F445320

General Info

Members Datasets Scaffolds Average Seq Length
444 188 888 201

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0104821|Ga0395899_0104821_971_1606
Length 195
Sequence MGTSVAVRDDTYRGAMRFVDVAGRQVEVHIRRSKRVKGNRIVVRHGLAPELVVRPRASDADIDAALAHYLPWLERQLASACEPKLALDKLNITEAQGRILGVRYRRLTIRDQVSRWGSCSSAGALSFNWRLVLAPHDVLDYVVVHEVCHLVEHHHGPAFWALVAKRRPKYAESKEWLDEHGWEILAYRPPLDAAA

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
71 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
75 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
185 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.85
Metatranscriptomes 3.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.51
Rhizosphere 86.26
Stem 0
Stem Tuber 0
Unclassified 3.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0104821 3300037312 Bacteria 2038
2 rootH1_10055943 3300003316 Bacteria 1099
3 Ga0070658_10227027 3300005327 Bacteria 1580
4 Ga0070658_10294669 3300005327 Bacteria 1383
5 Ga0070658_10312753 3300005327 Bacteria 1340
6 Ga0070658_10727709 3300005327 Bacteria 862
7 Ga0070658_10830708 3300005327 Bacteria 803
8 Ga0070683_100007870 3300005329 Bacteria 9029
9 Ga0070683_100011736 3300005329 Bacteria 7586
10 Ga0070683_100275511 3300005329 Bacteria 1601
11 Ga0070683_100436194 3300005329 Bacteria 1250
12 Ga0070683_100874951 3300005329 Bacteria 862
13 Ga0070680_100005196 3300005336 Bacteria 9853
14 Ga0070680_100020164 3300005336 Bacteria 5290
15 Ga0070680_100102002 3300005336 Bacteria 2382
16 Ga0070682_100156664 3300005337 Bacteria 1569
17 Ga0070660_100002486 3300005339 Bacteria 12647
18 Ga0070660_100002517 3300005339 Bacteria 12559
19 Ga0070660_100070375 3300005339 Bacteria 2730
20 Ga0070660_100076388 3300005339 Bacteria 2624
21 Ga0070660_100115041 3300005339 Bacteria 2144
22 Ga0070660_100285274 3300005339 Bacteria 1351
23 Ga0070661_100021782 3300005344 Bacteria 4583
24 Ga0070661_100048112 3300005344 Bacteria 3121
25 Ga0070674_100211957 3300005356 Bacteria 1502
26 Ga0070659_100025038 3300005366 Bacteria 4580
27 Ga0070714_100021286 3300005435 Bacteria 5305
28 Ga0070714_100252948 3300005435 Bacteria 1630
29 Ga0070710_10063064 3300005437 Bacteria 2116
30 Ga0070710_10411008 3300005437 Bacteria 909
31 Ga0070681_10007863 3300005458 Bacteria 10431
32 Ga0070681_10010706 3300005458 Bacteria 9062
33 Ga0070681_10013095 3300005458 Bacteria 8236
34 Ga0070681_10047414 3300005458 Bacteria 4295
35 Ga0070681_10051784 3300005458 Bacteria 4094
36 Ga0070707_100538216 3300005468 Bacteria 1130
37 Ga0070707_100553069 3300005468 Bacteria 1113
38 Ga0070699_100409199 3300005518 Bacteria 1227
39 Ga0070679_100002705 3300005530 Bacteria 16140
40 Ga0070679_100021855 3300005530 Bacteria 6249
41 Ga0070679_100052420 3300005530 Bacteria 4063
42 Ga0070684_100002119 3300005535 Bacteria 14629
43 Ga0070684_100109864 3300005535 Bacteria 2471
44 Ga0070684_100481598 3300005535 Bacteria 1148
45 Ga0070684_100622943 3300005535 Bacteria 1004
46 Ga0068853_100154124 3300005539 Bacteria 2069
47 Ga0068853_100247529 3300005539 Bacteria 1635
48 Ga0070686_100289901 3300005544 Unclassified 1210
49 Ga0068855_100062809 3300005563 Bacteria 4335
50 Ga0068855_100182466 3300005563 Bacteria 2372
51 Ga0068855_100191107 3300005563 Bacteria 2309
52 Ga0068855_100476809 3300005563 Bacteria 1359
53 Ga0068855_100739856 3300005563 Unclassified 1049
54 Ga0068855_100885674 3300005563 Bacteria 944
55 Ga0070664_100296262 3300005564 Bacteria 1461
56 Ga0068857_100038812 3300005577 Bacteria 4216
57 Ga0068857_100543978 3300005577 Bacteria 1093
58 Ga0068856_100057832 3300005614 Bacteria 3828
59 Ga0068856_100249869 3300005614 Bacteria 1789
60 Ga0068856_100250925 3300005614 Unclassified 1784
61 Ga0068852_100026262 3300005616 Bacteria 4731
62 Ga0068852_101228915 3300005616 Unclassified 770
63 Ga0068858_100068309 3300005842 Bacteria 3293
64 Ga0070717_10471493 3300006028 Bacteria 1133
65 Ga0075434_100185884 3300006871 Bacteria 2098
66 Ga0068865_100441485 3300006881 Bacteria 1074
67 Ga0075436_100328163 3300006914 Bacteria 1100
68 Ga0075435_100192036 3300007076 Bacteria 1729
69 Ga0105240_10034729 3300009093 Bacteria 6501
70 Ga0105240_10333795 3300009093 Bacteria 1724
71 Ga0105240_10405796 3300009093 Bacteria 1534
72 Ga0105240_11166373 3300009093 Unclassified 817
73 Ga0105245_10245656 3300009098 Bacteria 1737
74 Ga0105245_10298199 3300009098 Bacteria 1581
75 Ga0105241_10178074 3300009174 Bacteria 1761
76 Ga0105241_10485832 3300009174 Bacteria 1098
77 Ga0105242_10017968 3300009176 Bacteria 5524
78 Ga0105248_10433388 3300009177 Bacteria 1481
79 Ga0105237_10845020 3300009545 Bacteria 922
80 Ga0105238_10269084 3300009551 Bacteria 1684
81 Ga0157345_1011559 3300012498 Bacteria 785
82 Ga0157370_10002516 3300013104 Bacteria 22041
83 Ga0157370_10093309 3300013104 Bacteria 2825
84 Ga0157369_10002737 3300013105 Bacteria 21049
85 Ga0157369_10093632 3300013105 Bacteria 3207
86 Ga0157369_10103885 3300013105 Bacteria 3027
87 Ga0157369_10239978 3300013105 Bacteria 1893
88 Ga0157369_10378040 3300013105 Bacteria 1470
89 Ga0157369_10956583 3300013105 Bacteria 878
90 Ga0157372_10123001 3300013307 Bacteria 2982
91 Ga0157372_10245882 3300013307 Bacteria 2076
92 Ga0157375_10063317 3300013308 Bacteria 3679
93 Ga0157375_11757286 3300013308 Bacteria 735
94 Ga0197907_10786839 3300020069 Unclassified 693
95 Ga0206356_10437870 3300020070 Bacteria 1347
96 Ga0206356_10957203 3300020070 Bacteria 1086
97 Ga0206356_11517027 3300020070 Bacteria 6573
98 Ga0206356_11912159 3300020070 Bacteria 1281
99 Ga0206354_10066404 3300020081 Bacteria 924
100 Ga0206354_10298155 3300020081 Bacteria 1241
101 Ga0206354_11221948 3300020081 Bacteria 884
102 Ga0206353_10389759 3300020082 Bacteria 1833
103 Ga0206353_10423363 3300020082 Bacteria 10620
104 Ga0206353_10738018 3300020082 Bacteria 6433
105 Ga0206353_10795808 3300020082 Bacteria 2258
106 Ga0206353_11387004 3300020082 Bacteria 1092
107 Ga0224712_10035901 3300022467 Bacteria 1833
108 Ga0207692_10180073 3300025898 Bacteria 1231
109 Ga0207692_10247786 3300025898 Bacteria 1066
110 Ga0207705_10023580 3300025909 Bacteria 4389
111 Ga0207705_10084366 3300025909 Bacteria 2319
112 Ga0207705_10138452 3300025909 Bacteria 1816
113 Ga0207705_10254380 3300025909 Bacteria 1340
114 Ga0207707_10011362 3300025912 Bacteria 7753
115 Ga0207707_10021452 3300025912 Bacteria 5646
116 Ga0207707_10047285 3300025912 Bacteria 3747
117 Ga0207707_10064999 3300025912 Bacteria 3177
118 Ga0207707_10350658 3300025912 Bacteria 1272
119 Ga0207695_10168214 3300025913 Bacteria 2119
120 Ga0207695_10200782 3300025913 Bacteria 1908
121 Ga0207671_10617110 3300025914 Bacteria 864
122 Ga0207660_10052456 3300025917 Bacteria 2903
123 Ga0207660_10068473 3300025917 Bacteria 2574
124 Ga0207660_10132377 3300025917 Bacteria 1899
125 Ga0207657_10001654 3300025919 Bacteria 24052
126 Ga0207657_10006020 3300025919 Bacteria 12619
127 Ga0207657_10007555 3300025919 Bacteria 11142
128 Ga0207657_10186286 3300025919 Bacteria 1676
129 Ga0207657_10838380 3300025919 Unclassified 710
130 Ga0207649_10010012 3300025920 Bacteria 5199
131 Ga0207649_10102859 3300025920 Bacteria 1894
132 Ga0207652_10028324 3300025921 Bacteria 4674
133 Ga0207652_10131188 3300025921 Bacteria 2235
134 Ga0207652_10183629 3300025921 Bacteria 1880
135 Ga0207687_10073034 3300025927 Bacteria 2455
136 Ga0207687_10203159 3300025927 Bacteria 1550
137 Ga0207690_10032204 3300025932 Bacteria 3362
138 Ga0207690_10090839 3300025932 Bacteria 2157
139 Ga0207661_10028286 3300025944 Bacteria 4291
140 Ga0207661_10050325 3300025944 Bacteria 3319
141 Ga0207667_10014549 3300025949 Bacteria 8964
142 Ga0207667_10022297 3300025949 Bacteria 6999
143 Ga0207667_10099015 3300025949 Bacteria 3008
144 Ga0207667_10578698 3300025949 Bacteria 1134
145 Ga0207658_10010190 3300025986 Bacteria 6388
146 Ga0207703_10128521 3300026035 Bacteria 2185
147 Ga0207639_10319300 3300026041 Bacteria 1378
148 Ga0207702_10204210 3300026078 Bacteria 1834
149 Ga0207702_10222602 3300026078 Bacteria 1759
150 Ga0207674_10073248 3300026116 Bacteria 3438
151 Ga0207683_10178967 3300026121 Bacteria 1922
152 Ga0207683_10579552 3300026121 Bacteria 1038
153 Ga0207698_10859542 3300026142 Unclassified 912
154 Ga0265334_10086498 3300028573 Bacteria 1149
155 Ga0265318_10028459 3300028577 Bacteria 2186
156 Ga0265318_10122439 3300028577 Bacteria 956
157 Ga0265322_10016808 3300028654 Bacteria 2110
158 Ga0265336_10076136 3300028666 Bacteria 1002
159 Ga0265338_10015169 3300028800 Bacteria 8494
160 Ga0265338_10112979 3300028800 Bacteria 2183
161 Ga0265324_10028417 3300029957 Bacteria 1973
162 Ga0265332_10237679 3300031238 Bacteria 754
163 Ga0265328_10019283 3300031239 Bacteria 2622
164 Ga0265325_10010608 3300031241 Bacteria 5326
165 Ga0265340_10020266 3300031247 Bacteria 3420
166 Ga0265331_10016815 3300031250 Bacteria 3831
167 Ga0265327_10010910 3300031251 Bacteria 6324
168 Ga0265327_10100094 3300031251 Bacteria 1400
169 Ga0265316_10014401 3300031344 Bacteria 6963
170 Ga0265313_10002188 3300031595 Bacteria 17292
171 Ga0265313_10078956 3300031595 Bacteria 1499
172 Ga0265314_10003467 3300031711 Bacteria 15234
173 Ga0265314_10300000 3300031711 Unclassified 902
174 Ga0307405_10021701 3300031731 Bacteria 3615
175 Ga0307412_10394723 3300031911 Bacteria 1124
176 Ga0307416_100100844 3300032002 Bacteria 2512
177 Ga0373944_0012172 3300035089 Bacteria 2367
178 Ga0373944_0045589 3300035089 Bacteria 1368
179 Ga0373936_0039920 3300035113 Bacteria 1879
180 Ga0373936_0116107 3300035113 Bacteria 1140
181 Ga0373945_0026867 3300035116 Bacteria 2007
182 Ga0373956_0340481 3300035119 Unclassified 715
183 Ga0373943_0001097 3300035170 Bacteria 12064
184 Ga0373946_0003443 3300035171 Bacteria 5618
185 Ga0373955_0233740 3300035172 Bacteria 1100
186 Ga0373935_0001485 3300035692 Bacteria 13029
187 Ga0373927_0018529 3300035695 Bacteria 4572
188 Ga0373927_0434538 3300035695 Bacteria 867
189 Ga0373947_0000716 3300035725 Bacteria 19733
190 Ga0373937_0230467 3300036401 Bacteria 1744
191 Ga0373937_0552140 3300036401 Bacteria 1094
192 Ga0373925_0004218 3300037068 Bacteria 10914
193 Ga0395899_0012574 3300037312 Bacteria 6487
194 Ga0395899_0212931 3300037312 Bacteria 1342
195 Ga0395899_0581471 3300037312 Bacteria 716
196 Ga0395900_0005758 3300037418 Bacteria 12951
197 Ga0395900_0037288 3300037418 Bacteria 5013
198 Ga0395900_0059518 3300037418 Bacteria 3932
199 Ga0395900_0218307 3300037418 Bacteria 1923
200 Ga0395900_0330560 3300037418 Bacteria 1502
201 Ga0395898_0000824 3300037466 Bacteria 51781
202 Ga0395898_0016056 3300037466 Bacteria 7670
203 Ga0395898_0057074 3300037466 Bacteria 3805
204 Ga0395898_0064691 3300037466 Bacteria 3547
205 Ga0395898_0182393 3300037466 Bacteria 2006
206 Ga0395898_0235287 3300037466 Bacteria 1747
207 Ga0395898_0614348 3300037466 Bacteria 1030
208 Ga0395898_0772393 3300037466 Bacteria 902
209 Ga0395898_0844545 3300037466 Bacteria 855
210 Ga0395905_0012823 3300037471 Bacteria 8059
211 Ga0395905_0016484 3300037471 Bacteria 7025
212 Ga0395905_0290269 3300037471 Bacteria 1522
213 Ga0395905_1056120 3300037471 Bacteria 715
214 Ga0395901_0000244 3300038443 Bacteria 67684
215 Ga0395901_0001584 3300038443 Bacteria 23533
216 Ga0395901_0012213 3300038443 Bacteria 8716
217 Ga0395901_0012503 3300038443 Bacteria 8614
218 Ga0395901_0023269 3300038443 Bacteria 6351
219 Ga0395901_0039586 3300038443 Bacteria 4879
220 Ga0395901_0248024 3300038443 Bacteria 1856
221 Ga0395901_0260178 3300038443 Bacteria 1806
222 Ga0395901_0322374 3300038443 Bacteria 1598
223 Ga0466969_0106355 3300044656 Bacteria 1317
224 Ga0466965_0093781 3300044683 Bacteria 1529
225 Ga0466966_0013313 3300044684 Bacteria 5445
226 Ga0466961_0001160 3300044693 Bacteria 16206
227 Ga0466961_0005119 3300044693 Bacteria 8251
228 Ga0466961_0053131 3300044693 Bacteria 2586
229 Ga0466961_0247352 3300044693 Bacteria 1095
230 Ga0466963_0006398 3300044694 Bacteria 6966
231 Ga0466963_0014359 3300044694 Bacteria 4882
232 Ga0466963_0032261 3300044694 Bacteria 3391
233 Ga0466963_0128075 3300044694 Bacteria 1751
234 Ga0466963_0206328 3300044694 Bacteria 1374
235 Ga0466964_0020958 3300044706 Bacteria 2523
236 Ga0466964_0039396 3300044706 Bacteria 1904
237 Ga0466964_0048976 3300044706 Bacteria 1729
238 Ga0466964_0154128 3300044706 Bacteria 1068
239 Ga0466971_0000719 3300044719 Bacteria 13240
240 Ga0466971_0159534 3300044719 Bacteria 1055
241 Ga0466968_0005368 3300044735 Bacteria 4797
242 Ga0466968_0212464 3300044735 Bacteria 909
243 Ga0466957_0002461 3300044842 Bacteria 9945
244 Ga0466957_0257722 3300044842 Bacteria 1161
245 Ga0466957_0321612 3300044842 Bacteria 1044
246 Ga0466959_0001752 3300045049 Bacteria 13523
247 Ga0466959_0079354 3300045049 Bacteria 2367
248 Ga0466959_0196843 3300045049 Bacteria 1404
249 Ga0466959_0260247 3300045049 Bacteria 1194
250 Ga0466959_0427283 3300045049 Bacteria 899
251 Ga0466958_0013252 3300045836 Bacteria 4691
252 Ga0466958_0026471 3300045836 Bacteria 3428
253 Ga0466958_0067871 3300045836 Bacteria 2179
254 Ga0466958_0201186 3300045836 Bacteria 1267
255 Ga0466958_0459543 3300045836 Bacteria 825
256 Ga0466967_0007181 3300045976 Bacteria 8002
257 Ga0466967_0019107 3300045976 Bacteria 5501
258 Ga0466967_0020913 3300045976 Bacteria 5302
259 Ga0466967_0030659 3300045976 Bacteria 4515
260 Ga0466967_0034431 3300045976 Bacteria 4299
261 Ga0466967_0064648 3300045976 Bacteria 3254
262 Ga0466967_0086829 3300045976 Bacteria 2835
263 Ga0466967_0109808 3300045976 Bacteria 2532
264 Ga0466967_0119226 3300045976 Bacteria 2435
265 Ga0466967_0219295 3300045976 Bacteria 1807
266 Ga0466967_0243723 3300045976 Bacteria 1715
267 Ga0466967_0363295 3300045976 Bacteria 1403
268 Ga0466967_0364585 3300045976 Bacteria 1400
269 Ga0466967_0385711 3300045976 Bacteria 1361
270 Ga0466967_0452092 3300045976 Bacteria 1255
271 Ga0466967_0811171 3300045976 Bacteria 929
272 Ga0466967_1286506 3300045976 Bacteria 728
273 Ga0466967_1317085 3300045976 Unclassified 719
274 Ga0466967_1363646 3300045976 Bacteria 706
275 Ga0495592_0014829 3300046454 Bacteria 5917
276 Ga0495592_0377404 3300046454 Bacteria 903
277 Ga0495629_0022886 3300046459 Bacteria 4453
278 Ga0495629_0340101 3300046459 Bacteria 1025
279 Ga0495641_0004541 3300046461 Bacteria 9752
280 Ga0495641_0062804 3300046461 Bacteria 1675
281 Ga0495653_0074921 3300046463 Bacteria 2520
282 Ga0495582_0000276 3300046473 Bacteria 28706
283 Ga0495582_0154612 3300046473 Bacteria 1303
284 Ga0495582_0298974 3300046473 Unclassified 925
285 Ga0495605_0033673 3300046474 Bacteria 2599
286 Ga0495639_0000416 3300046475 Bacteria 20358
287 Ga0495662_0117952 3300046476 Unclassified 1302
288 Ga0495664_0024484 3300046477 Bacteria 3509
289 Ga0495594_0124889 3300046499 Bacteria 1456
290 Ga0495608_0018765 3300046511 Bacteria 4766
291 Ga0495608_0097705 3300046511 Bacteria 1895
292 Ga0495618_0019225 3300046514 Bacteria 4201
293 Ga0495618_0093109 3300046514 Bacteria 1927
294 Ga0495628_0122229 3300046516 Bacteria 1996
295 Ga0495630_0001315 3300046517 Bacteria 17081
296 Ga0495630_0094177 3300046517 Bacteria 2264
297 Ga0495666_0011008 3300046526 Bacteria 4513
298 Ga0495652_0211688 3300046529 Bacteria 1463
299 Ga0495665_0006870 3300046531 Bacteria 6141
300 Ga0495640_0004359 3300046533 Bacteria 11296
301 Ga0495640_0025119 3300046533 Bacteria 4327
302 Ga0495640_0339502 3300046533 Archaea 928
303 Ga0495587_0055112 3300046536 Bacteria 2342
304 Ga0495645_0067857 3300046543 Bacteria 2575
305 Ga0495645_0196592 3300046543 Bacteria 1371
306 Ga0495645_0248599 3300046543 Bacteria 1183
307 Ga0495645_0303833 3300046543 Bacteria 1041
308 Ga0495667_0001711 3300046559 Bacteria 14566
309 Ga0495667_0027735 3300046559 Bacteria 3813
310 Ga0495667_0058101 3300046559 Bacteria 2541
311 Ga0495667_0161583 3300046559 Bacteria 1441
312 Ga0495634_0027309 3300046642 Bacteria 3972
313 Ga0495634_0143021 3300046642 Bacteria 1517
314 Ga0495635_0003672 3300046663 Bacteria 10640
315 Ga0495635_0261608 3300046663 Bacteria 1165
316 Ga0495657_0023161 3300046675 Bacteria 4441
317 Ga0495657_0041940 3300046675 Bacteria 3128
318 Ga0495599_0088632 3300046678 Archaea 1932
319 Ga0495599_0104814 3300046678 Bacteria 1761
320 Ga0495623_0336644 3300046679 Unclassified 825
321 Ga0495646_0110162 3300046680 Bacteria 1569
322 Ga0495647_0012677 3300046681 Bacteria 2907
323 Ga0495658_0002918 3300046683 Bacteria 8581
324 Ga0495613_0030231 3300046689 Bacteria 4023
325 Ga0495613_0115198 3300046689 Bacteria 1934
326 Ga0495624_0004610 3300046690 Bacteria 10051
327 Ga0495600_0253402 3300046809 Bacteria 1119
328 Ga0495581_0127948 3300047315 Bacteria 1479
329 Ga0495604_0032035 3300047317 Bacteria 4168
330 Ga0495604_0043771 3300047317 Bacteria 3503
331 Ga0495604_0121781 3300047317 Bacteria 1887
332 Ga0495604_0200975 3300047317 Bacteria 1383
333 Ga0495674_0002208 3300047319 Bacteria 19139
334 Ga0495674_0019693 3300047319 Bacteria 6259
335 Ga0495674_0065238 3300047319 Bacteria 3163
336 Ga0495674_0091539 3300047319 Bacteria 2597
337 Ga0495674_0112165 3300047319 Bacteria 2311
338 Ga0495676_0011130 3300047321 Bacteria 8129
339 Ga0495676_0625690 3300047321 Bacteria 700
340 Ga0495680_0008719 3300047322 Bacteria 9189
341 Ga0495680_0022177 3300047322 Bacteria 5300
342 Ga0495680_0031251 3300047322 Bacteria 4336
343 Ga0495680_0193416 3300047322 Bacteria 1463
344 Ga0495675_0197718 3300047444 Bacteria 1225
345 Ga0495675_0235115 3300047444 Bacteria 1105
346 Ga0495684_0020683 3300047471 Bacteria 5070
347 Ga0495684_0027345 3300047471 Bacteria 4379
348 Ga0495684_0051531 3300047471 Bacteria 3141
349 Ga0495684_0055561 3300047471 Bacteria 3020
350 Ga0495593_0034682 3300047673 Bacteria 2743
351 Ga0495602_0060930 3300048088 Bacteria 3285
352 Ga0495602_0262059 3300048088 Bacteria 1282
353 Ga0495614_0066503 3300048089 Bacteria 1550
354 Ga0496100_0000981 3300048903 Bacteria 13718
355 Ga0496100_0024429 3300048903 Bacteria 3686
356 Ga0496100_0050645 3300048903 Bacteria 2692
357 Ga0496100_0068823 3300048903 Bacteria 2355
358 Ga0496100_0495163 3300048903 Archaea 941
359 Ga0496101_0000424 3300048904 Bacteria 27117
360 Ga0496101_0005250 3300048904 Bacteria 8243
361 Ga0496101_0006459 3300048904 Bacteria 7546
362 Ga0496101_0050271 3300048904 Bacteria 3000
363 Ga0496101_0200953 3300048904 Archaea 1541
364 Ga0496102_0003088 3300048905 Bacteria 14109
365 Ga0496102_0212001 3300048905 Bacteria 1826
366 Ga0496103_0030574 3300048906 Bacteria 3278
367 Ga0496103_0045083 3300048906 Bacteria 2720
368 Ga0496103_0130568 3300048906 Bacteria 1604
369 Ga0496103_0355818 3300048906 Bacteria 941
370 Ga0496104_0011326 3300048907 Bacteria 7984
371 Ga0496104_0016611 3300048907 Bacteria 6688
372 Ga0496104_0217477 3300048907 Bacteria 1823
373 Ga0496105_0000597 3300048908 Bacteria 24061
374 Ga0496105_0118577 3300048908 Bacteria 2183
375 Ga0496105_0329456 3300048908 Bacteria 1222
376 Ga0496106_0019642 3300048909 Bacteria 5012
377 Ga0496106_0042154 3300048909 Bacteria 3422
378 Ga0496106_0127229 3300048909 Bacteria 1996
379 Ga0496107_0009074 3300048910 Bacteria 6895
380 Ga0496107_0024576 3300048910 Bacteria 4262
381 Ga0496107_0046298 3300048910 Bacteria 3131
382 Ga0496107_0729259 3300048910 Bacteria 728
383 Ga0496108_0010971 3300048911 Bacteria 7358
384 Ga0496108_0131752 3300048911 Bacteria 2149
385 Ga0496109_0001453 3300048912 Bacteria 19631
386 Ga0496109_0009128 3300048912 Bacteria 8443
387 Ga0496109_0340993 3300048912 Bacteria 1415
388 Ga0496109_0457293 3300048912 Bacteria 1206
389 Ga0496109_0831186 3300048912 Bacteria 862
390 Ga0496110_0006795 3300048913 Bacteria 9099
391 Ga0496110_0042505 3300048913 Bacteria 3967
392 Ga0496110_0339962 3300048913 Bacteria 1367
393 Ga0496111_0084592 3300048914 Bacteria 2319
394 Ga0496111_0140691 3300048914 Bacteria 1788
395 Ga0496111_0351838 3300048914 Bacteria 1090
396 Ga0496112_0005576 3300048915 Bacteria 10912
397 Ga0496112_0035473 3300048915 Bacteria 4859
398 Ga0496112_0056444 3300048915 Bacteria 3864
399 Ga0496112_0153867 3300048915 Bacteria 2267
400 Ga0496112_0272498 3300048915 Bacteria 1641
401 Ga0496114_0000392 3300048917 Bacteria 32304
402 Ga0496114_0001985 3300048917 Bacteria 15563
403 Ga0496114_0002716 3300048917 Bacteria 13516
404 Ga0496114_0079103 3300048917 Bacteria 2774
405 Ga0496114_0178354 3300048917 Bacteria 1854
406 Ga0496114_0231548 3300048917 Bacteria 1623
407 Ga0496114_1144058 3300048917 Bacteria 664
408 Ga0496115_0001999 3300048918 Bacteria 14573
409 Ga0496115_0003805 3300048918 Bacteria 10865
410 Ga0496115_0045773 3300048918 Bacteria 3494
411 Ga0496115_0165017 3300048918 Bacteria 1831
412 Ga0496115_0282780 3300048918 Bacteria 1362
413 Ga0496115_0983314 3300048918 Unclassified 646
414 Ga0501034_0229961 3300049571 Bacteria 1804
415 Ga0501043_0103776 3300049579 Bacteria 2234
416 Ga0501047_0046252 3300049581 Bacteria 4206
417 Ga0501067_0006177 3300049583 Bacteria 6641
418 Ga0501067_0240265 3300049583 Bacteria 1008
419 Ga0501069_0085602 3300049585 Bacteria 1779
420 Ga0501069_0179887 3300049585 Bacteria 1222
421 Ga0501070_0044089 3300049586 Bacteria 3711
422 Ga0501070_0177362 3300049586 Bacteria 1754
423 Ga0501070_0236090 3300049586 Bacteria 1497
424 Ga0501070_0312409 3300049586 Bacteria 1279
425 Ga0501074_0088060 3300049590 Bacteria 2224
426 Ga0501074_0121624 3300049590 Bacteria 1867
427 Ga0501074_0189303 3300049590 Bacteria 1467
428 Ga0501080_0208582 3300049742 Bacteria 1791
429 Ga0501080_0242122 3300049742 Bacteria 1646
430 nmdc:mga0n895_9121_c1 3300050512 Bacteria 8658
431 nmdc:mga0rr50_217363_c1 3300050513 Bacteria 1577
432 nmdc:mga0a205_82771_c1 3300050515 Bacteria 3100
433 Ga0495601_0059864 3300053077 Bacteria 2416
434 Ga0495601_0101215 3300053077 Bacteria 1861
435 Ga0495612_0051230 3300053078 Bacteria 1696
436 Ga0495655_0007303 3300053083 Bacteria 2047
437 Ga0495595_0075897 3300053084 Bacteria 1595
438 Ga0495619_0003843 3300053085 Bacteria 9668
439 Ga0495619_0005855 3300053085 Bacteria 7790
440 Ga0495619_0031762 3300053085 Bacteria 3423
441 Ga0495619_0079456 3300053085 Bacteria 2206
442 Ga0501082_1217628 3300060353 Bacteria 658
443 Ga0466962_0000254 3300061719 Bacteria 22544
444 Ga0466962_0122537 3300061719 Bacteria 1255
445 Ga0395899_0104821
446 rootH1_10055943
447 Ga0070658_10227027
448 Ga0070658_10294669
449 Ga0070658_10312753
450 Ga0070658_10727709
451 Ga0070658_10830708
452 Ga0070683_100007870
453 Ga0070683_100011736
454 Ga0070683_100275511
455 Ga0070683_100436194
456 Ga0070683_100874951
457 Ga0070680_100005196
458 Ga0070680_100020164
459 Ga0070680_100102002
460 Ga0070682_100156664
461 Ga0070660_100002486
462 Ga0070660_100002517
463 Ga0070660_100070375
464 Ga0070660_100076388
465 Ga0070660_100115041
466 Ga0070660_100285274
467 Ga0070661_100021782
468 Ga0070661_100048112
469 Ga0070674_100211957
470 Ga0070659_100025038
471 Ga0070714_100021286
472 Ga0070714_100252948
473 Ga0070710_10063064
474 Ga0070710_10411008
475 Ga0070681_10007863
476 Ga0070681_10010706
477 Ga0070681_10013095
478 Ga0070681_10047414
479 Ga0070681_10051784
480 Ga0070707_100538216
481 Ga0070707_100553069
482 Ga0070699_100409199
483 Ga0070679_100002705
484 Ga0070679_100021855
485 Ga0070679_100052420
486 Ga0070684_100002119
487 Ga0070684_100109864
488 Ga0070684_100481598
489 Ga0070684_100622943
490 Ga0068853_100154124
491 Ga0068853_100247529
492 Ga0070686_100289901
493 Ga0068855_100062809
494 Ga0068855_100182466
495 Ga0068855_100191107
496 Ga0068855_100476809
497 Ga0068855_100739856
498 Ga0068855_100885674
499 Ga0070664_100296262
500 Ga0068857_100038812
501 Ga0068857_100543978
502 Ga0068856_100057832
503 Ga0068856_100249869
504 Ga0068856_100250925
505 Ga0068852_100026262
506 Ga0068852_101228915
507 Ga0068858_100068309
508 Ga0070717_10471493
509 Ga0075434_100185884
510 Ga0068865_100441485
511 Ga0075436_100328163
512 Ga0075435_100192036
513 Ga0105240_10034729
514 Ga0105240_10333795
515 Ga0105240_10405796
516 Ga0105240_11166373
517 Ga0105245_10245656
518 Ga0105245_10298199
519 Ga0105241_10178074
520 Ga0105241_10485832
521 Ga0105242_10017968
522 Ga0105248_10433388
523 Ga0105237_10845020
524 Ga0105238_10269084
525 Ga0157345_1011559
526 Ga0157370_10002516
527 Ga0157370_10093309
528 Ga0157369_10002737
529 Ga0157369_10093632
530 Ga0157369_10103885
531 Ga0157369_10239978
532 Ga0157369_10378040
533 Ga0157369_10956583
534 Ga0157372_10123001
535 Ga0157372_10245882
536 Ga0157375_10063317
537 Ga0157375_11757286
538 Ga0197907_10786839
539 Ga0206356_10437870
540 Ga0206356_10957203
541 Ga0206356_11517027
542 Ga0206356_11912159
543 Ga0206354_10066404
544 Ga0206354_10298155
545 Ga0206354_11221948
546 Ga0206353_10389759
547 Ga0206353_10423363
548 Ga0206353_10738018
549 Ga0206353_10795808
550 Ga0206353_11387004
551 Ga0224712_10035901
552 Ga0207692_10180073
553 Ga0207692_10247786
554 Ga0207705_10023580
555 Ga0207705_10084366
556 Ga0207705_10138452
557 Ga0207705_10254380
558 Ga0207707_10011362
559 Ga0207707_10021452
560 Ga0207707_10047285
561 Ga0207707_10064999
562 Ga0207707_10350658
563 Ga0207695_10168214
564 Ga0207695_10200782
565 Ga0207671_10617110
566 Ga0207660_10052456
567 Ga0207660_10068473
568 Ga0207660_10132377
569 Ga0207657_10001654
570 Ga0207657_10006020
571 Ga0207657_10007555
572 Ga0207657_10186286
573 Ga0207657_10838380
574 Ga0207649_10010012
575 Ga0207649_10102859
576 Ga0207652_10028324
577 Ga0207652_10131188
578 Ga0207652_10183629
579 Ga0207687_10073034
580 Ga0207687_10203159
581 Ga0207690_10032204
582 Ga0207690_10090839
583 Ga0207661_10028286
584 Ga0207661_10050325
585 Ga0207667_10014549
586 Ga0207667_10022297
587 Ga0207667_10099015
588 Ga0207667_10578698
589 Ga0207658_10010190
590 Ga0207703_10128521
591 Ga0207639_10319300
592 Ga0207702_10204210
593 Ga0207702_10222602
594 Ga0207674_10073248
595 Ga0207683_10178967
596 Ga0207683_10579552
597 Ga0207698_10859542
598 Ga0265334_10086498
599 Ga0265318_10028459
600 Ga0265318_10122439
601 Ga0265322_10016808
602 Ga0265336_10076136
603 Ga0265338_10015169
604 Ga0265338_10112979
605 Ga0265324_10028417
606 Ga0265332_10237679
607 Ga0265328_10019283
608 Ga0265325_10010608
609 Ga0265340_10020266
610 Ga0265331_10016815
611 Ga0265327_10010910
612 Ga0265327_10100094
613 Ga0265316_10014401
614 Ga0265313_10002188
615 Ga0265313_10078956
616 Ga0265314_10003467
617 Ga0265314_10300000
618 Ga0307405_10021701
619 Ga0307412_10394723
620 Ga0307416_100100844
621 Ga0373944_0012172
622 Ga0373944_0045589
623 Ga0373936_0039920
624 Ga0373936_0116107
625 Ga0373945_0026867
626 Ga0373956_0340481
627 Ga0373943_0001097
628 Ga0373946_0003443
629 Ga0373955_0233740
630 Ga0373935_0001485
631 Ga0373927_0018529
632 Ga0373927_0434538
633 Ga0373947_0000716
634 Ga0373937_0230467
635 Ga0373937_0552140
636 Ga0373925_0004218
637 Ga0395899_0012574
638 Ga0395899_0212931
639 Ga0395899_0581471
640 Ga0395900_0005758
641 Ga0395900_0037288
642 Ga0395900_0059518
643 Ga0395900_0218307
644 Ga0395900_0330560
645 Ga0395898_0000824
646 Ga0395898_0016056
647 Ga0395898_0057074
648 Ga0395898_0064691
649 Ga0395898_0182393
650 Ga0395898_0235287
651 Ga0395898_0614348
652 Ga0395898_0772393
653 Ga0395898_0844545
654 Ga0395905_0012823
655 Ga0395905_0016484
656 Ga0395905_0290269
657 Ga0395905_1056120
658 Ga0395901_0000244
659 Ga0395901_0001584
660 Ga0395901_0012213
661 Ga0395901_0012503
662 Ga0395901_0023269
663 Ga0395901_0039586
664 Ga0395901_0248024
665 Ga0395901_0260178
666 Ga0395901_0322374
667 Ga0466969_0106355
668 Ga0466965_0093781
669 Ga0466966_0013313
670 Ga0466961_0001160
671 Ga0466961_0005119
672 Ga0466961_0053131
673 Ga0466961_0247352
674 Ga0466963_0006398
675 Ga0466963_0014359
676 Ga0466963_0032261
677 Ga0466963_0128075
678 Ga0466963_0206328
679 Ga0466964_0020958
680 Ga0466964_0039396
681 Ga0466964_0048976
682 Ga0466964_0154128
683 Ga0466971_0000719
684 Ga0466971_0159534
685 Ga0466968_0005368
686 Ga0466968_0212464
687 Ga0466957_0002461
688 Ga0466957_0257722
689 Ga0466957_0321612
690 Ga0466959_0001752
691 Ga0466959_0079354
692 Ga0466959_0196843
693 Ga0466959_0260247
694 Ga0466959_0427283
695 Ga0466958_0013252
696 Ga0466958_0026471
697 Ga0466958_0067871
698 Ga0466958_0201186
699 Ga0466958_0459543
700 Ga0466967_0007181
701 Ga0466967_0019107
702 Ga0466967_0020913
703 Ga0466967_0030659
704 Ga0466967_0034431
705 Ga0466967_0064648
706 Ga0466967_0086829
707 Ga0466967_0109808
708 Ga0466967_0119226
709 Ga0466967_0219295
710 Ga0466967_0243723
711 Ga0466967_0363295
712 Ga0466967_0364585
713 Ga0466967_0385711
714 Ga0466967_0452092
715 Ga0466967_0811171
716 Ga0466967_1286506
717 Ga0466967_1317085
718 Ga0466967_1363646
719 Ga0495592_0014829
720 Ga0495592_0377404
721 Ga0495629_0022886
722 Ga0495629_0340101
723 Ga0495641_0004541
724 Ga0495641_0062804
725 Ga0495653_0074921
726 Ga0495582_0000276
727 Ga0495582_0154612
728 Ga0495582_0298974
729 Ga0495605_0033673
730 Ga0495639_0000416
731 Ga0495662_0117952
732 Ga0495664_0024484
733 Ga0495594_0124889
734 Ga0495608_0018765
735 Ga0495608_0097705
736 Ga0495618_0019225
737 Ga0495618_0093109
738 Ga0495628_0122229
739 Ga0495630_0001315
740 Ga0495630_0094177
741 Ga0495666_0011008
742 Ga0495652_0211688
743 Ga0495665_0006870
744 Ga0495640_0004359
745 Ga0495640_0025119
746 Ga0495640_0339502
747 Ga0495587_0055112
748 Ga0495645_0067857
749 Ga0495645_0196592
750 Ga0495645_0248599
751 Ga0495645_0303833
752 Ga0495667_0001711
753 Ga0495667_0027735
754 Ga0495667_0058101
755 Ga0495667_0161583
756 Ga0495634_0027309
757 Ga0495634_0143021
758 Ga0495635_0003672
759 Ga0495635_0261608
760 Ga0495657_0023161
761 Ga0495657_0041940
762 Ga0495599_0088632
763 Ga0495599_0104814
764 Ga0495623_0336644
765 Ga0495646_0110162
766 Ga0495647_0012677
767 Ga0495658_0002918
768 Ga0495613_0030231
769 Ga0495613_0115198
770 Ga0495624_0004610
771 Ga0495600_0253402
772 Ga0495581_0127948
773 Ga0495604_0032035
774 Ga0495604_0043771
775 Ga0495604_0121781
776 Ga0495604_0200975
777 Ga0495674_0002208
778 Ga0495674_0019693
779 Ga0495674_0065238
780 Ga0495674_0091539
781 Ga0495674_0112165
782 Ga0495676_0011130
783 Ga0495676_0625690
784 Ga0495680_0008719
785 Ga0495680_0022177
786 Ga0495680_0031251
787 Ga0495680_0193416
788 Ga0495675_0197718
789 Ga0495675_0235115
790 Ga0495684_0020683
791 Ga0495684_0027345
792 Ga0495684_0051531
793 Ga0495684_0055561
794 Ga0495593_0034682
795 Ga0495602_0060930
796 Ga0495602_0262059
797 Ga0495614_0066503
798 Ga0496100_0000981
799 Ga0496100_0024429
800 Ga0496100_0050645
801 Ga0496100_0068823
802 Ga0496100_0495163
803 Ga0496101_0000424
804 Ga0496101_0005250
805 Ga0496101_0006459
806 Ga0496101_0050271
807 Ga0496101_0200953
808 Ga0496102_0003088
809 Ga0496102_0212001
810 Ga0496103_0030574
811 Ga0496103_0045083
812 Ga0496103_0130568
813 Ga0496103_0355818
814 Ga0496104_0011326
815 Ga0496104_0016611
816 Ga0496104_0217477
817 Ga0496105_0000597
818 Ga0496105_0118577
819 Ga0496105_0329456
820 Ga0496106_0019642
821 Ga0496106_0042154
822 Ga0496106_0127229
823 Ga0496107_0009074
824 Ga0496107_0024576
825 Ga0496107_0046298
826 Ga0496107_0729259
827 Ga0496108_0010971
828 Ga0496108_0131752
829 Ga0496109_0001453
830 Ga0496109_0009128
831 Ga0496109_0340993
832 Ga0496109_0457293
833 Ga0496109_0831186
834 Ga0496110_0006795
835 Ga0496110_0042505
836 Ga0496110_0339962
837 Ga0496111_0084592
838 Ga0496111_0140691
839 Ga0496111_0351838
840 Ga0496112_0005576
841 Ga0496112_0035473
842 Ga0496112_0056444
843 Ga0496112_0153867
844 Ga0496112_0272498
845 Ga0496114_0000392
846 Ga0496114_0001985
847 Ga0496114_0002716
848 Ga0496114_0079103
849 Ga0496114_0178354
850 Ga0496114_0231548
851 Ga0496114_1144058
852 Ga0496115_0001999
853 Ga0496115_0003805
854 Ga0496115_0045773
855 Ga0496115_0165017
856 Ga0496115_0282780
857 Ga0496115_0983314
858 Ga0501034_0229961
859 Ga0501043_0103776
860 Ga0501047_0046252
861 Ga0501067_0006177
862 Ga0501067_0240265
863 Ga0501069_0085602
864 Ga0501069_0179887
865 Ga0501070_0044089
866 Ga0501070_0177362
867 Ga0501070_0236090
868 Ga0501070_0312409
869 Ga0501074_0088060
870 Ga0501074_0121624
871 Ga0501074_0189303
872 Ga0501080_0208582
873 Ga0501080_0242122
874 nmdc:mga0n895_9121_c1
875 nmdc:mga0rr50_217363_c1
876 nmdc:mga0a205_82771_c1
877 Ga0495601_0059864
878 Ga0495601_0101215
879 Ga0495612_0051230
880 Ga0495655_0007303
881 Ga0495595_0075897
882 Ga0495619_0003843
883 Ga0495619_0005855
884 Ga0495619_0031762
885 Ga0495619_0079456
886 Ga0501082_1217628
887 Ga0466962_0000254
888 Ga0466962_0122537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01863

YgjP-like

YgjP-like, metallopeptidase domain

21

180

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qhi-assembly2.cif.gz_C crystal structure of methanocaldococcus jannaschii selecase mutant r36w 0.8404 84 181
4jix-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin 0.8313 86 177
4jiu-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of pyrococcus abyssi abylysin 0.8158 87 177
4jix-assembly1.cif.gz_B crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin 0.7987 87 177
4qhi-assembly2.cif.gz_C crystal structure of methanocaldococcus jannaschii selecase mutant r36w 0.7785 84 181
ID Description Score Start End Superfamily
4qhiC00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8404 84 181 3.30.2010.10
4jiuA00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8158 87 177 3.30.2010.10
4jixB00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7987 87 177 3.30.2010.10
4qhiC00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7785 84 181 3.30.2010.10
af_P66948_73_150_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7727 85 151 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A529SK86-F1-model_v4 M48 family metallopeptidase 0.9908 77 184
AF-H0E525-F1-model_v4 YgjP-like metallopeptidase domain-containing protein 0.9891 76 183
AF-A0A3B0SQ04-F1-model_v4 Zinc metalloprotease 0.9885 82 183 GO:0006508
GO:0008237
AF-A0A7C3W0S0-F1-model_v4 M48 family peptidase 0.9826 79 186
AF-A0A3D5RNP4-F1-model_v4 YgjP-like metallopeptidase domain-containing protein 0.9811 79 182

Map