F445293

General Info

Members Datasets Scaffolds Average Seq Length
444 302 888 144

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10313403|Ga0207678_103134032
Length 174
Sequence MQREATYRGTVYPWQCDHVGHMNIMWYVGKFDEANWNLFARIGLTPSYLRETGRGMAAVQQNISYVSELLAGDIVEITSTLLEIREKSIRFVHQMRNAETGEIAATCEITGVHIDRQARRSAPFDDAIRRTAARQLAFPDPVSTCGTPHGFPRFSRLRIITPASEGKLDSIRVW

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
182 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
275 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
276 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
277 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
280 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
281 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
282 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
283 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
284 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
285 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
286 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
287 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
288 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
289 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
290 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
291 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
292 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
293 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
294 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
295 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
296 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
297 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
298 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
299 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
300 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
301 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
302 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.91
Nodule 0.9
Rhizoplane 5.41
Rhizosphere 79.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10313403 3300026067 Bacteria 1349
2 JGI25406J46586_10000012 3300003203 Bacteria 102438
3 JGI25153J46596_10001308 3300003215 Bacteria 14903
4 JGI25153J46596_10002547 3300003215 Bacteria 10449
5 JGI25160J50197_1001680 3300003354 Bacteria 10780
6 JGI25404J52841_10009216 3300003659 Bacteria 2109
7 JGI25404J52841_10027370 3300003659 Bacteria 1226
8 JGI25404J52841_10035691 3300003659 Bacteria 1059
9 JGI25404J52841_10054240 3300003659 Bacteria 841
10 Ga0055531_10007525 3300003794 Bacteria 5917
11 Ga0065165_1012184 3300005262 Bacteria 3520
12 Ga0065165_1147333 3300005262 Bacteria 551
13 Ga0070658_10094908 3300005327 Bacteria 2461
14 Ga0070683_100130697 3300005329 Bacteria 2376
15 Ga0070683_100865441 3300005329 Bacteria 867
16 Ga0070670_100099751 3300005331 Bacteria 2499
17 Ga0068869_100156536 3300005334 Bacteria 1771
18 Ga0070680_100029430 3300005336 Bacteria 4412
19 Ga0070682_101223225 3300005337 Bacteria 635
20 Ga0068868_100351544 3300005338 Bacteria 1262
21 Ga0068868_101929247 3300005338 Bacteria 560
22 Ga0070661_100018347 3300005344 Bacteria 4974
23 Ga0070675_100881311 3300005354 Bacteria 820
24 Ga0070671_100294750 3300005355 Bacteria 1381
25 Ga0070673_101908719 3300005364 Bacteria 563
26 Ga0070659_100241570 3300005366 Bacteria 1495
27 Ga0070709_11551236 3300005434 Bacteria 539
28 Ga0070714_100287399 3300005435 Bacteria 1529
29 Ga0070713_100032505 3300005436 Bacteria 4168
30 Ga0070710_10011862 3300005437 Bacteria 4315
31 Ga0070711_100002720 3300005439 Bacteria 10143
32 Ga0070711_100011221 3300005439 Bacteria 5556
33 Ga0070708_100628551 3300005445 Bacteria 1012
34 Ga0070663_100005926 3300005455 Bacteria 7315
35 Ga0070663_100717269 3300005455 Bacteria 851
36 Ga0070663_100856028 3300005455 Bacteria 783
37 Ga0070678_100004690 3300005456 Bacteria 7779
38 Ga0070662_100432812 3300005457 Bacteria 1090
39 Ga0070685_10162373 3300005466 Bacteria 1425
40 Ga0070706_100163562 3300005467 Bacteria 2078
41 Ga0070706_100248489 3300005467 Bacteria 1661
42 Ga0070707_100241789 3300005468 Bacteria 1757
43 Ga0070699_100273242 3300005518 Bacteria 1513
44 Ga0070679_100163265 3300005530 Bacteria 2201
45 Ga0070684_100039351 3300005535 Bacteria 4066
46 Ga0070684_100162360 3300005535 Bacteria 2027
47 Ga0070697_100657433 3300005536 Bacteria 923
48 Ga0068853_100072772 3300005539 Bacteria 2996
49 Ga0068853_100645004 3300005539 Bacteria 1007
50 Ga0070665_100367329 3300005548 Bacteria 1445
51 Ga0068855_100544249 3300005563 Bacteria 1257
52 Ga0070664_100069626 3300005564 Bacteria 3011
53 Ga0068857_100051992 3300005577 Bacteria 3635
54 Ga0068854_100171639 3300005578 Bacteria 1688
55 Ga0068856_100763365 3300005614 Bacteria 987
56 Ga0070702_100189512 3300005615 Bacteria 1352
57 Ga0068852_100040677 3300005616 Bacteria 3924
58 Ga0068859_100848614 3300005617 Bacteria 999
59 Ga0068866_10239246 3300005718 Bacteria 1105
60 Ga0068851_10036633 3300005834 Bacteria 2457
61 Ga0068851_10063152 3300005834 Bacteria 1901
62 Ga0068858_100656963 3300005842 Bacteria 1019
63 Ga0081538_10148021 3300005981 Bacteria 1069
64 Ga0081540_1001239 3300005983 Bacteria 22275
65 Ga0081540_1007760 3300005983 Bacteria 7598
66 Ga0081540_1022428 3300005983 Bacteria 3729
67 Ga0081540_1041170 3300005983 Bacteria 2398
68 Ga0081540_1117973 3300005983 Bacteria 1107
69 Ga0081539_10000040 3300005985 Bacteria 292753
70 Ga0070717_10272316 3300006028 Bacteria 1500
71 Ga0070717_10275130 3300006028 Bacteria 1492
72 Ga0070717_10884880 3300006028 Bacteria 813
73 Ga0075365_10227696 3300006038 Bacteria 1308
74 Ga0075365_10852953 3300006038 Bacteria 642
75 Ga0075364_10119783 3300006051 Bacteria 1761
76 Ga0070715_10001698 3300006163 Bacteria 6540
77 Ga0070716_100005769 3300006173 Bacteria 6014
78 Ga0070716_100292642 3300006173 Bacteria 1129
79 Ga0070712_100043313 3300006175 Bacteria 3098
80 Ga0070712_100120186 3300006175 Bacteria 1976
81 Ga0075367_10094061 3300006178 Bacteria 1826
82 Ga0075367_10535232 3300006178 Bacteria 744
83 Ga0075369_10054171 3300006186 Bacteria 1741
84 Ga0097621_100241626 3300006237 Bacteria 1579
85 Ga0097621_100506752 3300006237 Bacteria 1094
86 Ga0068871_100510004 3300006358 Bacteria 1085
87 Ga0068865_100413843 3300006881 Bacteria 1107
88 Ga0097620_100848604 3300006931 Bacteria 999
89 Ga0099794_10334393 3300007265 Bacteria 787
90 Ga0105240_10027951 3300009093 Bacteria 7377
91 Ga0105245_10014248 3300009098 Bacteria 6928
92 Ga0105245_11260325 3300009098 Bacteria 788
93 Ga0105247_10233678 3300009101 Bacteria 1249
94 Ga0105242_10700464 3300009176 Bacteria 991
95 Ga0105242_11523682 3300009176 Bacteria 700
96 Ga0105248_11329365 3300009177 Bacteria 813
97 Ga0105237_10011548 3300009545 Bacteria 9341
98 Ga0105237_10279509 3300009545 Bacteria 1672
99 Ga0105237_12007466 3300009545 Bacteria 587
100 Ga0105238_10012021 3300009551 Bacteria 8721
101 Ga0105238_10131192 3300009551 Bacteria 2484
102 Ga0105238_11601972 3300009551 Bacteria 681
103 Ga0105249_10123068 3300009553 Bacteria 2468
104 Ga0105249_10956502 3300009553 Bacteria 924
105 Ga0099796_10060501 3300010159 Bacteria 1341
106 Ga0099796_10086686 3300010159 Bacteria 1158
107 Ga0105239_11207262 3300010375 Bacteria 872
108 Ga0105246_10024003 3300011119 Bacteria 3954
109 Ga0157370_10010775 3300013104 Bacteria 9611
110 Ga0157374_10065814 3300013296 Bacteria 3405
111 Ga0157374_10230906 3300013296 Bacteria 1817
112 Ga0157378_10002449 3300013297 Bacteria 16521
113 Ga0157378_10691573 3300013297 Bacteria 1038
114 Ga0157378_11190079 3300013297 Bacteria 801
115 Ga0163162_10037738 3300013306 Bacteria 4822
116 Ga0163162_10444184 3300013306 Bacteria 1429
117 Ga0163162_11122891 3300013306 Bacteria 891
118 Ga0157375_10012970 3300013308 Bacteria 7402
119 Ga0163163_10200120 3300014325 Bacteria 2046
120 Ga0157377_10021319 3300014745 Bacteria 3407
121 Ga0157376_10145536 3300014969 Bacteria 2131
122 Ga0157376_12378376 3300014969 Bacteria 569
123 Ga0157376_12621164 3300014969 Bacteria 544
124 Ga0213872_10025525 3300021361 Bacteria 2716
125 Ga0213872_10380590 3300021361 Bacteria 575
126 Ga0209129_1024542 3300025258 Bacteria 1060
127 Ga0209564_1010432 3300025295 Bacteria 4282
128 Ga0209564_1013885 3300025295 Bacteria 3387
129 Ga0209758_1000030 3300025297 Bacteria 509217
130 Ga0209758_1000893 3300025297 Bacteria 40627
131 Ga0209758_1001645 3300025297 Bacteria 25366
132 Ga0209758_1102107 3300025297 Bacteria 813
133 Ga0209256_1002674 3300025299 Bacteria 13977
134 Ga0209256_1030594 3300025299 Bacteria 1484
135 Ga0207426_1000271 3300025302 Bacteria 108392
136 Ga0207426_1028587 3300025302 Bacteria 1846
137 Ga0209257_1000662 3300025304 Bacteria 54143
138 Ga0207697_10041162 3300025315 Bacteria 1897
139 Ga0207656_10070640 3300025321 Bacteria 1551
140 Ga0207692_10044605 3300025898 Bacteria 2213
141 Ga0207642_10946877 3300025899 Bacteria 553
142 Ga0207688_10094658 3300025901 Bacteria 1719
143 Ga0207685_10023625 3300025905 Bacteria 2096
144 Ga0207699_10054158 3300025906 Bacteria 2382
145 Ga0207699_10148522 3300025906 Bacteria 1548
146 Ga0207705_10180298 3300025909 Bacteria 1594
147 Ga0207684_10094607 3300025910 Bacteria 2549
148 Ga0207684_10344113 3300025910 Bacteria 1284
149 Ga0207707_10001185 3300025912 Bacteria 24547
150 Ga0207695_10083765 3300025913 Bacteria 3221
151 Ga0207695_10128152 3300025913 Bacteria 2498
152 Ga0207671_10049559 3300025914 Bacteria 3109
153 Ga0207671_10240771 3300025914 Bacteria 1421
154 Ga0207671_10482042 3300025914 Bacteria 988
155 Ga0207693_10002151 3300025915 Bacteria 17197
156 Ga0207693_10086703 3300025915 Bacteria 2453
157 Ga0207693_10114267 3300025915 Bacteria 2118
158 Ga0207663_10001035 3300025916 Bacteria 12747
159 Ga0207663_10040970 3300025916 Bacteria 2819
160 Ga0207663_10355761 3300025916 Bacteria 1110
161 Ga0207660_10003703 3300025917 Bacteria 9962
162 Ga0207657_10006555 3300025919 Bacteria 12051
163 Ga0207649_10061878 3300025920 Bacteria 2358
164 Ga0207649_10213675 3300025920 Bacteria 1370
165 Ga0207652_10067422 3300025921 Bacteria 3103
166 Ga0207646_10256673 3300025922 Bacteria 1580
167 Ga0207694_10027049 3300025924 Bacteria 4367
168 Ga0207694_10134363 3300025924 Bacteria 1985
169 Ga0207650_10085341 3300025925 Bacteria 2402
170 Ga0207650_10640026 3300025925 Bacteria 896
171 Ga0207687_10056387 3300025927 Bacteria 2756
172 Ga0207700_10104751 3300025928 Bacteria 2264
173 Ga0207700_10211634 3300025928 Bacteria 1639
174 Ga0207664_10003571 3300025929 Bacteria 10392
175 Ga0207709_10177921 3300025935 Bacteria 1499
176 Ga0207665_10003044 3300025939 Bacteria 11252
177 Ga0207665_10120733 3300025939 Bacteria 1851
178 Ga0207689_10174715 3300025942 Bacteria 1771
179 Ga0207661_10528693 3300025944 Bacteria 1079
180 Ga0207679_10030874 3300025945 Bacteria 3746
181 Ga0207667_10233390 3300025949 Bacteria 1883
182 Ga0207667_10240835 3300025949 Bacteria 1851
183 Ga0207651_11013581 3300025960 Bacteria 742
184 Ga0207668_12095538 3300025972 Bacteria 509
185 Ga0207640_10073849 3300025981 Bacteria 2306
186 Ga0207658_10271781 3300025986 Bacteria 1449
187 Ga0207658_11573111 3300025986 Bacteria 601
188 Ga0207677_10251097 3300026023 Bacteria 1436
189 Ga0207703_10110889 3300026035 Bacteria 2341
190 Ga0207639_10022060 3300026041 Bacteria 4582
191 Ga0207639_10601872 3300026041 Bacteria 1014
192 Ga0207678_10007829 3300026067 Bacteria 9431
193 Ga0207648_10986123 3300026089 Bacteria 789
194 Ga0207676_10473321 3300026095 Bacteria 1185
195 Ga0207674_10017074 3300026116 Bacteria 7922
196 Ga0207683_10085722 3300026121 Bacteria 2800
197 Ga0207683_10338432 3300026121 Bacteria 1380
198 Ga0207698_10048829 3300026142 Bacteria 3216
199 Ga0209179_1141487 3300027512 Bacteria 537
200 Ga0268266_10102557 3300028379 Bacteria 2524
201 Ga0265334_10011370 3300028573 Bacteria 3749
202 Ga0265338_10350390 3300028800 Bacteria 1062
203 Ga0265332_10054556 3300031238 Bacteria 1714
204 Ga0265332_10154247 3300031238 Bacteria 960
205 Ga0265328_10134636 3300031239 Bacteria 926
206 Ga0265325_10004532 3300031241 Bacteria 8754
207 Ga0265339_10475945 3300031249 Bacteria 578
208 Ga0265331_10074850 3300031250 Bacteria 1579
209 Ga0265331_10225624 3300031250 Bacteria 842
210 Ga0265316_10604517 3300031344 Bacteria 777
211 Ga0307513_10067158 3300031456 Bacteria 3764
212 Ga0307509_10005206 3300031507 Bacteria 18223
213 Ga0307408_101240908 3300031548 Bacteria 697
214 Ga0265313_10045354 3300031595 Bacteria 2141
215 Ga0307508_10017055 3300031616 Bacteria 6605
216 Ga0307514_10584692 3300031649 Bacteria 506
217 Ga0307516_10013774 3300031730 Bacteria 8589
218 Ga0307516_10495595 3300031730 Bacteria 876
219 Ga0307416_100812721 3300032002 Bacteria 1031
220 Ga0373926_0232170 3300035083 Bacteria 713
221 Ga0373934_0000358 3300035086 Bacteria 15879
222 Ga0373951_0197578 3300035091 Bacteria 585
223 Ga0373923_0000753 3300035111 Bacteria 8382
224 Ga0373945_0004424 3300035116 Bacteria 4464
225 Ga0373953_0002484 3300035117 Bacteria 5578
226 Ga0373953_0104598 3300035117 Bacteria 1193
227 Ga0373954_0000139 3300035118 Bacteria 25320
228 Ga0373954_0042158 3300035118 Bacteria 2128
229 Ga0373956_0003582 3300035119 Bacteria 6264
230 Ga0373956_0229897 3300035119 Bacteria 881
231 Ga0373956_0384637 3300035119 Bacteria 669
232 Ga0373957_0000613 3300035120 Bacteria 9090
233 Ga0373957_0106780 3300035120 Bacteria 1125
234 Ga0373946_0005901 3300035171 Bacteria 4436
235 Ga0373955_0001252 3300035172 Bacteria 10793
236 Ga0373955_0014646 3300035172 Bacteria 3820
237 Ga0373955_0852105 3300035172 Bacteria 560
238 Ga0373961_0198325 3300035241 Bacteria 707
239 Ga0373962_0179151 3300035242 Bacteria 708
240 Ga0373924_0000828 3300035410 Bacteria 9668
241 Ga0373924_0269204 3300035410 Bacteria 755
242 Ga0373935_0000106 3300035692 Bacteria 37674
243 Ga0373935_0067738 3300035692 Bacteria 2296
244 Ga0373927_0000267 3300035695 Bacteria 41137
245 Ga0373927_0027921 3300035695 Bacteria 3683
246 Ga0373933_0000483 3300035724 Bacteria 24839
247 Ga0373933_0094311 3300035724 Bacteria 1851
248 Ga0373947_0005290 3300035725 Bacteria 7546
249 Ga0373947_0050171 3300035725 Bacteria 2509
250 Ga0373937_0001773 3300036401 Bacteria 18126
251 Ga0373937_0538511 3300036401 Bacteria 1109
252 Ga0373925_0002245 3300037068 Bacteria 15641
253 Ga0373925_0101607 3300037068 Bacteria 2211
254 Ga0373925_0595415 3300037068 Bacteria 910
255 Ga0395899_0521669 3300037312 Bacteria 768
256 Ga0395898_0555782 3300037466 Bacteria 1090
257 Ga0395905_0005908 3300037471 Bacteria 12410
258 Ga0395901_0323252 3300038443 Bacteria 1596
259 Ga0436360_0223639 3300039438 Bacteria 2763
260 Ga0436361_0129820 3300039447 Bacteria 6294
261 Ga0436361_0701165 3300039447 Bacteria 617
262 Ga0436361_0771934 3300039447 Bacteria 576
263 Ga0436363_0055896 3300039450 Bacteria 919
264 Ga0439461_0036579 3300041410 Bacteria 1046
265 Ga0439465_0017518 3300041413 Bacteria 2237
266 Ga0439465_0244564 3300041413 Bacteria 662
267 Ga0451807_2472203 3300041486 Bacteria 621
268 Ga0451833_0694062 3300041491 Bacteria 677
269 Ga0439431_0087315 3300041997 Bacteria 847
270 Ga0466972_0417709 3300044658 Bacteria 629
271 Ga0466965_0026765 3300044683 Bacteria 2796
272 Ga0495592_0001002 3300046454 Bacteria 19619
273 Ga0495592_0023918 3300046454 Bacteria 4647
274 Ga0495603_0000609 3300046455 Bacteria 20089
275 Ga0495603_0100925 3300046455 Bacteria 1684
276 Ga0495603_0154977 3300046455 Bacteria 1330
277 Ga0495629_0000074 3300046459 Bacteria 87355
278 Ga0495629_0000548 3300046459 Bacteria 30813
279 Ga0495629_0170115 3300046459 Bacteria 1512
280 Ga0495629_0536667 3300046459 Bacteria 786
281 Ga0495641_0016556 3300046461 Bacteria 3880
282 Ga0495651_0008038 3300046462 Bacteria 8087
283 Ga0495653_0000621 3300046463 Bacteria 27177
284 Ga0495653_0552396 3300046463 Bacteria 712
285 Ga0495580_0000467 3300046472 Bacteria 33629
286 Ga0495582_0000059 3300046473 Bacteria 55798
287 Ga0495639_0000283 3300046475 Bacteria 25017
288 Ga0495639_0426319 3300046475 Bacteria 672
289 Ga0495662_0001173 3300046476 Bacteria 12925
290 Ga0495664_0005211 3300046477 Bacteria 7132
291 Ga0495594_0000621 3300046499 Bacteria 18249
292 Ga0495608_0004080 3300046511 Bacteria 10475
293 Ga0495610_0358891 3300046512 Bacteria 547
294 Ga0495616_0101509 3300046513 Bacteria 1349
295 Ga0495618_0050116 3300046514 Bacteria 2637
296 Ga0495618_0061834 3300046514 Bacteria 2375
297 Ga0495628_0025416 3300046516 Bacteria 4837
298 Ga0495628_0026181 3300046516 Bacteria 4761
299 Ga0495628_0209554 3300046516 Bacteria 1466
300 Ga0495628_0466247 3300046516 Bacteria 916
301 Ga0495630_0012889 3300046517 Bacteria 6073
302 Ga0495632_0222679 3300046519 Bacteria 853
303 Ga0495643_0260368 3300046522 Bacteria 806
304 Ga0495652_0009264 3300046529 Bacteria 8948
305 Ga0495652_0177966 3300046529 Bacteria 1635
306 Ga0495652_0371939 3300046529 Bacteria 1018
307 Ga0495665_0099511 3300046531 Bacteria 1526
308 Ga0495640_0003653 3300046533 Bacteria 12360
309 Ga0495640_0015782 3300046533 Bacteria 5668
310 Ga0495640_0370127 3300046533 Bacteria 882
311 Ga0495586_0260296 3300046535 Bacteria 991
312 Ga0495587_0004331 3300046536 Bacteria 9367
313 Ga0495609_0369936 3300046538 Bacteria 576
314 Ga0495645_0006393 3300046543 Bacteria 8180
315 Ga0495645_0027025 3300046543 Bacteria 4168
316 Ga0495622_0019759 3300046557 Bacteria 3136
317 Ga0495667_0010990 3300046559 Bacteria 6118
318 Ga0495667_0112490 3300046559 Bacteria 1759
319 Ga0495668_0158726 3300046616 Bacteria 1239
320 Ga0495668_0491515 3300046616 Bacteria 676
321 Ga0495634_0010682 3300046642 Bacteria 6721
322 Ga0495634_0027492 3300046642 Bacteria 3957
323 Ga0495625_0744498 3300046660 Bacteria 575
324 Ga0495635_0000177 3300046663 Bacteria 40081
325 Ga0495635_0000485 3300046663 Bacteria 25077
326 Ga0495635_0010095 3300046663 Bacteria 6602
327 Ga0495588_0002207 3300046674 Bacteria 8335
328 Ga0495657_0009555 3300046675 Bacteria 7346
329 Ga0495657_0239410 3300046675 Bacteria 1095
330 Ga0495599_0007052 3300046678 Bacteria 6799
331 Ga0495599_0079243 3300046678 Bacteria 2051
332 Ga0495599_0213707 3300046678 Bacteria 1182
333 Ga0495599_0217051 3300046678 Bacteria 1171
334 Ga0495623_0004663 3300046679 Bacteria 9010
335 Ga0495646_0001052 3300046680 Bacteria 15982
336 Ga0495646_0208502 3300046680 Bacteria 1061
337 Ga0495647_0001565 3300046681 Bacteria 7063
338 Ga0495658_0000338 3300046683 Bacteria 26426
339 Ga0495669_0118437 3300046684 Bacteria 1240
340 Ga0495613_0022290 3300046689 Bacteria 4720
341 Ga0495613_0026235 3300046689 Bacteria 4341
342 Ga0495624_0000963 3300046690 Bacteria 22722
343 Ga0495624_0217187 3300046690 Bacteria 1160
344 Ga0495671_0218481 3300046692 Bacteria 923
345 Ga0495600_0002436 3300046809 Bacteria 10671
346 Ga0495581_0000784 3300047315 Bacteria 16864
347 Ga0495581_0014180 3300047315 Bacteria 4620
348 Ga0495604_0011194 3300047317 Bacteria 7123
349 Ga0495604_0827706 3300047317 Bacteria 582
350 Ga0495674_0003252 3300047319 Bacteria 15782
351 Ga0495674_0010919 3300047319 Bacteria 8583
352 Ga0495674_0070565 3300047319 Bacteria 3018
353 Ga0495674_0368237 3300047319 Bacteria 1164
354 Ga0495676_0033076 3300047321 Bacteria 4359
355 Ga0495680_0001218 3300047322 Bacteria 28201
356 Ga0495675_0005191 3300047444 Bacteria 7928
357 Ga0495673_0149432 3300047469 Bacteria 904
358 Ga0495684_0006208 3300047471 Bacteria 9295
359 Ga0495684_0024168 3300047471 Bacteria 4676
360 Ga0495684_0073141 3300047471 Bacteria 2604
361 Ga0495593_0000158 3300047673 Bacteria 34211
362 Ga0495593_0006582 3300047673 Bacteria 6800
363 Ga0495602_0025825 3300048088 Bacteria 5678
364 Ga0495602_0137873 3300048088 Bacteria 1935
365 Ga0495602_0361276 3300048088 Bacteria 1045
366 Ga0495602_0631468 3300048088 Bacteria 733
367 Ga0495614_0113897 3300048089 Bacteria 1188
368 Ga0496100_0033641 3300048903 Bacteria 3209
369 Ga0496100_0051361 3300048903 Bacteria 2676
370 Ga0496101_0731215 3300048904 Bacteria 781
371 Ga0496102_0005763 3300048905 Bacteria 10531
372 Ga0496102_0310579 3300048905 Bacteria 1486
373 Ga0496103_0094479 3300048906 Bacteria 1889
374 Ga0496104_0033498 3300048907 Bacteria 4786
375 Ga0496105_0038780 3300048908 Bacteria 3925
376 Ga0496106_0002811 3300048909 Bacteria 12911
377 Ga0496107_0133101 3300048910 Bacteria 1836
378 Ga0496108_0018586 3300048911 Bacteria 5693
379 Ga0496109_0367297 3300048912 Bacteria 1359
380 Ga0496109_0409925 3300048912 Bacteria 1280
381 Ga0496110_0013892 3300048913 Bacteria 6671
382 Ga0496110_0269466 3300048913 Bacteria 1550
383 Ga0496111_0047540 3300048914 Bacteria 3090
384 Ga0496111_0164095 3300048914 Bacteria 1650
385 Ga0496112_0000137 3300048915 Bacteria 45501
386 Ga0496112_1486841 3300048915 Bacteria 591
387 Ga0496113_0914741 3300048916 Bacteria 693
388 Ga0496114_0087399 3300048917 Bacteria 2643
389 Ga0496115_0014366 3300048918 Bacteria 5994
390 Ga0496115_0044751 3300048918 Bacteria 3533
391 Ga0496118_0058655 3300048921 Bacteria 2874
392 Ga0496119_0114528 3300048922 Bacteria 1491
393 Ga0496119_0487020 3300048922 Bacteria 576
394 Ga0496120_0033190 3300048923 Bacteria 3103
395 Ga0496121_0156417 3300048924 Bacteria 1672
396 Ga0496125_0072928 3300048928 Bacteria 2673
397 Ga0496126_0025504 3300048929 Bacteria 5685
398 Ga0496126_0609274 3300048929 Bacteria 859
399 Ga0501039_0241338 3300049575 Bacteria 1421
400 Ga0501048_0401732 3300049582 Bacteria 979
401 Ga0501071_0054712 3300049587 Bacteria 2880
402 Ga0501071_0175933 3300049587 Bacteria 1603
403 Ga0501076_0839501 3300049592 Bacteria 758
404 Ga0501080_0060360 3300049742 Bacteria 3530
405 Ga0501035_0713532 3300049822 Bacteria 808
406 Ga0501045_0911032 3300049824 Bacteria 646
407 nmdc:mga00v17_73654_c1 3300050491 Bacteria 1737
408 nmdc:mga06z11_49948_c1 3300050494 Bacteria 2136
409 nmdc:mga0sz30_6086_c1 3300050516 Bacteria 4162
410 Ga0495601_0033196 3300053077 Bacteria 3215
411 Ga0495601_0043750 3300053077 Bacteria 2812
412 Ga0495612_0090985 3300053078 Bacteria 1292
413 Ga0495612_0385629 3300053078 Bacteria 635
414 Ga0500635_0001927 3300053080 Bacteria 5064
415 Ga0495655_0117419 3300053083 Bacteria 806
416 Ga0495595_0000228 3300053084 Bacteria 22263
417 Ga0495619_0010162 3300053085 Bacteria 5927
418 Ga0495619_0165641 3300053085 Bacteria 1527
419 Ga0495619_0215921 3300053085 Bacteria 1328
420 Ga0500643_000028 3300053087 Bacteria 245672
421 Ga0500647_0331536 3300053091 Bacteria 640
422 Ga0500651_0038098 3300053093 Bacteria 3029
423 Ga0500554_026839 3300053102 Bacteria 1659
424 Ga0500642_0001807 3300053130 Bacteria 6174
425 Ga0500559_0055064 3300053136 Bacteria 1763
426 Ga0500568_0008444 3300053139 Bacteria 4959
427 Ga0500573_0080595 3300053140 Bacteria 1849
428 Ga0500577_0041913 3300053142 Bacteria 1673
429 Ga0500603_000194 3300053150 Bacteria 15890
430 Ga0500603_229137 3300053150 Bacteria 594
431 Ga0500619_041424 3300053154 Bacteria 1457
432 Ga0500636_0013902 3300053177 Bacteria 4732
433 Ga0500637_0003301 3300053178 Bacteria 7417
434 Ga0500645_035843 3300053730 Bacteria 1477
435 Ga0500596_001601 3300053735 Bacteria 4589
436 2511400260 2511231028 Bacteria 8046582
437 2513874127 2513237139 Bacteria 8737671
438 2617350252 2617270735 Bacteria 9163226
439 2805920846 2802429603 Bacteria 8777136
440 2824699395 2824696289 Bacteria 8335049
441 2824778051 2824773399 Bacteria 8360218
442 2841977793 2841974524 Bacteria 8931498
443 2847943164 2847939898 Bacteria 8606328
444 2857514830 2857509624 Bacteria 7472071
445 Ga0207678_10313403
446 JGI25406J46586_10000012
447 JGI25153J46596_10001308
448 JGI25153J46596_10002547
449 JGI25160J50197_1001680
450 JGI25404J52841_10009216
451 JGI25404J52841_10027370
452 JGI25404J52841_10035691
453 JGI25404J52841_10054240
454 Ga0055531_10007525
455 Ga0065165_1012184
456 Ga0065165_1147333
457 Ga0070658_10094908
458 Ga0070683_100130697
459 Ga0070683_100865441
460 Ga0070670_100099751
461 Ga0068869_100156536
462 Ga0070680_100029430
463 Ga0070682_101223225
464 Ga0068868_100351544
465 Ga0068868_101929247
466 Ga0070661_100018347
467 Ga0070675_100881311
468 Ga0070671_100294750
469 Ga0070673_101908719
470 Ga0070659_100241570
471 Ga0070709_11551236
472 Ga0070714_100287399
473 Ga0070713_100032505
474 Ga0070710_10011862
475 Ga0070711_100002720
476 Ga0070711_100011221
477 Ga0070708_100628551
478 Ga0070663_100005926
479 Ga0070663_100717269
480 Ga0070663_100856028
481 Ga0070678_100004690
482 Ga0070662_100432812
483 Ga0070685_10162373
484 Ga0070706_100163562
485 Ga0070706_100248489
486 Ga0070707_100241789
487 Ga0070699_100273242
488 Ga0070679_100163265
489 Ga0070684_100039351
490 Ga0070684_100162360
491 Ga0070697_100657433
492 Ga0068853_100072772
493 Ga0068853_100645004
494 Ga0070665_100367329
495 Ga0068855_100544249
496 Ga0070664_100069626
497 Ga0068857_100051992
498 Ga0068854_100171639
499 Ga0068856_100763365
500 Ga0070702_100189512
501 Ga0068852_100040677
502 Ga0068859_100848614
503 Ga0068866_10239246
504 Ga0068851_10036633
505 Ga0068851_10063152
506 Ga0068858_100656963
507 Ga0081538_10148021
508 Ga0081540_1001239
509 Ga0081540_1007760
510 Ga0081540_1022428
511 Ga0081540_1041170
512 Ga0081540_1117973
513 Ga0081539_10000040
514 Ga0070717_10272316
515 Ga0070717_10275130
516 Ga0070717_10884880
517 Ga0075365_10227696
518 Ga0075365_10852953
519 Ga0075364_10119783
520 Ga0070715_10001698
521 Ga0070716_100005769
522 Ga0070716_100292642
523 Ga0070712_100043313
524 Ga0070712_100120186
525 Ga0075367_10094061
526 Ga0075367_10535232
527 Ga0075369_10054171
528 Ga0097621_100241626
529 Ga0097621_100506752
530 Ga0068871_100510004
531 Ga0068865_100413843
532 Ga0097620_100848604
533 Ga0099794_10334393
534 Ga0105240_10027951
535 Ga0105245_10014248
536 Ga0105245_11260325
537 Ga0105247_10233678
538 Ga0105242_10700464
539 Ga0105242_11523682
540 Ga0105248_11329365
541 Ga0105237_10011548
542 Ga0105237_10279509
543 Ga0105237_12007466
544 Ga0105238_10012021
545 Ga0105238_10131192
546 Ga0105238_11601972
547 Ga0105249_10123068
548 Ga0105249_10956502
549 Ga0099796_10060501
550 Ga0099796_10086686
551 Ga0105239_11207262
552 Ga0105246_10024003
553 Ga0157370_10010775
554 Ga0157374_10065814
555 Ga0157374_10230906
556 Ga0157378_10002449
557 Ga0157378_10691573
558 Ga0157378_11190079
559 Ga0163162_10037738
560 Ga0163162_10444184
561 Ga0163162_11122891
562 Ga0157375_10012970
563 Ga0163163_10200120
564 Ga0157377_10021319
565 Ga0157376_10145536
566 Ga0157376_12378376
567 Ga0157376_12621164
568 Ga0213872_10025525
569 Ga0213872_10380590
570 Ga0209129_1024542
571 Ga0209564_1010432
572 Ga0209564_1013885
573 Ga0209758_1000030
574 Ga0209758_1000893
575 Ga0209758_1001645
576 Ga0209758_1102107
577 Ga0209256_1002674
578 Ga0209256_1030594
579 Ga0207426_1000271
580 Ga0207426_1028587
581 Ga0209257_1000662
582 Ga0207697_10041162
583 Ga0207656_10070640
584 Ga0207692_10044605
585 Ga0207642_10946877
586 Ga0207688_10094658
587 Ga0207685_10023625
588 Ga0207699_10054158
589 Ga0207699_10148522
590 Ga0207705_10180298
591 Ga0207684_10094607
592 Ga0207684_10344113
593 Ga0207707_10001185
594 Ga0207695_10083765
595 Ga0207695_10128152
596 Ga0207671_10049559
597 Ga0207671_10240771
598 Ga0207671_10482042
599 Ga0207693_10002151
600 Ga0207693_10086703
601 Ga0207693_10114267
602 Ga0207663_10001035
603 Ga0207663_10040970
604 Ga0207663_10355761
605 Ga0207660_10003703
606 Ga0207657_10006555
607 Ga0207649_10061878
608 Ga0207649_10213675
609 Ga0207652_10067422
610 Ga0207646_10256673
611 Ga0207694_10027049
612 Ga0207694_10134363
613 Ga0207650_10085341
614 Ga0207650_10640026
615 Ga0207687_10056387
616 Ga0207700_10104751
617 Ga0207700_10211634
618 Ga0207664_10003571
619 Ga0207709_10177921
620 Ga0207665_10003044
621 Ga0207665_10120733
622 Ga0207689_10174715
623 Ga0207661_10528693
624 Ga0207679_10030874
625 Ga0207667_10233390
626 Ga0207667_10240835
627 Ga0207651_11013581
628 Ga0207668_12095538
629 Ga0207640_10073849
630 Ga0207658_10271781
631 Ga0207658_11573111
632 Ga0207677_10251097
633 Ga0207703_10110889
634 Ga0207639_10022060
635 Ga0207639_10601872
636 Ga0207678_10007829
637 Ga0207648_10986123
638 Ga0207676_10473321
639 Ga0207674_10017074
640 Ga0207683_10085722
641 Ga0207683_10338432
642 Ga0207698_10048829
643 Ga0209179_1141487
644 Ga0268266_10102557
645 Ga0265334_10011370
646 Ga0265338_10350390
647 Ga0265332_10054556
648 Ga0265332_10154247
649 Ga0265328_10134636
650 Ga0265325_10004532
651 Ga0265339_10475945
652 Ga0265331_10074850
653 Ga0265331_10225624
654 Ga0265316_10604517
655 Ga0307513_10067158
656 Ga0307509_10005206
657 Ga0307408_101240908
658 Ga0265313_10045354
659 Ga0307508_10017055
660 Ga0307514_10584692
661 Ga0307516_10013774
662 Ga0307516_10495595
663 Ga0307416_100812721
664 Ga0373926_0232170
665 Ga0373934_0000358
666 Ga0373951_0197578
667 Ga0373923_0000753
668 Ga0373945_0004424
669 Ga0373953_0002484
670 Ga0373953_0104598
671 Ga0373954_0000139
672 Ga0373954_0042158
673 Ga0373956_0003582
674 Ga0373956_0229897
675 Ga0373956_0384637
676 Ga0373957_0000613
677 Ga0373957_0106780
678 Ga0373946_0005901
679 Ga0373955_0001252
680 Ga0373955_0014646
681 Ga0373955_0852105
682 Ga0373961_0198325
683 Ga0373962_0179151
684 Ga0373924_0000828
685 Ga0373924_0269204
686 Ga0373935_0000106
687 Ga0373935_0067738
688 Ga0373927_0000267
689 Ga0373927_0027921
690 Ga0373933_0000483
691 Ga0373933_0094311
692 Ga0373947_0005290
693 Ga0373947_0050171
694 Ga0373937_0001773
695 Ga0373937_0538511
696 Ga0373925_0002245
697 Ga0373925_0101607
698 Ga0373925_0595415
699 Ga0395899_0521669
700 Ga0395898_0555782
701 Ga0395905_0005908
702 Ga0395901_0323252
703 Ga0436360_0223639
704 Ga0436361_0129820
705 Ga0436361_0701165
706 Ga0436361_0771934
707 Ga0436363_0055896
708 Ga0439461_0036579
709 Ga0439465_0017518
710 Ga0439465_0244564
711 Ga0451807_2472203
712 Ga0451833_0694062
713 Ga0439431_0087315
714 Ga0466972_0417709
715 Ga0466965_0026765
716 Ga0495592_0001002
717 Ga0495592_0023918
718 Ga0495603_0000609
719 Ga0495603_0100925
720 Ga0495603_0154977
721 Ga0495629_0000074
722 Ga0495629_0000548
723 Ga0495629_0170115
724 Ga0495629_0536667
725 Ga0495641_0016556
726 Ga0495651_0008038
727 Ga0495653_0000621
728 Ga0495653_0552396
729 Ga0495580_0000467
730 Ga0495582_0000059
731 Ga0495639_0000283
732 Ga0495639_0426319
733 Ga0495662_0001173
734 Ga0495664_0005211
735 Ga0495594_0000621
736 Ga0495608_0004080
737 Ga0495610_0358891
738 Ga0495616_0101509
739 Ga0495618_0050116
740 Ga0495618_0061834
741 Ga0495628_0025416
742 Ga0495628_0026181
743 Ga0495628_0209554
744 Ga0495628_0466247
745 Ga0495630_0012889
746 Ga0495632_0222679
747 Ga0495643_0260368
748 Ga0495652_0009264
749 Ga0495652_0177966
750 Ga0495652_0371939
751 Ga0495665_0099511
752 Ga0495640_0003653
753 Ga0495640_0015782
754 Ga0495640_0370127
755 Ga0495586_0260296
756 Ga0495587_0004331
757 Ga0495609_0369936
758 Ga0495645_0006393
759 Ga0495645_0027025
760 Ga0495622_0019759
761 Ga0495667_0010990
762 Ga0495667_0112490
763 Ga0495668_0158726
764 Ga0495668_0491515
765 Ga0495634_0010682
766 Ga0495634_0027492
767 Ga0495625_0744498
768 Ga0495635_0000177
769 Ga0495635_0000485
770 Ga0495635_0010095
771 Ga0495588_0002207
772 Ga0495657_0009555
773 Ga0495657_0239410
774 Ga0495599_0007052
775 Ga0495599_0079243
776 Ga0495599_0213707
777 Ga0495599_0217051
778 Ga0495623_0004663
779 Ga0495646_0001052
780 Ga0495646_0208502
781 Ga0495647_0001565
782 Ga0495658_0000338
783 Ga0495669_0118437
784 Ga0495613_0022290
785 Ga0495613_0026235
786 Ga0495624_0000963
787 Ga0495624_0217187
788 Ga0495671_0218481
789 Ga0495600_0002436
790 Ga0495581_0000784
791 Ga0495581_0014180
792 Ga0495604_0011194
793 Ga0495604_0827706
794 Ga0495674_0003252
795 Ga0495674_0010919
796 Ga0495674_0070565
797 Ga0495674_0368237
798 Ga0495676_0033076
799 Ga0495680_0001218
800 Ga0495675_0005191
801 Ga0495673_0149432
802 Ga0495684_0006208
803 Ga0495684_0024168
804 Ga0495684_0073141
805 Ga0495593_0000158
806 Ga0495593_0006582
807 Ga0495602_0025825
808 Ga0495602_0137873
809 Ga0495602_0361276
810 Ga0495602_0631468
811 Ga0495614_0113897
812 Ga0496100_0033641
813 Ga0496100_0051361
814 Ga0496101_0731215
815 Ga0496102_0005763
816 Ga0496102_0310579
817 Ga0496103_0094479
818 Ga0496104_0033498
819 Ga0496105_0038780
820 Ga0496106_0002811
821 Ga0496107_0133101
822 Ga0496108_0018586
823 Ga0496109_0367297
824 Ga0496109_0409925
825 Ga0496110_0013892
826 Ga0496110_0269466
827 Ga0496111_0047540
828 Ga0496111_0164095
829 Ga0496112_0000137
830 Ga0496112_1486841
831 Ga0496113_0914741
832 Ga0496114_0087399
833 Ga0496115_0014366
834 Ga0496115_0044751
835 Ga0496118_0058655
836 Ga0496119_0114528
837 Ga0496119_0487020
838 Ga0496120_0033190
839 Ga0496121_0156417
840 Ga0496125_0072928
841 Ga0496126_0025504
842 Ga0496126_0609274
843 Ga0501039_0241338
844 Ga0501048_0401732
845 Ga0501071_0054712
846 Ga0501071_0175933
847 Ga0501076_0839501
848 Ga0501080_0060360
849 Ga0501035_0713532
850 Ga0501045_0911032
851 nmdc:mga00v17_73654_c1
852 nmdc:mga06z11_49948_c1
853 nmdc:mga0sz30_6086_c1
854 Ga0495601_0033196
855 Ga0495601_0043750
856 Ga0495612_0090985
857 Ga0495612_0385629
858 Ga0500635_0001927
859 Ga0495655_0117419
860 Ga0495595_0000228
861 Ga0495619_0010162
862 Ga0495619_0165641
863 Ga0495619_0215921
864 Ga0500643_000028
865 Ga0500647_0331536
866 Ga0500651_0038098
867 Ga0500554_026839
868 Ga0500642_0001807
869 Ga0500559_0055064
870 Ga0500568_0008444
871 Ga0500573_0080595
872 Ga0500577_0041913
873 Ga0500603_000194
874 Ga0500603_229137
875 Ga0500619_041424
876 Ga0500636_0013902
877 Ga0500637_0003301
878 Ga0500645_035843
879 Ga0500596_001601
880 2511400260
881 2513874127
882 2617350252
883 2805920846
884 2824699395
885 2824778051
886 2841977793
887 2847943164
888 2857514830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13279

4HBT_2

Thioesterase-like superfamily

11

131

0.97

PF03061

4HBT

Thioesterase superfamily

19

104

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d6x-assembly1.cif.gz_F crystal structure of campylobacter jejuni fabz 0.8996 54 114
3bbj-assembly1.cif.gz_B crystal structure of a putative thioesterase ii (tfu_2367) from thermobifida fusca yx at 2.45 a resolution 0.8978 58 112
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.8867 5 131
5kl9-assembly1.cif.gz_B crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa 0.878 4 130
6fdg-assembly1.cif.gz_D novel crystal structure of dhna-coa thioesterase from staphylococcus aureus 0.8731 4 123
ID Description Score Start End Superfamily
4xmhA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.9138 75 112 2.40.128.20
af_A0A1P8B531_128_238_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9107 75 106 3.10.450.50
3bbjB00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.8978 58 112 2.40.160.210
af_B0G100_946_1201_3.10.129.110 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Polyketide synthase dehydratase 0.8895 73 112 3.10.129.110
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8867 5 131 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2E9E518-F1-model_v4 Thioesterase-like protein 0.9134 7 133 GO:0047617
AF-A0A523PFK1-F1-model_v4 Thioesterase 0.9134 4 133 GO:0047617
AF-A0A7T1WVP7-F1-model_v4 Acyl-CoA thioesterase 0.9129 7 133 GO:0047617
AF-A0A2E6E989-F1-model_v4 Thioesterase 0.9122 7 133 GO:0047617
AF-A0A1Y5T2V6-F1-model_v4 L-carnitine dehydrogenase (EC 1.1.1.108) 0.912 4 133 GO:0047728

Map