 Bacteria 1070
158 Ga0307405_10361330 3300031731 Bacteria 1123
159 Ga0307413_10387201 3300031824 Bacteria 1091
160 Ga0307410_10699024 3300031852 Bacteria 854
161 Ga0307406_10188113 3300031901 Bacteria 1509
162 Ga0307407_10125146 3300031903 Bacteria 1636
163 Ga0307412_10031188 3300031911 Bacteria 3364
164 Ga0307414_10049894 3300032004 Bacteria 2896
165 Ga0307411_10289749 3300032005 Bacteria 1307
166 Ga0373961_0068040 3300035241 Bacteria 1096
167 Ga0373947_0528587 3300035725 Bacteria 802
168 Ga0373925_0252081 3300037068 Bacteria 1416
169 Ga0395900_0446768 3300037418 Bacteria 1250
170 Ga0395905_0167090 3300037471 Bacteria 2067
171 Ga0436360_0783284 3300039438 Bacteria 10314
172 Ga0436361_1148557 3300039447 Bacteria 4707
173 Ga0436363_1412148 3300039450 Bacteria 1007
174 Ga0439465_0006296 3300041413 Bacteria 3768
175 Ga0451798_0304899 3300041458 Bacteria 2042
176 Ga0451804_0486008 3300041463 Bacteria 1379
177 Ga0451833_0271586 3300041491 Bacteria 2619
178 Ga0451835_0111837 3300041492 Bacteria 1984
179 Ga0451837_0458588 3300041494 Bacteria 3072
180 Ga0451837_1600647 3300041494 Bacteria 1162
181 Ga0451839_0421304 3300041496 Bacteria 3147
182 Ga0451849_1139822 3300041505 Bacteria 1819
183 Ga0451851_1181860 3300041507 Bacteria 2068
184 Ga0451843_1150161 3300041509 Bacteria 908
185 Ga0451853_0613702 3300041512 Bacteria 2465
186 Ga0451853_1137069 3300041512 Bacteria 1106
187 Ga0451853_2292606 3300041512 Bacteria 1144
188 Ga0466967_0130275 3300045976 Bacteria 2334
189 Ga0495638_0006005 3300046460 Bacteria 8898
190 Ga0495605_0005848 3300046474 Bacteria 7114
191 Ga0495584_0061551 3300046491 Bacteria 1887
192 Ga0495585_0030197 3300046492 Bacteria 3083
193 Ga0495585_0047837 3300046492 Bacteria 2380
194 Ga0495585_0227434 3300046492 Bacteria 939
195 Ga0495596_0049400 3300046500 Bacteria 1649
196 Ga0495607_0000101 3300046501 Bacteria 91495
197 Ga0495607_0005399 3300046501 Bacteria 9155
198 Ga0495607_0096076 3300046501 Bacteria 1596
199 Ga0495583_0000010 3300046506 Bacteria 353523
200 Ga0495583_0022147 3300046506 Bacteria 3250
201 Ga0495606_0014267 3300046507 Bacteria 6213
202 Ga0495610_0015238 3300046512 Bacteria 4475
203 Ga0495610_0024255 3300046512 Bacteria 3277
204 Ga0495610_0068786 3300046512 Bacteria 1658
205 Ga0495610_0111899 3300046512 Bacteria 1208
206 Ga0495616_0225992 3300046513 Unclassified 813
207 Ga0495620_0003970 3300046515 Bacteria 8410
208 Ga0495620_0019710 3300046515 Bacteria 3311
209 Ga0495631_0026771 3300046518 Bacteria 2644
210 Ga0495631_0132347 3300046518 Bacteria 1071
211 Ga0495631_0146997 3300046518 Bacteria 1011
212 Ga0495632_0011198 3300046519 Bacteria 5251
213 Ga0495632_0024191 3300046519 Bacteria 3231
214 Ga0495632_0042081 3300046519 Bacteria 2292
215 Ga0495643_0001887 3300046522 Bacteria 17753
216 Ga0495643_0011261 3300046522 Bacteria 5459
217 Ga0495643_0061074 3300046522 Bacteria 1999
218 Ga0495643_0067054 3300046522 Bacteria 1892
219 Ga0495648_0031675 3300046524 Bacteria 3480
220 Ga0495654_0055426 3300046530 Bacteria 1919
221 Ga0495609_0031220 3300046538 Bacteria 2423
222 Ga0495609_0123856 3300046538 Bacteria 1110
223 Ga0495597_0004692 3300046542 Bacteria 7415
224 Ga0495668_0010534 3300046616 Bacteria 5589
225 Ga0495668_0017449 3300046616 Bacteria 4163
226 Ga0495668_0083069 3300046616 Unclassified 1757
227 Ga0495611_0004484 3300046648 Bacteria 6043
228 Ga0495625_0000508 3300046660 Bacteria 57754
229 Ga0495625_0009325 3300046660 Bacteria 8225
230 Ga0495625_0012026 3300046660 Bacteria 7025
231 Ga0495625_0015606 3300046660 Bacteria 6009
232 Ga0495625_0024002 3300046660 Bacteria 4649
233 Ga0495661_0083430 3300046665 Bacteria 1837
234 Ga0495671_0072333 3300046692 Bacteria 1693
235 Ga0495649_0235360 3300046694 Bacteria 944
236 Ga0495589_0023547 3300046794 Bacteria 3137
237 Ga0495660_0010064 3300046810 Bacteria 5501
238 Ga0495636_0119690 3300047318 Bacteria 1164
239 Ga0495683_0036013 3300047323 Bacteria 2514
240 Ga0495687_004989 3300047443 Bacteria 8677
241 Ga0495687_013525 3300047443 Bacteria 4253
242 Ga0495687_161502 3300047443 Bacteria 753
243 Ga0495679_045042 3300047446 Bacteria 1349
244 Ga0495673_0177525 3300047469 Bacteria 808
245 Ga0495681_0017580 3300047470 Bacteria 3965
246 Ga0495686_0000278 3300047472 Bacteria 90520
247 Ga0495686_0001455 3300047472 Bacteria 25795
248 Ga0495686_0003836 3300047472 Bacteria 12735
249 Ga0495686_0017875 3300047472 Bacteria 4768
250 Ga0495686_0021566 3300047472 Bacteria 4274
251 Ga0495686_0046485 3300047472 Bacteria 2743
252 Ga0495686_0139148 3300047472 Bacteria 1433
253 Ga0495615_0000780 3300048090 Bacteria 4465
254 Ga0495626_0019461 3300048091 Bacteria 3397
255 Ga0496101_0009259 3300048904 Bacteria 6466
256 Ga0496101_0335887 3300048904 Bacteria 1186
257 Ga0496102_0006671 3300048905 Bacteria 9865
258 Ga0496103_0006841 3300048906 Bacteria 6807
259 Ga0496106_0001359 3300048909 Bacteria 18315
260 Ga0496106_0115570 3300048909 Bacteria 2093
261 Ga0496106_0428985 3300048909 Bacteria 1062
262 Ga0496107_0012662 3300048910 Bacteria 5891
263 Ga0496109_0279923 3300048912 Bacteria 1572
264 Ga0496113_0048489 3300048916 Bacteria 3160
265 Ga0496114_0628909 3300048917 Unclassified 945
266 Ga0496115_0082204 3300048918 Bacteria 2624
267 Ga0496116_0007077 3300048919 Bacteria 10044
268 Ga0496116_0014411 3300048919 Bacteria 6315
269 Ga0496116_0035375 3300048919 Bacteria 3509
270 Ga0496117_0001348 3300048920 Bacteria 36026
271 Ga0496117_0038374 3300048920 Bacteria 3552
272 Ga0496117_0127946 3300048920 Bacteria 1546
273 Ga0496117_0188801 3300048920 Bacteria 1176
274 Ga0496117_0400415 3300048920 Unclassified 693
275 Ga0496118_0006857 3300048921 Bacteria 12345
276 Ga0496118_0030476 3300048921 Bacteria 4501
277 Ga0496119_0018741 3300048922 Bacteria 5133
278 Ga0496119_0214925 3300048922 Bacteria 987
279 Ga0496120_0002158 3300048923 Bacteria 20963
280 Ga0496121_0000466 3300048924 Bacteria 78934
281 Ga0496121_0006947 3300048924 Bacteria 13794
282 Ga0496121_0023875 3300048924 Bacteria 5868
283 Ga0496121_0380263 3300048924 Bacteria 931
284 Ga0496122_0010148 3300048925 Bacteria 9759
285 Ga0496122_0017511 3300048925 Bacteria 6694
286 Ga0496122_0026555 3300048925 Bacteria 4986
287 Ga0496122_0047623 3300048925 Bacteria 3307
288 Ga0496122_0087582 3300048925 Bacteria 2138
289 Ga0496123_0000335 3300048926 Bacteria 89251
290 Ga0496123_0006910 3300048926 Bacteria 10855
291 Ga0496123_0032152 3300048926 Bacteria 3805
292 Ga0496123_0108401 3300048926 Bacteria 1594
293 Ga0496124_0001939 3300048927 Bacteria 28328
294 Ga0496124_0029659 3300048927 Bacteria 4868
295 Ga0496124_0086849 3300048927 Bacteria 2559
296 Ga0496124_0309184 3300048927 Bacteria 1137
297 Ga0496125_0026928 3300048928 Bacteria 5222
298 Ga0496125_0067618 3300048928 Bacteria 2814
299 Ga0496125_0276849 3300048928 Bacteria 1042
300 Ga0496125_0330669 3300048928 Bacteria 919
301 Ga0496125_0463543 3300048928 Bacteria 722
302 Ga0496126_0170327 3300048929 Bacteria 1855
303 Ga0495678_002473 3300049459 Bacteria 12461
304 Ga0495678_025779 3300049459 Bacteria 2520
305 Ga0495682_0107377 3300049460 Bacteria 1000
306 Ga0495682_0200465 3300049460 Bacteria 708
307 Ga0501032_0119832 3300049569 Bacteria 1740
308 Ga0501034_0029409 3300049571 Bacteria 5583
309 Ga0501038_0252661 3300049574 Bacteria 1396
310 Ga0501046_0048937 3300049580 Bacteria 3346
311 Ga0501047_0183390 3300049581 Bacteria 1959
312 Ga0501073_0072365 3300049589 Bacteria 2401
313 nmdc:mga03n38_161160_c1 3300050490 Bacteria 1136
314 nmdc:mga0yw44_328409_c1 3300050492 Bacteria 1028
315 nmdc:mga07m45_197191_c1 3300050496 Bacteria 1171
316 nmdc:mga0qj67_41623_c1 3300050509 Bacteria 3614
317 nmdc:mga0sz30_34764_c2 3300050516 Bacteria 1082
318 Ga0500610_0151999 3300053079 Bacteria 1159
319 Ga0500578_0081123 3300053086 Bacteria 2062
320 Ga0500643_047859 3300053087 Bacteria 1231
321 Ga0500651_0159431 3300053093 Bacteria 1350
322 Ga0500650_0242307 3300053098 Bacteria 811
323 Ga0500555_000684 3300053103 Bacteria 12890
324 Ga0500556_0000013 3300053104 Bacteria 243797
325 Ga0500557_130982 3300053105 Bacteria 830
326 Ga0500569_058538 3300053109 Bacteria 1183
327 Ga0500594_0001139 3300053118 Bacteria 5715
328 Ga0500617_068275 3300053124 Bacteria 1562
329 Ga0500618_001900 3300053125 Bacteria 8628
330 Ga0500618_016727 3300053125 Bacteria 1831
331 Ga0500642_0000002 3300053130 Bacteria 795093
332 Ga0500658_0016492 3300053134 Bacteria 2752
333 Ga0500658_0031787 3300053134 Bacteria 2066
334 Ga0500568_0003524 3300053139 Bacteria 8676
335 Ga0500588_0118484 3300053146 Bacteria 931
336 Ga0500604_0016238 3300053151 Bacteria 2048
337 Ga0500616_0003848 3300053153 Bacteria 11090
338 Ga0500616_0131809 3300053153 Bacteria 1180
339 Ga0500622_0000614 3300053156 Bacteria 32273
340 Ga0500622_0175307 3300053156 Unclassified 995
341 Ga0500633_0002647 3300053160 Bacteria 3733
342 Ga0500636_0080998 3300053177 Bacteria 1870
343 Ga0500645_002578 3300053730 Bacteria 7968
344 Ga0501082_0632388 3300060353 Bacteria 936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046515 Ga0495620_0019710 Ga0495620_0019710_1915_2529 194
2 3300046522 Ga0495643_0067054 Ga0495643_0067054_846_1460 194
3 3300046616 Ga0495668_0083069 Ga0495668_0083069_701_1315 194
4 3300047472 Ga0495686_0021566 Ga0495686_0021566_222_836 194
5 3300049459 Ga0495678_002473 Ga0495678_002473_6627_7241 194
6 iso_pu_bacteria 2510917028 2511187218 196
7 3300026035 Ga0207703_10255012 Ga0207703_102550123 197
8 3300048090 Ga0495615_0000780 Ga0495615_0000780_3017_3649 197
9 3300048924 Ga0496121_0000466 Ga0496121_0000466_51972_52598 197
10 3300048925 Ga0496122_0010148 Ga0496122_0010148_398_1030 197
11 3300048926 Ga0496123_0006910 Ga0496123_0006910_8918_9550 197
12 3300048928 Ga0496125_0276849 Ga0496125_0276849_210_842 197
13 3300039450 Ga0436363_1412148 Ga0436363_1412148_151_753 198
14 3300047472 Ga0495686_0000278 Ga0495686_0000278_78778_79380 198
15 3300047472 Ga0495686_0003836 Ga0495686_0003836_5666_6268 198
16 3300048920 Ga0496117_0188801 Ga0496117_0188801_262_864 198
17 3300037418 Ga0395900_0446768 Ga0395900_0446768_411_1028 199
18 3300037471 Ga0395905_0167090 Ga0395905_0167090_538_1155 199
19 3300039438 Ga0436360_0783284 Ga0436360_0783284_4255_4860 199
20 3300046522 Ga0495643_0001887 Ga0495643_0001887_8630_9235 199
21 3300046660 Ga0495625_0000508 Ga0495625_0000508_23030_23635 199
22 iso_pu_bacteria 2509276021 2509392427 199
23 iso_pu_bacteria 2510461076 2510894955 199
24 iso_pu_bacteria 2510917022 2511135570 199
25 iso_pu_bacteria 2513237085 2513577525 199
26 iso_pu_bacteria 2513237093 2513629826 199
27 iso_pu_bacteria 2513237103 2513708460 199
28 iso_pu_bacteria 2513237138 2513867608 199
29 iso_pu_bacteria 2515075009 2515112556 199
30 iso_pu_bacteria 2515154113 2515632892 199
31 iso_pu_bacteria 2515154114 2515640036 199
32 iso_pu_bacteria 2515154116 2515655766 199
33 iso_pu_bacteria 2516653077 2517036280 199
34 iso_pu_bacteria 2517093000 2517095416 199
35 iso_pu_bacteria 2517287029 2517407013 199
36 iso_pu_bacteria 2582581294 2585204846 199
37 iso_pu_bacteria 2582581307 2585272645 199
38 iso_pu_bacteria 2582581308 2585278364 199
39 iso_pu_bacteria 2582581315 2585324794 199
40 iso_pu_bacteria 2582581316 2585332225 199
41 iso_pu_bacteria 2582581867 2585403411 199
42 iso_pu_bacteria 2585427526 2585527034 199
43 iso_pu_bacteria 2585427527 2585531980 199
44 iso_pu_bacteria 2585427530 2585552340 199
45 iso_pu_bacteria 2585427531 2585562313 199
46 iso_pu_bacteria 2585427590 2585823707 199
47 iso_pu_bacteria 2585427608 2585896757 199
48 iso_pu_bacteria 2585427609 2585906520 199
49 iso_pu_bacteria 2585428125 2587981942 199
50 iso_pu_bacteria 2615840626 2616307882 199
51 iso_pu_bacteria 2615840698 2616552458 199
52 iso_pu_bacteria 2617270742 2617381803 199
53 iso_pu_bacteria 2718218199 2720492222 199
54 iso_pu_bacteria 2718218233 2720620363 199
55 iso_pu_bacteria 2721755556 2723027133 199
56 iso_pu_bacteria 2721755684 2723560745 199
57 iso_pu_bacteria 2721755823 2724110410 199
58 iso_pu_bacteria 2724679232 2725950518 199
59 iso_pu_bacteria 2728369352 2730108069 199
60 iso_pu_bacteria 2738541317 2738948025 199
61 iso_pu_bacteria 2765235942 2766066882 199
62 iso_pu_bacteria 2791355267 2793366947 199
63 iso_pu_bacteria 2818991453 2819640225 199
64 iso_pu_bacteria 2838016132 2838018008 199
65 iso_pu_bacteria 2838042994 2838043645 199
66 iso_pu_bacteria 2838686498 2838692028 199
67 iso_pu_bacteria 2838729681 2838732826 199
68 iso_pu_bacteria 2838742623 2838745704 199
69 iso_pu_bacteria 2841851746 2841855838 199
70 iso_pu_bacteria 2841864319 2841864329 199
71 iso_pu_bacteria 2842110456 2842114151 199
72 iso_pu_bacteria 2842156927 2842157170 199
73 iso_pu_bacteria 2842163707 2842167831 199
74 iso_pu_bacteria 2842180545 2842181246 199
75 iso_pu_bacteria 2842217011 2842217511 199
76 iso_pu_bacteria 2842229732 2842230703 199
77 iso_pu_bacteria 2842243621 2842245197 199
78 iso_pu_bacteria 2842257432 2842259010 199
79 iso_pu_bacteria 2842264693 2842265843 199
80 iso_pu_bacteria 2842271015 2842276320 199
81 iso_pu_bacteria 2842304105 2842304537 199
82 iso_pu_bacteria 2842341865 2842345335 199
83 iso_pu_bacteria 2842363717 2842364784 199
84 iso_pu_bacteria 2842428310 2842429520 199
85 iso_pu_bacteria 2842434925 2842436133 199
86 iso_pu_bacteria 2842441272 2842442480 199
87 iso_pu_bacteria 2842462802 2842463941 199
88 iso_pu_bacteria 2842469257 2842470462 199
89 iso_pu_bacteria 2842482326 2842484041 199
90 iso_pu_bacteria 2844454524 2844458917 199
91 iso_pu_bacteria 2891633521 2891634964 199
92 iso_pu_bacteria 2913308742 2913312764 199
93 iso_pu_bacteria 2933586486 2933590247 199
94 iso_pu_bacteria 2936381700 2936388417 199
95 iso_pu_bacteria 8005430974 8005431710 199
96 iso_pu_bacteria 8005460587 8005463229 199
97 iso_pu_bacteria 8005542996 8005547311 199
98 iso_pu_bacteria 8005619151 8005621913 199
99 iso_pu_bacteria 8005626139 8005627155 199
100 iso_pu_bacteria 8005668836 8005671954 199
101 iso_pu_bacteria 8005682033 8005684083 199
102 iso_pu_bacteria 8056375014 8056376833 199
103 iso_pu_bacteria 8057874678 8057874788 199
104 3300005335 Ga0070666_10004913 Ga0070666_100049139 200
105 3300005353 Ga0070669_100465988 Ga0070669_1004659882 200
106 3300005456 Ga0070678_100059507 Ga0070678_1000595072 200
107 3300005548 Ga0070665_100215436 Ga0070665_1002154362 200
108 3300009177 Ga0105248_10045785 Ga0105248_100457855 200
109 3300013306 Ga0163162_10008449 Ga0163162_100084494 200
110 3300013308 Ga0157375_10024322 Ga0157375_100243225 200
111 3300025903 Ga0207680_10052392 Ga0207680_100523923 200
112 3300026121 Ga0207683_10152572 Ga0207683_101525723 200
113 3300046460 Ga0495638_0006005 Ga0495638_0006005_3134_3745 200
114 3300046474 Ga0495605_0005848 Ga0495605_0005848_6418_7029 200
115 3300046491 Ga0495584_0061551 Ga0495584_0061551_1161_1772 200
116 3300046492 Ga0495585_0030197 Ga0495585_0030197_181_792 200
117 3300046500 Ga0495596_0049400 Ga0495596_0049400_864_1475 200
118 3300046501 Ga0495607_0096076 Ga0495607_0096076_140_751 200
119 3300046513 Ga0495616_0225992 Ga0495616_0225992_30_641 200
120 3300046518 Ga0495631_0026771 Ga0495631_0026771_1339_1950 200
121 3300046692 Ga0495671_0072333 Ga0495671_0072333_132_743 200
122 3300046794 Ga0495589_0023547 Ga0495589_0023547_209_820 200
123 3300047323 Ga0495683_0036013 Ga0495683_0036013_748_1359 200
124 3300048909 Ga0496106_0115570 Ga0496106_0115570_431_1042 200
125 3300048910 Ga0496107_0012662 Ga0496107_0012662_850_1461 200
126 3300048917 Ga0496114_0628909 Ga0496114_0628909_202_813 200
127 3300048918 Ga0496115_0082204 Ga0496115_0082204_660_1271 200
128 3300048920 Ga0496117_0400415 Ga0496117_0400415_32_643 200
129 iso_pu_bacteria 2900634093 2900641734 200
130 iso_pu_bacteria 642555113 642615778 200
131 3300028800 Ga0265338_10178720 Ga0265338_101787202 201
132 3300005328 Ga0070676_10459059 Ga0070676_104590592 202
133 3300005329 Ga0070683_100312766 Ga0070683_1003127662 202
134 3300005331 Ga0070670_100629697 Ga0070670_1006296971 202
135 3300005340 Ga0070689_100024599 Ga0070689_1000245993 202
136 3300005354 Ga0070675_100158190 Ga0070675_1001581903 202
137 3300005365 Ga0070688_100212225 Ga0070688_1002122251 202
138 3300005438 Ga0070701_10088804 Ga0070701_100888043 202
139 3300005543 Ga0070672_100268812 Ga0070672_1002688121 202
140 3300005563 Ga0068855_100328273 Ga0068855_1003282732 202
141 3300005564 Ga0070664_100008459 Ga0070664_1000084592 202
142 3300005614 Ga0068856_100007129 Ga0068856_10000712911 202
143 3300005616 Ga0068852_100793763 Ga0068852_1007937632 202
144 3300005617 Ga0068859_100247954 Ga0068859_1002479542 202
145 3300005840 Ga0068870_10374300 Ga0068870_103743001 202
146 3300006038 Ga0075365_10000344 Ga0075365_1000034411 202
147 3300006186 Ga0075369_10125972 Ga0075369_101259721 202
148 3300006881 Ga0068865_100137972 Ga0068865_1001379724 202
149 3300006931 Ga0097620_100247981 Ga0097620_1002479813 202
150 3300009553 Ga0105249_10453099 Ga0105249_104530993 202
151 3300013105 Ga0157369_10302823 Ga0157369_103028233 202
152 3300025907 Ga0207645_10382229 Ga0207645_103822292 202
153 3300025913 Ga0207695_10089008 Ga0207695_100890081 202
154 3300025926 Ga0207659_10124816 Ga0207659_101248163 202
155 3300025936 Ga0207670_10058943 Ga0207670_100589433 202
156 3300025944 Ga0207661_10176491 Ga0207661_101764912 202
157 3300025949 Ga0207667_10245682 Ga0207667_102456823 202
158 3300025949 Ga0207667_10683358 Ga0207667_106833582 202
159 3300025981 Ga0207640_10298979 Ga0207640_102989791 202
160 3300026041 Ga0207639_10135963 Ga0207639_101359633 202
161 3300026078 Ga0207702_10013214 Ga0207702_100132143 202
162 3300028380 Ga0268265_10140130 Ga0268265_101401303 202
163 3300028558 Ga0265326_10024651 Ga0265326_100246511 202
164 3300028573 Ga0265334_10027775 Ga0265334_100277751 202
165 3300028800 Ga0265338_10009406 Ga0265338_1000940610 202
166 3300028800 Ga0265338_10214084 Ga0265338_102140842 202
167 3300031251 Ga0265327_10032816 Ga0265327_100328162 202
168 3300031711 Ga0265314_10232125 Ga0265314_102321252 202
169 3300046506 Ga0495583_0000010 Ga0495583_0000010_21442_22062 202
170 3300046665 Ga0495661_0083430 Ga0495661_0083430_281_901 202
171 3300047443 Ga0495687_161502 Ga0495687_161502_67_687 202
172 3300049460 Ga0495682_0200465 Ga0495682_0200465_74_694 202
173 3300049571 Ga0501034_0029409 Ga0501034_0029409_4019_4630 202
174 3300050492 nmdc:mga0yw44_328409_c1 nmdc:mga0yw44_328409_c1_325_936 202
175 3300050516 nmdc:mga0sz30_34764_c2 nmdc:mga0sz30_34764_c2_182_793 202
176 3300053103 Ga0500555_000684 Ga0500555_000684_2742_3362 202
177 3300002737 JGI25162J39368_1001983 JGI25162J39368_10019834 203
178 3300002739 JGI25158J39367_1000053 JGI25158J39367_10000538 203
179 3300002773 JGI25152J39213_1002422 JGI25152J39213_10024222 203
180 3300002773 JGI25152J39213_1014016 JGI25152J39213_10140164 203
181 3300002774 JGI25150J39212_1003266 JGI25150J39212_10032662 203
182 3300002987 JGI25159J45721_1001345 JGI25159J45721_10013457 203
183 3300003187 JGI25151J46595_10011803 JGI25151J46595_100118031 203
184 3300003214 JGI25165J46597_1001534 JGI25165J46597_10015343 203
185 3300003215 JGI25153J46596_10005014 JGI25153J46596_100050145 203
186 3300003215 JGI25153J46596_10007447 JGI25153J46596_100074475 203
187 3300003215 JGI25153J46596_10022083 JGI25153J46596_100220836 203
188 3300003323 rootH1_10012775 rootH1_100127752 203
189 3300003354 JGI25160J50197_1013838 JGI25160J50197_10138381 203
190 3300003354 JGI25160J50197_1026574 JGI25160J50197_10265742 203
191 3300003374 JGI25161J50226_1000134 JGI25161J50226_100013433 203
192 3300003374 JGI25161J50226_1000140 JGI25161J50226_10001402 203
193 3300003374 JGI25161J50226_1000242 JGI25161J50226_100024215 203
194 3300003752 Ga0055539_1006202 Ga0055539_10062022 203
195 3300003771 Ga0055526_1000783 Ga0055526_100078315 203
196 3300003775 Ga0055524_1039483 Ga0055524_10394831 203
197 3300003775 Ga0055524_1050709 Ga0055524_10507092 203
198 3300003775 Ga0055524_1050715 Ga0055524_10507152 203
199 3300003790 Ga0055528_1016866 Ga0055528_10168662 203
200 3300003792 Ga0055540_1000192 Ga0055540_100019228 203
201 3300003792 Ga0055540_1002652 Ga0055540_10026525 203
202 3300003792 Ga0055540_1017888 Ga0055540_10178882 203
203 3300004625 Ga0055543_1000128 Ga0055543_100012860 203
204 3300005262 Ga0065165_1015392 Ga0065165_10153923 203
205 3300005340 Ga0070689_100001813 Ga0070689_1000018134 203
206 3300005347 Ga0070668_100476896 Ga0070668_1004768962 203
207 3300005353 Ga0070669_100402960 Ga0070669_1004029602 203
208 3300005467 Ga0070706_100054996 Ga0070706_1000549963 203
209 3300005518 Ga0070699_100103652 Ga0070699_1001036523 203
210 3300005536 Ga0070697_100029183 Ga0070697_1000291835 203
211 3300005539 Ga0068853_100298705 Ga0068853_1002987052 203
212 3300005548 Ga0070665_100207300 Ga0070665_1002073001 203
213 3300005563 Ga0068855_101395170 Ga0068855_1013951701 203
214 3300005578 Ga0068854_100192631 Ga0068854_1001926311 203
215 3300005616 Ga0068852_100079848 Ga0068852_1000798485 203
216 3300005617 Ga0068859_100033646 Ga0068859_1000336462 203
217 3300005843 Ga0068860_100026634 Ga0068860_1000266343 203
218 3300006186 Ga0075369_10034711 Ga0075369_100347114 203
219 3300006353 Ga0075370_10005738 Ga0075370_100057382 203
220 3300006846 Ga0075430_100062534 Ga0075430_1000625342 203
221 3300006931 Ga0097620_100033645 Ga0097620_1000336454 203
222 3300009036 Ga0105244_10196320 Ga0105244_101963202 203
223 3300009093 Ga0105240_10000012 Ga0105240_10000012133 203
224 3300009177 Ga0105248_10747881 Ga0105248_107478812 203
225 3300009545 Ga0105237_10015105 Ga0105237_100151054 203
226 3300009766 Ga0123342_1017765 Ga0123342_10177654 203
227 3300009988 Ga0105035_100515 Ga0105035_1005153 203
228 3300010375 Ga0105239_10026862 Ga0105239_100268624 203
229 3300013104 Ga0157370_10005220 Ga0157370_1000522016 203
230 3300014497 Ga0182008_10127772 Ga0182008_101277721 203
231 3300015265 Ga0182005_1003664 Ga0182005_10036644 203
232 3300021361 Ga0213872_10023754 Ga0213872_100237542 203
233 3300021441 Ga0213871_10000746 Ga0213871_100007462 203
234 3300025208 Ga0209436_100029 Ga0209436_10002943 203
235 3300025233 Ga0209437_100040 Ga0209437_100040250 203
236 3300025245 Ga0207425_1006905 Ga0207425_10069052 203
237 3300025245 Ga0207425_1027648 Ga0207425_10276482 203
238 3300025253 Ga0209677_100584 Ga0209677_1005849 203
239 3300025258 Ga0209129_1007012 Ga0209129_10070124 203
240 3300025258 Ga0209129_1012364 Ga0209129_10123641 203
241 3300025258 Ga0209129_1023916 Ga0209129_10239161 203
242 3300025261 Ga0209233_1000051 Ga0209233_1000051251 203
243 3300025261 Ga0209233_1000146 Ga0209233_100014680 203
244 3300025273 Ga0209673_1004436 Ga0209673_10044365 203
245 3300025273 Ga0209673_1068876 Ga0209673_10688762 203
246 3300025284 Ga0209130_1000472 Ga0209130_100047234 203
247 3300025294 Ga0209025_1020677 Ga0209025_10206773 203
248 3300025295 Ga0209564_1001299 Ga0209564_10012997 203
249 3300025297 Ga0209758_1001861 Ga0209758_100186115 203
250 3300025297 Ga0209758_1007792 Ga0209758_10077922 203
251 3300025297 Ga0209758_1018477 Ga0209758_10184774 203
252 3300025297 Ga0209758_1034730 Ga0209758_10347301 203
253 3300025298 Ga0209050_1006618 Ga0209050_10066181 203
254 3300025299 Ga0209256_1002853 Ga0209256_100285311 203
255 3300025299 Ga0209256_1019085 Ga0209256_10190852 203
256 3300025299 Ga0209256_1051338 Ga0209256_10513382 203
257 3300025302 Ga0207426_1000008 Ga0207426_1000008448 203
258 3300025302 Ga0207426_1002717 Ga0207426_10027179 203
259 3300025302 Ga0207426_1048298 Ga0207426_10482982 203
260 3300025303 Ga0209051_1000253 Ga0209051_100025334 203
261 3300025303 Ga0209051_1002465 Ga0209051_100246511 203
262 3300025303 Ga0209051_1008262 Ga0209051_10082625 203
263 3300025303 Ga0209051_1032905 Ga0209051_10329053 203
264 3300025304 Ga0209257_1002797 Ga0209257_100279714 203
265 3300025304 Ga0209257_1040539 Ga0209257_10405392 203
266 3300025910 Ga0207684_10087722 Ga0207684_100877222 203
267 3300025913 Ga0207695_10000120 Ga0207695_1000012080 203
268 3300025914 Ga0207671_10000023 Ga0207671_100000236 203
269 3300025923 Ga0207681_10252128 Ga0207681_102521284 203
270 3300025926 Ga0207659_10653666 Ga0207659_106536662 203
271 3300025931 Ga0207644_10512033 Ga0207644_105120331 203
272 3300025949 Ga0207667_10909308 Ga0207667_109093081 203
273 3300025981 Ga0207640_10167403 Ga0207640_101674033 203
274 3300026041 Ga0207639_10480905 Ga0207639_104809051 203
275 3300026078 Ga0207702_10345351 Ga0207702_103453512 203
276 3300026142 Ga0207698_10188714 Ga0207698_101887142 203
277 3300028379 Ga0268266_10188702 Ga0268266_101887023 203
278 3300031548 Ga0307408_100287581 Ga0307408_1002875812 203
279 3300031731 Ga0307405_10361330 Ga0307405_103613302 203
280 3300031824 Ga0307413_10387201 Ga0307413_103872012 203
281 3300031852 Ga0307410_10699024 Ga0307410_106990241 203
282 3300031901 Ga0307406_10188113 Ga0307406_101881132 203
283 3300031903 Ga0307407_10125146 Ga0307407_101251462 203
284 3300031911 Ga0307412_10031188 Ga0307412_100311882 203
285 3300032004 Ga0307414_10049894 Ga0307414_100498942 203
286 3300032005 Ga0307411_10289749 Ga0307411_102897492 203
287 3300035241 Ga0373961_0068040 Ga0373961_0068040_122_739 203
288 3300035725 Ga0373947_0528587 Ga0373947_0528587_40_657 203
289 3300037068 Ga0373925_0252081 Ga0373925_0252081_180_797 203
290 3300039447 Ga0436361_1148557 Ga0436361_1148557_2245_2862 203
291 3300041413 Ga0439465_0006296 Ga0439465_0006296_181_840 203
292 3300041458 Ga0451798_0304899 Ga0451798_0304899_1277_1969 203
293 3300041463 Ga0451804_0486008 Ga0451804_0486008_600_1292 203
294 3300041491 Ga0451833_0271586 Ga0451833_0271586_805_1479 203
295 3300041492 Ga0451835_0111837 Ga0451835_0111837_654_1328 203
296 3300041494 Ga0451837_0458588 Ga0451837_0458588_339_1037 203
297 3300041494 Ga0451837_1600647 Ga0451837_1600647_39_650 203
298 3300041496 Ga0451839_0421304 Ga0451839_0421304_1338_2030 203
299 3300041505 Ga0451849_1139822 Ga0451849_1139822_1125_1790 203
300 3300041507 Ga0451851_1181860 Ga0451851_1181860_1337_1948 203
301 3300041509 Ga0451843_1150161 Ga0451843_1150161_193_891 203
302 3300041512 Ga0451853_0613702 Ga0451853_0613702_256_930 203
303 3300041512 Ga0451853_1137069 Ga0451853_1137069_119_838 203
304 3300041512 Ga0451853_2292606 Ga0451853_2292606_340_966 203
305 3300045976 Ga0466967_0130275 Ga0466967_0130275_1243_1860 203
306 3300046492 Ga0495585_0047837 Ga0495585_0047837_934_1575 203
307 3300046492 Ga0495585_0227434 Ga0495585_0227434_64_708 203
308 3300046501 Ga0495607_0000101 Ga0495607_0000101_24817_25437 203
309 3300046501 Ga0495607_0005399 Ga0495607_0005399_2020_2721 203
310 3300046507 Ga0495606_0014267 Ga0495606_0014267_1520_2260 203
311 3300046512 Ga0495610_0015238 Ga0495610_0015238_1256_1996 203
312 3300046512 Ga0495610_0024255 Ga0495610_0024255_2570_3229 203
313 3300046512 Ga0495610_0068786 Ga0495610_0068786_837_1451 203
314 3300046512 Ga0495610_0111899 Ga0495610_0111899_315_1007 203
315 3300046515 Ga0495620_0003970 Ga0495620_0003970_7302_7916 203
316 3300046518 Ga0495631_0132347 Ga0495631_0132347_322_1014 203
317 3300046518 Ga0495631_0146997 Ga0495631_0146997_99_740 203
318 3300046519 Ga0495632_0011198 Ga0495632_0011198_2710_3450 203
319 3300046519 Ga0495632_0024191 Ga0495632_0024191_2162_2776 203
320 3300046519 Ga0495632_0042081 Ga0495632_0042081_136_777 203
321 3300046522 Ga0495643_0011261 Ga0495643_0011261_4210_4887 203
322 3300046522 Ga0495643_0061074 Ga0495643_0061074_587_1201 203
323 3300046524 Ga0495648_0031675 Ga0495648_0031675_2786_3403 203
324 3300046530 Ga0495654_0055426 Ga0495654_0055426_936_1577 203
325 3300046538 Ga0495609_0031220 Ga0495609_0031220_1081_1773 203
326 3300046538 Ga0495609_0123856 Ga0495609_0123856_115_756 203
327 3300046542 Ga0495597_0004692 Ga0495597_0004692_70_810 203
328 3300046616 Ga0495668_0010534 Ga0495668_0010534_1846_2487 203
329 3300046616 Ga0495668_0017449 Ga0495668_0017449_1441_2181 203
330 3300046648 Ga0495611_0004484 Ga0495611_0004484_131_772 203
331 3300046660 Ga0495625_0012026 Ga0495625_0012026_4183_4923 203
332 3300046660 Ga0495625_0015606 Ga0495625_0015606_183_827 203
333 3300046660 Ga0495625_0024002 Ga0495625_0024002_3911_4603 203
334 3300046694 Ga0495649_0235360 Ga0495649_0235360_217_876 203
335 3300046810 Ga0495660_0010064 Ga0495660_0010064_325_966 203
336 3300047318 Ga0495636_0119690 Ga0495636_0119690_70_810 203
337 3300047443 Ga0495687_004989 Ga0495687_004989_1616_2356 203
338 3300047443 Ga0495687_013525 Ga0495687_013525_525_1139 203
339 3300047446 Ga0495679_045042 Ga0495679_045042_42_656 203
340 3300047469 Ga0495673_0177525 Ga0495673_0177525_55_669 203
341 3300047470 Ga0495681_0017580 Ga0495681_0017580_2993_3607 203
342 3300047472 Ga0495686_0001455 Ga0495686_0001455_22322_22939 203
343 3300047472 Ga0495686_0017875 Ga0495686_0017875_1238_1855 203
344 3300047472 Ga0495686_0046485 Ga0495686_0046485_529_1143 203
345 3300047472 Ga0495686_0139148 Ga0495686_0139148_546_1166 203
346 3300048091 Ga0495626_0019461 Ga0495626_0019461_2061_2738 203
347 3300048904 Ga0496101_0009259 Ga0496101_0009259_319_936 203
348 3300048904 Ga0496101_0335887 Ga0496101_0335887_314_928 203
349 3300048905 Ga0496102_0006671 Ga0496102_0006671_8376_8993 203
350 3300048906 Ga0496103_0006841 Ga0496103_0006841_857_1474 203
351 3300048909 Ga0496106_0001359 Ga0496106_0001359_8337_8993 203
352 3300048909 Ga0496106_0428985 Ga0496106_0428985_403_1020 203
353 3300048912 Ga0496109_0279923 Ga0496109_0279923_496_1113 203
354 3300048916 Ga0496113_0048489 Ga0496113_0048489_857_1474 203
355 3300048919 Ga0496116_0007077 Ga0496116_0007077_995_1609 203
356 3300048919 Ga0496116_0014411 Ga0496116_0014411_5527_6144 203
357 3300048919 Ga0496116_0035375 Ga0496116_0035375_840_1499 203
358 3300048920 Ga0496117_0001348 Ga0496117_0001348_3042_3659 203
359 3300048920 Ga0496117_0038374 Ga0496117_0038374_394_1008 203
360 3300048920 Ga0496117_0127946 Ga0496117_0127946_617_1276 203
361 3300048921 Ga0496118_0006857 Ga0496118_0006857_3042_3659 203
362 3300048921 Ga0496118_0030476 Ga0496118_0030476_1666_2325 203
363 3300048922 Ga0496119_0018741 Ga0496119_0018741_2184_2801 203
364 3300048922 Ga0496119_0214925 Ga0496119_0214925_54_674 203
365 3300048923 Ga0496120_0002158 Ga0496120_0002158_7412_8029 203
366 3300048924 Ga0496121_0006947 Ga0496121_0006947_11649_12266 203
367 3300048924 Ga0496121_0023875 Ga0496121_0023875_1648_2268 203
368 3300048924 Ga0496121_0380263 Ga0496121_0380263_71_697 203
369 3300048925 Ga0496122_0017511 Ga0496122_0017511_4013_4672 203
370 3300048925 Ga0496122_0026555 Ga0496122_0026555_361_975 203
371 3300048925 Ga0496122_0047623 Ga0496122_0047623_1622_2248 203
372 3300048925 Ga0496122_0087582 Ga0496122_0087582_1135_1752 203
373 3300048926 Ga0496123_0032152 Ga0496123_0032152_2932_3546 203
374 3300048926 Ga0496123_0108401 Ga0496123_0108401_451_1068 203
375 3300048927 Ga0496124_0001939 Ga0496124_0001939_4150_4767 203
376 3300048927 Ga0496124_0029659 Ga0496124_0029659_1275_1889 203
377 3300048927 Ga0496124_0086849 Ga0496124_0086849_576_1190 203
378 3300048927 Ga0496124_0309184 Ga0496124_0309184_442_1059 203
379 3300048928 Ga0496125_0026928 Ga0496125_0026928_4096_4755 203
380 3300048928 Ga0496125_0067618 Ga0496125_0067618_1108_1725 203
381 3300048928 Ga0496125_0330669 Ga0496125_0330669_228_842 203
382 3300048928 Ga0496125_0463543 Ga0496125_0463543_27_641 203
383 3300048929 Ga0496126_0170327 Ga0496126_0170327_221_847 203
384 3300049459 Ga0495678_025779 Ga0495678_025779_879_1493 203
385 3300049460 Ga0495682_0107377 Ga0495682_0107377_10_651 203
386 3300049569 Ga0501032_0119832 Ga0501032_0119832_914_1585 203
387 3300049574 Ga0501038_0252661 Ga0501038_0252661_479_1150 203
388 3300049580 Ga0501046_0048937 Ga0501046_0048937_1275_1946 203
389 3300049581 Ga0501047_0183390 Ga0501047_0183390_776_1393 203
390 3300049589 Ga0501073_0072365 Ga0501073_0072365_825_1496 203
391 3300050490 nmdc:mga03n38_161160_c1 nmdc:mga03n38_161160_c1_504_1121 203
392 3300050496 nmdc:mga07m45_197191_c1 nmdc:mga07m45_197191_c1_353_970 203
393 3300050509 nmdc:mga0qj67_41623_c1 nmdc:mga0qj67_41623_c1_278_913 203
394 3300053079 Ga0500610_0151999 Ga0500610_0151999_184_825 203
395 3300053086 Ga0500578_0081123 Ga0500578_0081123_130_807 203
396 3300053093 Ga0500651_0159431 Ga0500651_0159431_378_1034 203
397 3300053098 Ga0500650_0242307 Ga0500650_0242307_48_689 203
398 3300053105 Ga0500557_130982 Ga0500557_130982_120_761 203
399 3300053109 Ga0500569_058538 Ga0500569_058538_346_987 203
400 3300053118 Ga0500594_0001139 Ga0500594_0001139_1830_2471 203
401 3300053125 Ga0500618_001900 Ga0500618_001900_6299_6916 203
402 3300053125 Ga0500618_016727 Ga0500618_016727_844_1458 203
403 3300053134 Ga0500658_0016492 Ga0500658_0016492_731_1387 203
404 3300053134 Ga0500658_0031787 Ga0500658_0031787_1209_1949 203
405 3300053139 Ga0500568_0003524 Ga0500568_0003524_7690_8346 203
406 3300053146 Ga0500588_0118484 Ga0500588_0118484_35_676 203
407 3300053151 Ga0500604_0016238 Ga0500604_0016238_1275_1931 203
408 3300053153 Ga0500616_0003848 Ga0500616_0003848_2725_3402 203
409 3300053153 Ga0500616_0131809 Ga0500616_0131809_54_671 203
410 3300053156 Ga0500622_0000614 Ga0500622_0000614_13664_14323 203
411 3300053160 Ga0500633_0002647 Ga0500633_0002647_170_826 203
412 3300053177 Ga0500636_0080998 Ga0500636_0080998_865_1482 203
413 3300060353 Ga0501082_0632388 Ga0501082_0632388_156_827 203
414 iso_pu_bacteria 2510917030 2511196111 203
415 iso_pu_bacteria 2515154134 2515740218 203
416 iso_pu_bacteria 2516653085 2517076641 203
417 iso_pu_bacteria 2582581298 2585222704 203
418 iso_pu_bacteria 2585427528 2585537791 203
419 iso_pu_bacteria 2585427529 2585545287 203
420 iso_pu_bacteria 2585427593 2585835741 203
421 iso_pu_bacteria 2791355263 2793341727 203
422 iso_pu_bacteria 2919100787 2919106589 203
423 iso_pu_bacteria 2933570622 2933571810 203
424 iso_pu_bacteria 2935901341 2935905441 203
425 iso_pu_bacteria 3005445848 3005448317 203
426 iso_pu_bacteria 8005307578 8005312409 203
427 iso_pu_bacteria 8005556819 8005557447 203
428 iso_pu_bacteria 8005563573 8005568626 203
429 iso_pu_bacteria 8018163183 8018166537 203
430 iso_pu_bacteria 8023680758 8023685139 203
431 3300002705 JGI25156J39149_1000327 JGI25156J39149_100032724 204
432 3300005329 Ga0070683_100111013 Ga0070683_1001110132 204
433 3300005548 Ga0070665_100592539 Ga0070665_1005925392 204
434 3300025256 Ga0209759_1000052 Ga0209759_1000052135 204
435 3300025302 Ga0207426_1035899 Ga0207426_10358992 204
436 3300028379 Ga0268266_10019290 Ga0268266_100192906 204
437 3300046506 Ga0495583_0022147 Ga0495583_0022147_1223_1837 204
438 3300046660 Ga0495625_0009325 Ga0495625_0009325_5291_5953 204
439 3300048926 Ga0496123_0000335 Ga0496123_0000335_6367_7020 204
440 3300053087 Ga0500643_047859 Ga0500643_047859_435_1097 204
441 3300053104 Ga0500556_0000013 Ga0500556_0000013_230970_231632 204
442 3300053124 Ga0500617_068275 Ga0500617_068275_887_1549 204
443 3300053130 Ga0500642_0000002 Ga0500642_0000002_468520_469182 204
444 3300053156 Ga0500622_0175307 Ga0500622_0175307_246_908 204
445 3300053730 Ga0500645_002578 Ga0500645_002578_4797_5459 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13578

Methyltransf_24

Methyltransferase domain

106

208

0.94

PF01596

Methyltransf_3

O-methyltransferase

78

244

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c9v-assembly1.cif.gz_A-2 o-methyltransferase from desulfuromonas acetoxidans 0.9115 37 204
5zy6-assembly1.cif.gz_A catechol methyltransferase spcomt 0.898 48 203
4pca-assembly1.cif.gz_A x-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sah and manganese 0.8884 47 203
5zy6-assembly2.cif.gz_B catechol methyltransferase spcomt 0.8858 48 203
5fhr-assembly1.cif.gz_B crystal structure of y200l mutant of rat catechol-o-methyltransferase in complex with adomet and 3,5-dinitrocatechol 0.8776 47 185
ID Description Score Start End Superfamily
af_K7N0B7_9_135_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.904 41 156 3.40.50.150
af_A0A0R0IR39_2_192_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9001 45 202 3.40.50.150
af_Q9M266_77_290_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8874 47 204 3.40.50.150
af_F4IAT4_68_291_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8747 45 203 3.40.50.150
4pyjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8721 46 185 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6P0Q6H9-F1-model_v4 deleted 0.9668 58 204
AF-A0A2H0L3A8-F1-model_v4 Methyltransferase 0.9501 46 202 GO:0008171
GO:0032259
AF-A0A842TSK0-F1-model_v4 Methyltransferase domain-containing protein 0.949 46 204 GO:0008171
GO:0032259
AF-A0A1F5AUH4-F1-model_v4 Methyltransferase 0.9475 46 204 GO:0008171
GO:0032259
AF-A0A369X2F7-F1-model_v4 deleted 0.9465 48 204

Feature Viewer

pLDDT pTM Quality
88.39 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map