F445258

General Info

Members Datasets Scaffolds Average Seq Length
444 205 888 455

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100175198|Ga0075428_1001751982
Length 504
Sequence MRPDTQRPRSGWHEQYHAPRRRRVHIPDVKTMPPIHTAYFRKLPSVDEVLRSPEAQLWMAQSSRAVVTEAVREILATARQTILQATDEAALETLPLLLXXXXQQVQERLQAQQTYHLRRLINATGVIVHTNLGRSLLAPAAVANLQEVAESYSNLEYDLEGGERGSRYAHVEAALKTLTGAEAALVVNNNAAAVFLALQALATGREVVVSRGQLIEIGGEFRIPDIMRSSGAILREVGATNKTHLRDYAQAISEHTALLLRVHTSNYRIVGFTAEVSAPELVALGRQHQIPVMEDLGSGTLVDLRPFGLYDEPTVPEVVASGVDIVTFSGDKLLGGPQAGIIVGKAAYIAAVRRHPLHRAVRVDKFTVAALEATLRLYADPELARRAIPTLTMLSMSPQTLAGRVRRLRRRLPEAVQAAYRPRVVDGNSAVGGGALPLAQLPTKLLALRPTFCSVSELERRLRGRHPAIIGRIAQDQYLLDLRTVLEREIPEIATALQQLVPAS

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.68
Rhizosphere 99.1
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100175198 3300006844 Bacteria 2323
2 JGI24751J29686_10000378 3300002459 Bacteria 15010
3 JGI26141J51220_1000198 3300003503 Bacteria 3178
4 Ga0070658_10079074 3300005327 Bacteria 2700
5 Ga0070676_10000427 3300005328 Bacteria 19946
6 Ga0070683_100010690 3300005329 Bacteria 7891
7 Ga0070690_100020675 3300005330 Bacteria 4011
8 Ga0070670_100039023 3300005331 Bacteria 4083
9 Ga0068869_100002472 3300005334 Bacteria 11149
10 Ga0068869_100008231 3300005334 Bacteria 6712
11 Ga0070680_100000568 3300005336 Bacteria 25347
12 Ga0070682_100000700 3300005337 Bacteria 20170
13 Ga0070660_100000101 3300005339 Bacteria 52337
14 Ga0070660_100003888 3300005339 Bacteria 10322
15 Ga0070661_100001100 3300005344 Bacteria 19048
16 Ga0070661_100003735 3300005344 Bacteria 10494
17 Ga0070661_100048938 3300005344 Bacteria 3095
18 Ga0070692_10000220 3300005345 Bacteria 15611
19 Ga0070675_100025320 3300005354 Bacteria 4757
20 Ga0070674_100004306 3300005356 Bacteria 8102
21 Ga0070673_100015384 3300005364 Bacteria 5373
22 Ga0070673_100181776 3300005364 Bacteria 1801
23 Ga0070659_100002337 3300005366 Bacteria 13492
24 Ga0070667_100107106 3300005367 Bacteria 2420
25 Ga0070703_10000029 3300005406 Bacteria 70192
26 Ga0070703_10001760 3300005406 Bacteria 6417
27 Ga0070714_100021548 3300005435 Bacteria 5273
28 Ga0070705_100003111 3300005440 Bacteria 8160
29 Ga0070700_100093930 3300005441 Unclassified 1963
30 Ga0070694_100092617 3300005444 Bacteria 2123
31 Ga0070694_100104362 3300005444 Bacteria 2010
32 Ga0070708_100006507 3300005445 Bacteria 9295
33 Ga0070708_100043647 3300005445 Bacteria 3940
34 Ga0070708_100058512 3300005445 Bacteria 3434
35 Ga0070708_100064118 3300005445 Bacteria 3291
36 Ga0070708_100067102 3300005445 Bacteria 3221
37 Ga0070708_100077118 3300005445 Bacteria 3011
38 Ga0070708_100099831 3300005445 Bacteria 2656
39 Ga0070708_100109347 3300005445 Bacteria 2539
40 Ga0070663_100079011 3300005455 Bacteria 2413
41 Ga0070681_10009774 3300005458 Bacteria 9438
42 Ga0068867_100046407 3300005459 Bacteria 3191
43 Ga0070706_100002601 3300005467 Bacteria 18092
44 Ga0070706_100006322 3300005467 Bacteria 11193
45 Ga0070706_100017157 3300005467 Bacteria 6688
46 Ga0070706_100061390 3300005467 Bacteria 3471
47 Ga0070706_100081072 3300005467 Bacteria 3005
48 Ga0070706_100090973 3300005467 Bacteria 2830
49 Ga0070706_100106214 3300005467 Bacteria 2612
50 Ga0070707_100005734 3300005468 Bacteria 11584
51 Ga0070707_100011887 3300005468 Bacteria 8125
52 Ga0070707_100018063 3300005468 Bacteria 6634
53 Ga0070707_100026309 3300005468 Bacteria 5523
54 Ga0070707_100047505 3300005468 Bacteria 4109
55 Ga0070707_100098161 3300005468 Bacteria 2837
56 Ga0070707_100121299 3300005468 Bacteria 2538
57 Ga0070707_100150335 3300005468 Bacteria 2267
58 Ga0070698_100011572 3300005471 Bacteria 9362
59 Ga0070698_100063001 3300005471 Bacteria 3740
60 Ga0070698_100090233 3300005471 Bacteria 3048
61 Ga0070699_100003803 3300005518 Bacteria 13341
62 Ga0070699_100008044 3300005518 Bacteria 9155
63 Ga0070699_100016311 3300005518 Bacteria 6378
64 Ga0070699_100025684 3300005518 Bacteria 5077
65 Ga0070699_100072054 3300005518 Bacteria 3005
66 Ga0070699_100120560 3300005518 Bacteria 2306
67 Ga0070679_100000816 3300005530 Bacteria 27011
68 Ga0070684_100022395 3300005535 Bacteria 5269
69 Ga0070684_100050187 3300005535 Bacteria 3623
70 Ga0070697_100024191 3300005536 Bacteria 4834
71 Ga0070697_100067928 3300005536 Bacteria 2917
72 Ga0070697_100144127 3300005536 Bacteria 2004
73 Ga0068853_100002651 3300005539 Bacteria 13494
74 Ga0070672_100161351 3300005543 Bacteria 1860
75 Ga0070695_100001364 3300005545 Bacteria 13550
76 Ga0070695_100004949 3300005545 Bacteria 7855
77 Ga0070695_100043970 3300005545 Bacteria 2842
78 Ga0070695_100063391 3300005545 Bacteria 2402
79 Ga0070696_100002144 3300005546 Bacteria 12984
80 Ga0070704_100000362 3300005549 Bacteria 20622
81 Ga0070704_100007486 3300005549 Bacteria 6498
82 Ga0068855_100090754 3300005563 Bacteria 3525
83 Ga0070664_100002159 3300005564 Bacteria 15779
84 Ga0070664_100027087 3300005564 Bacteria 4762
85 Ga0068857_100067770 3300005577 Bacteria 3176
86 Ga0068857_100118117 3300005577 Bacteria 2387
87 Ga0068854_100000477 3300005578 Bacteria 24535
88 Ga0068854_100009977 3300005578 Bacteria 6148
89 Ga0068854_100089640 3300005578 Unclassified 2286
90 Ga0068856_100033670 3300005614 Bacteria 5017
91 Ga0068852_100005694 3300005616 Bacteria 8936
92 Ga0068852_100233049 3300005616 Bacteria 1756
93 Ga0068859_100013971 3300005617 Bacteria 8052
94 Ga0068859_100020356 3300005617 Bacteria 6660
95 Ga0068859_100149319 3300005617 Bacteria 2413
96 Ga0068864_100051655 3300005618 Bacteria 3542
97 Ga0068861_100002177 3300005719 Bacteria 12724
98 Ga0068851_10006340 3300005834 Bacteria 5398
99 Ga0068851_10057391 3300005834 Bacteria 1988
100 Ga0068870_10000182 3300005840 Bacteria 22665
101 Ga0068870_10001376 3300005840 Bacteria 9811
102 Ga0068863_100002467 3300005841 Bacteria 18376
103 Ga0068863_100101383 3300005841 Bacteria 2737
104 Ga0068858_100046963 3300005842 Bacteria 4003
105 Ga0068860_100111023 3300005843 Bacteria 2621
106 Ga0068862_100028701 3300005844 Bacteria 4685
107 Ga0081455_10001199 3300005937 Bacteria 32468
108 Ga0081455_10001558 3300005937 Bacteria 28156
109 Ga0081455_10003494 3300005937 Bacteria 18052
110 Ga0081455_10004277 3300005937 Bacteria 16076
111 Ga0081455_10048514 3300005937 Bacteria 3668
112 Ga0081455_10055847 3300005937 Bacteria 3356
113 Ga0081538_10006152 3300005981 Bacteria 10642
114 Ga0081538_10012463 3300005981 Bacteria 6814
115 Ga0075432_10008518 3300006058 Bacteria 3498
116 Ga0075432_10017711 3300006058 Bacteria 2428
117 Ga0070716_100003747 3300006173 Bacteria 7197
118 Ga0070712_100002745 3300006175 Bacteria 10882
119 Ga0068871_100098746 3300006358 Bacteria 2443
120 Ga0075428_100034904 3300006844 Bacteria 5545
121 Ga0075428_100098220 3300006844 Bacteria 3192
122 Ga0075428_100175864 3300006844 Bacteria 2318
123 Ga0075430_100000679 3300006846 Bacteria 26048
124 Ga0075430_100050198 3300006846 Bacteria 3519
125 Ga0075430_100076239 3300006846 Bacteria 2810
126 Ga0075431_100000281 3300006847 Bacteria 39748
127 Ga0075431_100000841 3300006847 Bacteria 26876
128 Ga0075431_100014398 3300006847 Bacteria 7999
129 Ga0075431_100029650 3300006847 Bacteria 5633
130 Ga0075431_100074468 3300006847 Bacteria 3503
131 Ga0075433_10010172 3300006852 Bacteria 7545
132 Ga0075433_10011431 3300006852 Bacteria 7150
133 Ga0075433_10062366 3300006852 Bacteria 3264
134 Ga0075434_100004151 3300006871 Bacteria 12975
135 Ga0075434_100013305 3300006871 Bacteria 7825
136 Ga0075434_100018458 3300006871 Bacteria 6740
137 Ga0075434_100018515 3300006871 Bacteria 6729
138 Ga0075434_100039576 3300006871 Bacteria 4671
139 Ga0075434_100112202 3300006871 Bacteria 2738
140 Ga0075434_100191408 3300006871 Bacteria 2066
141 Ga0075429_100000341 3300006880 Bacteria 33999
142 Ga0075429_100101327 3300006880 Bacteria 2514
143 Ga0075429_100146533 3300006880 Bacteria 2066
144 Ga0075436_100070349 3300006914 Bacteria 2419
145 Ga0075436_100072685 3300006914 Bacteria 2380
146 Ga0097620_100013971 3300006931 Bacteria 8052
147 Ga0097620_100020358 3300006931 Bacteria 6660
148 Ga0097620_100149311 3300006931 Bacteria 2413
149 Ga0075435_100001409 3300007076 Bacteria 15484
150 Ga0075435_100005296 3300007076 Bacteria 8982
151 Ga0075435_100077388 3300007076 Bacteria 2727
152 Ga0105240_10025748 3300009093 Bacteria 7726
153 Ga0111539_10003279 3300009094 Bacteria 21396
154 Ga0111539_10004706 3300009094 Bacteria 17835
155 Ga0111539_10011917 3300009094 Bacteria 10899
156 Ga0111539_10012772 3300009094 Bacteria 10509
157 Ga0111539_10085311 3300009094 Bacteria 3712
158 Ga0105247_10059388 3300009101 Bacteria 2367
159 Ga0114129_10004971 3300009147 Bacteria 18736
160 Ga0114129_10032196 3300009147 Bacteria 7411
161 Ga0114129_10041536 3300009147 Bacteria 6480
162 Ga0114129_10059175 3300009147 Bacteria 5357
163 Ga0114129_10073936 3300009147 Bacteria 4748
164 Ga0114129_10086326 3300009147 Bacteria 4352
165 Ga0114129_10260895 3300009147 Bacteria 2322
166 Ga0114129_10272237 3300009147 Bacteria 2265
167 Ga0105243_10011358 3300009148 Bacteria 6741
168 Ga0105243_10088713 3300009148 Bacteria 2541
169 Ga0105241_10000707 3300009174 Bacteria 25256
170 Ga0105241_10020890 3300009174 Bacteria 4841
171 Ga0105242_10071537 3300009176 Bacteria 2879
172 Ga0105237_10072192 3300009545 Bacteria 3445
173 Ga0105238_10007188 3300009551 Bacteria 11139
174 Ga0105249_10009297 3300009553 Bacteria 8595
175 Ga0105249_10036171 3300009553 Bacteria 4480
176 Ga0157373_10000135 3300013100 Bacteria 58081
177 Ga0157369_10009196 3300013105 Bacteria 11306
178 Ga0157369_10055994 3300013105 Bacteria 4255
179 Ga0157374_10096327 3300013296 Bacteria 2830
180 Ga0157378_10113418 3300013297 Bacteria 2488
181 Ga0163162_10009195 3300013306 Bacteria 9619
182 Ga0163162_10087831 3300013306 Unclassified 3188
183 Ga0163162_10146950 3300013306 Bacteria 2474
184 Ga0157372_10001621 3300013307 Bacteria 24404
185 Ga0157372_10016306 3300013307 Bacteria 7973
186 Ga0157372_10059706 3300013307 Bacteria 4266
187 Ga0157375_10174833 3300013308 Bacteria 2296
188 Ga0157375_10244732 3300013308 Bacteria 1953
189 Ga0163163_10061967 3300014325 Bacteria 3706
190 Ga0163163_10104816 3300014325 Bacteria 2853
191 Ga0157380_10087857 3300014326 Bacteria 2557
192 Ga0157380_10124639 3300014326 Bacteria 2188
193 Ga0157379_10131467 3300014968 Bacteria 2253
194 Ga0207653_10019799 3300025885 Bacteria 2123
195 Ga0207647_10093132 3300025904 Bacteria 1796
196 Ga0207645_10000639 3300025907 Bacteria 29117
197 Ga0207643_10000086 3300025908 Bacteria 61258
198 Ga0207643_10000110 3300025908 Bacteria 56123
199 Ga0207684_10000400 3300025910 Bacteria 57952
200 Ga0207684_10004604 3300025910 Bacteria 12954
201 Ga0207684_10007838 3300025910 Bacteria 9553
202 Ga0207684_10009149 3300025910 Bacteria 8767
203 Ga0207684_10028939 3300025910 Bacteria 4719
204 Ga0207684_10071581 3300025910 Bacteria 2946
205 Ga0207654_10000471 3300025911 Bacteria 22997
206 Ga0207707_10000019 3300025912 Bacteria 206008
207 Ga0207693_10006029 3300025915 Bacteria 10048
208 Ga0207660_10000163 3300025917 Bacteria 41683
209 Ga0207657_10000233 3300025919 Bacteria 58450
210 Ga0207657_10007160 3300025919 Bacteria 11459
211 Ga0207649_10004694 3300025920 Bacteria 7392
212 Ga0207649_10041259 3300025920 Bacteria 2809
213 Ga0207652_10000357 3300025921 Bacteria 47346
214 Ga0207646_10003573 3300025922 Bacteria 17447
215 Ga0207646_10006091 3300025922 Bacteria 12563
216 Ga0207646_10019129 3300025922 Bacteria 6369
217 Ga0207646_10037525 3300025922 Bacteria 4368
218 Ga0207646_10041827 3300025922 Bacteria 4118
219 Ga0207646_10081240 3300025922 Bacteria 2898
220 Ga0207646_10083953 3300025922 Bacteria 2849
221 Ga0207646_10117687 3300025922 Bacteria 2387
222 Ga0207681_10075765 3300025923 Bacteria 2361
223 Ga0207694_10020211 3300025924 Bacteria 5036
224 Ga0207650_10050838 3300025925 Bacteria 3066
225 Ga0207644_10049271 3300025931 Unclassified 3015
226 Ga0207690_10002423 3300025932 Bacteria 11285
227 Ga0207706_10003062 3300025933 Bacteria 16102
228 Ga0207709_10011764 3300025935 Bacteria 4824
229 Ga0207709_10150268 3300025935 Bacteria 1612
230 Ga0207670_10042269 3300025936 Bacteria 3002
231 Ga0207669_10002360 3300025937 Bacteria 8028
232 Ga0207665_10001755 3300025939 Bacteria 14551
233 Ga0207691_10034892 3300025940 Bacteria 4673
234 Ga0207689_10001778 3300025942 Bacteria 20355
235 Ga0207689_10013999 3300025942 Bacteria 6829
236 Ga0207689_10074934 3300025942 Bacteria 2781
237 Ga0207679_10000555 3300025945 Bacteria 25070
238 Ga0207679_10003451 3300025945 Bacteria 9758
239 Ga0207667_10008234 3300025949 Bacteria 12407
240 Ga0207667_10036091 3300025949 Bacteria 5301
241 Ga0207651_10011120 3300025960 Bacteria 5022
242 Ga0207640_10022558 3300025981 Bacteria 3770
243 Ga0207639_10000989 3300026041 Bacteria 19361
244 Ga0207678_10001255 3300026067 Bacteria 23409
245 Ga0207678_10038994 3300026067 Bacteria 4125
246 Ga0207708_10026664 3300026075 Bacteria 4375
247 Ga0207702_10002481 3300026078 Bacteria 17427
248 Ga0207702_10027108 3300026078 Bacteria 4757
249 Ga0207648_10003307 3300026089 Bacteria 16930
250 Ga0207676_10000813 3300026095 Bacteria 24336
251 Ga0207676_10107344 3300026095 Bacteria 2328
252 Ga0207674_10000046 3300026116 Bacteria 122047
253 Ga0207674_10000471 3300026116 Bacteria 52830
254 Ga0207674_10058559 3300026116 Bacteria 3902
255 Ga0207674_10076578 3300026116 Bacteria 3353
256 Ga0207675_100001759 3300026118 Bacteria 21671
257 Ga0207675_100086488 3300026118 Bacteria 2944
258 Ga0207698_10220797 3300026142 Bacteria 1712
259 Ga0209968_1002146 3300027526 Bacteria 2987
260 Ga0209999_1002995 3300027543 Bacteria 3002
261 Ga0209971_1000032 3300027682 Bacteria 49849
262 Ga0209966_1000076 3300027695 Bacteria 42927
263 Ga0209998_10000053 3300027717 Bacteria 47292
264 Ga0207428_10000299 3300027907 Bacteria 65352
265 Ga0207428_10011098 3300027907 Bacteria 8002
266 Ga0207428_10022273 3300027907 Bacteria 5351
267 Ga0268265_10042034 3300028380 Bacteria 3388
268 Ga0268265_10194918 3300028380 Bacteria 1753
269 Ga0268264_10002911 3300028381 Bacteria 14867
270 Ga0268264_10044511 3300028381 Bacteria 3683
271 Ga0268264_10052535 3300028381 Bacteria 3398
272 Ga0307415_100042682 3300032126 Unclassified 3020
273 Ga0373948_0006919 3300034817 Bacteria 1892
274 Ga0373949_0003264 3300035090 Bacteria 3906
275 Ga0373960_0015928 3300035121 Bacteria 1927
276 Ga0373931_0020296 3300035691 Bacteria 3323
277 Ga0395899_0009327 3300037312 Bacteria 7536
278 Ga0395900_0002218 3300037418 Bacteria 21700
279 Ga0395900_0013801 3300037418 Bacteria 8245
280 Ga0395900_0017871 3300037418 Bacteria 7238
281 Ga0395898_0050224 3300037466 Bacteria 4083
282 Ga0395898_0118908 3300037466 Bacteria 2531
283 Ga0395905_0010386 3300037471 Bacteria 9063
284 Ga0395901_0003631 3300038443 Bacteria 15566
285 Ga0395901_0005429 3300038443 Bacteria 12898
286 Ga0395901_0061729 3300038443 Bacteria 3900
287 Ga0400489_20133 3300039093 Bacteria 96058
288 Ga0439460_0002745 3300042461 Bacteria 4239
289 Ga0439460_0012433 3300042461 Bacteria 2210
290 Ga0451577_0001992 3300042876 Bacteria 25513
291 Ga0453683_0009320 3300044673 Bacteria 6559
292 Ga0453683_0020858 3300044673 Bacteria 4186
293 Ga0453683_0096182 3300044673 Bacteria 1858
294 Ga0453684_0000089 3300044712 Bacteria 395064
295 Ga0453684_0009126 3300044712 Bacteria 17467
296 Ga0453684_0182114 3300044712 Bacteria 2465
297 Ga0451576_0059757 3300045051 Bacteria 3978
298 Ga0451576_0149097 3300045051 Bacteria 2439
299 Ga0495603_0002562 3300046455 Bacteria 10718
300 Ga0495603_0004006 3300046455 Bacteria 8769
301 Ga0495641_0022980 3300046461 Bacteria 3109
302 Ga0495580_0024774 3300046472 Bacteria 4388
303 Ga0495580_0135275 3300046472 Bacteria 1709
304 Ga0495584_0039987 3300046491 Bacteria 2369
305 Ga0495585_0060393 3300046492 Bacteria 2086
306 Ga0495644_0004620 3300046523 Bacteria 5412
307 Ga0495656_0088958 3300046615 Bacteria 1409
308 Ga0495659_0011108 3300046664 Bacteria 2901
309 Ga0495659_0020858 3300046664 Bacteria 2204
310 Ga0495636_0053165 3300047318 Bacteria 1700
311 Ga0496106_0104959 3300048909 Bacteria 2195
312 Ga0496110_0273888 3300048913 Bacteria 1537
313 Ga0496113_0035298 3300048916 Bacteria 3656
314 Ga0501031_0012605 3300049568 Bacteria 5521
315 Ga0501033_0005511 3300049570 Bacteria 10014
316 Ga0501034_0014580 3300049571 Bacteria 8092
317 Ga0501036_0018179 3300049572 Bacteria 5887
318 Ga0501036_0045123 3300049572 Bacteria 3735
319 Ga0501037_0015391 3300049573 Bacteria 5627
320 Ga0501038_0057914 3300049574 Bacteria 3324
321 Ga0501039_0022743 3300049575 Bacteria 4809
322 Ga0501040_0000438 3300049576 Bacteria 24760
323 Ga0501040_0001237 3300049576 Bacteria 16226
324 Ga0501040_0007684 3300049576 Bacteria 6976
325 Ga0501040_0012642 3300049576 Bacteria 5536
326 Ga0501040_0022474 3300049576 Bacteria 4221
327 Ga0501040_0022957 3300049576 Bacteria 4180
328 Ga0501040_0041201 3300049576 Bacteria 3145
329 Ga0501040_0076289 3300049576 Bacteria 2317
330 Ga0501041_0014540 3300049577 Bacteria 4673
331 Ga0501041_0014793 3300049577 Bacteria 4634
332 Ga0501041_0027612 3300049577 Bacteria 3420
333 Ga0501042_0002328 3300049578 Bacteria 11626
334 Ga0501042_0005249 3300049578 Bacteria 8321
335 Ga0501042_0044749 3300049578 Bacteria 3154
336 Ga0501042_0118024 3300049578 Bacteria 1910
337 Ga0501042_0153965 3300049578 Bacteria 1658
338 Ga0501043_0006561 3300049579 Bacteria 9334
339 Ga0501043_0130701 3300049579 Bacteria 1968
340 Ga0501046_0000662 3300049580 Bacteria 33426
341 Ga0501046_0043531 3300049580 Bacteria 3574
342 Ga0501046_0131966 3300049580 Bacteria 1894
343 Ga0501047_0032664 3300049581 Bacteria 5026
344 Ga0501048_0004611 3300049582 Bacteria 10481
345 Ga0501048_0007299 3300049582 Bacteria 8382
346 Ga0501048_0025578 3300049582 Bacteria 4302
347 Ga0501048_0041825 3300049582 Bacteria 3282
348 Ga0501068_0005167 3300049584 Bacteria 7119
349 Ga0501069_0012326 3300049585 Bacteria 4542
350 Ga0501069_0028979 3300049585 Bacteria 3037
351 Ga0501070_0065317 3300049586 Bacteria 3012
352 Ga0501071_0002243 3300049587 Bacteria 11633
353 Ga0501071_0053371 3300049587 Bacteria 2915
354 Ga0501071_0093842 3300049587 Bacteria 2207
355 Ga0501072_0016757 3300049588 Bacteria 5629
356 Ga0501072_0045657 3300049588 Bacteria 3446
357 Ga0501072_0112970 3300049588 Bacteria 2162
358 Ga0501072_0190784 3300049588 Bacteria 1634
359 Ga0501074_0002847 3300049590 Bacteria 12111
360 Ga0501074_0007211 3300049590 Bacteria 8029
361 Ga0501075_0010692 3300049591 Bacteria 6459
362 Ga0501075_0045671 3300049591 Bacteria 3288
363 Ga0501075_0052607 3300049591 Bacteria 3062
364 Ga0501075_0068527 3300049591 Bacteria 2680
365 Ga0501076_0004545 3300049592 Bacteria 9882
366 Ga0501076_0008399 3300049592 Bacteria 7567
367 Ga0501076_0017581 3300049592 Bacteria 5437
368 Ga0501076_0021751 3300049592 Bacteria 4924
369 Ga0501076_0038636 3300049592 Bacteria 3748
370 Ga0501077_0028942 3300049593 Bacteria 3521
371 Ga0501077_0056873 3300049593 Bacteria 2483
372 Ga0501077_0062598 3300049593 Bacteria 2360
373 Ga0501077_0133780 3300049593 Bacteria 1572
374 Ga0501079_0000183 3300049741 Bacteria 35711
375 Ga0501079_0009309 3300049741 Bacteria 7445
376 Ga0501079_0011962 3300049741 Bacteria 6623
377 Ga0501079_0025004 3300049741 Bacteria 4581
378 Ga0501079_0135950 3300049741 Bacteria 1914
379 Ga0501080_0011600 3300049742 Bacteria 8070
380 Ga0501080_0012830 3300049742 Bacteria 7686
381 Ga0501080_0064010 3300049742 Bacteria 3422
382 Ga0501080_0135824 3300049742 Bacteria 2276
383 Ga0501080_0141206 3300049742 Bacteria 2226
384 Ga0501080_0142862 3300049742 Bacteria 2213
385 Ga0501081_0006799 3300049743 Bacteria 7436
386 Ga0501081_0007833 3300049743 Bacteria 6926
387 Ga0501081_0009279 3300049743 Bacteria 6408
388 Ga0501081_0015676 3300049743 Bacteria 5002
389 Ga0501083_0011808 3300049744 Bacteria 6121
390 Ga0501083_0020226 3300049744 Bacteria 4631
391 Ga0501083_0025444 3300049744 Bacteria 4098
392 Ga0501035_0024684 3300049822 Bacteria 5511
393 Ga0501035_0068474 3300049822 Bacteria 3147
394 Ga0501044_0011685 3300049823 Bacteria 9512
395 Ga0501045_0004182 3300049824 Bacteria 9965
396 Ga0501045_0017176 3300049824 Bacteria 5137
397 Ga0501045_0035886 3300049824 Bacteria 3600
398 nmdc:mga05p37_105119_c1 3300050507 Bacteria 3474
399 nmdc:mga05p37_182757_c1 3300050507 Bacteria 2550
400 nmdc:mga05p37_20273_c1 3300050507 Bacteria 8045
401 nmdc:mga05p37_204144_c1 3300050507 Bacteria 2392
402 nmdc:mga05p37_39319_c1 3300050507 Bacteria 5807
403 nmdc:mga05p37_39345_c1 3300050507 Bacteria 5806
404 nmdc:mga05p37_6217_c1 3300050507 Bacteria 14055
405 nmdc:mga09592_114742_c1 3300050508 Bacteria 2312
406 nmdc:mga09592_171588_c1 3300050508 Bacteria 1876
407 nmdc:mga09592_2362_c1 3300050508 Bacteria 15222
408 nmdc:mga0qj67_3106_c1 3300050509 Bacteria 11947
409 nmdc:mga06r32_125969_c1 3300050510 Bacteria 2530
410 nmdc:mga06r32_133401_c1 3300050510 Bacteria 2457
411 nmdc:mga06r32_180270_c1 3300050510 Bacteria 2098
412 nmdc:mga06r32_191280_c1 3300050510 Bacteria 2034
413 nmdc:mga06r32_2190_c1 3300050510 Bacteria 17506
414 nmdc:mga06r32_27544_c1 3300050510 Bacteria 5310
415 nmdc:mga06r32_7140_c1 3300050510 Bacteria 10064
416 nmdc:mga08y16_110127_c1 3300050511 Bacteria 2868
417 nmdc:mga08y16_258477_c1 3300050511 Bacteria 1799
418 nmdc:mga0n895_1080_c1 3300050512 Bacteria 19910
419 nmdc:mga0n895_167267_c1 3300050512 Bacteria 2230
420 nmdc:mga0n895_91946_c1 3300050512 Bacteria 3037
421 nmdc:mga0rr50_157517_c1 3300050513 Bacteria 1841
422 nmdc:mga0rr50_4859_c1 3300050513 Bacteria 7948
423 nmdc:mga08x19_34109_c1 3300050514 Bacteria 3215
424 nmdc:mga08x19_4137_c1 3300050514 Bacteria 8606
425 nmdc:mga0a205_118719_c1 3300050515 Bacteria 2543
426 nmdc:mga0a205_12274_c2 3300050515 Bacteria 6989
427 nmdc:mga0a205_16958_c1 3300050515 Bacteria 6818
428 nmdc:mga0a205_4600_c1 3300050515 Bacteria 12371
429 nmdc:mga0a205_58417_c1 3300050515 Bacteria 3726
430 nmdc:mga0a205_6164_c1 3300050515 Bacteria 10821
431 Ga0501084_0004054 3300054114 Bacteria 11930
432 Ga0501084_0006016 3300054114 Bacteria 9976
433 Ga0501084_0017127 3300054114 Bacteria 6020
434 Ga0501084_0027831 3300054114 Bacteria 4723
435 Ga0501084_0035685 3300054114 Bacteria 4156
436 Ga0501084_0096885 3300054114 Bacteria 2477
437 Ga0501084_0166387 3300054114 Bacteria 1861
438 Ga0501082_0009075 3300060353 Bacteria 8578
439 Ga0501082_0017300 3300060353 Bacteria 6210
440 Ga0501082_0070575 3300060353 Bacteria 3007
441 Ga0530510_0012091 3300061734 Bacteria 6057
442 Ga0530510_0042473 3300061734 Bacteria 3285
443 Ga0530510_0042905 3300061734 Bacteria 3267
444 Ga0530510_0070763 3300061734 Bacteria 2531
445 Ga0075428_100175198
446 JGI24751J29686_10000378
447 JGI26141J51220_1000198
448 Ga0070658_10079074
449 Ga0070676_10000427
450 Ga0070683_100010690
451 Ga0070690_100020675
452 Ga0070670_100039023
453 Ga0068869_100002472
454 Ga0068869_100008231
455 Ga0070680_100000568
456 Ga0070682_100000700
457 Ga0070660_100000101
458 Ga0070660_100003888
459 Ga0070661_100001100
460 Ga0070661_100003735
461 Ga0070661_100048938
462 Ga0070692_10000220
463 Ga0070675_100025320
464 Ga0070674_100004306
465 Ga0070673_100015384
466 Ga0070673_100181776
467 Ga0070659_100002337
468 Ga0070667_100107106
469 Ga0070703_10000029
470 Ga0070703_10001760
471 Ga0070714_100021548
472 Ga0070705_100003111
473 Ga0070700_100093930
474 Ga0070694_100092617
475 Ga0070694_100104362
476 Ga0070708_100006507
477 Ga0070708_100043647
478 Ga0070708_100058512
479 Ga0070708_100064118
480 Ga0070708_100067102
481 Ga0070708_100077118
482 Ga0070708_100099831
483 Ga0070708_100109347
484 Ga0070663_100079011
485 Ga0070681_10009774
486 Ga0068867_100046407
487 Ga0070706_100002601
488 Ga0070706_100006322
489 Ga0070706_100017157
490 Ga0070706_100061390
491 Ga0070706_100081072
492 Ga0070706_100090973
493 Ga0070706_100106214
494 Ga0070707_100005734
495 Ga0070707_100011887
496 Ga0070707_100018063
497 Ga0070707_100026309
498 Ga0070707_100047505
499 Ga0070707_100098161
500 Ga0070707_100121299
501 Ga0070707_100150335
502 Ga0070698_100011572
503 Ga0070698_100063001
504 Ga0070698_100090233
505 Ga0070699_100003803
506 Ga0070699_100008044
507 Ga0070699_100016311
508 Ga0070699_100025684
509 Ga0070699_100072054
510 Ga0070699_100120560
511 Ga0070679_100000816
512 Ga0070684_100022395
513 Ga0070684_100050187
514 Ga0070697_100024191
515 Ga0070697_100067928
516 Ga0070697_100144127
517 Ga0068853_100002651
518 Ga0070672_100161351
519 Ga0070695_100001364
520 Ga0070695_100004949
521 Ga0070695_100043970
522 Ga0070695_100063391
523 Ga0070696_100002144
524 Ga0070704_100000362
525 Ga0070704_100007486
526 Ga0068855_100090754
527 Ga0070664_100002159
528 Ga0070664_100027087
529 Ga0068857_100067770
530 Ga0068857_100118117
531 Ga0068854_100000477
532 Ga0068854_100009977
533 Ga0068854_100089640
534 Ga0068856_100033670
535 Ga0068852_100005694
536 Ga0068852_100233049
537 Ga0068859_100013971
538 Ga0068859_100020356
539 Ga0068859_100149319
540 Ga0068864_100051655
541 Ga0068861_100002177
542 Ga0068851_10006340
543 Ga0068851_10057391
544 Ga0068870_10000182
545 Ga0068870_10001376
546 Ga0068863_100002467
547 Ga0068863_100101383
548 Ga0068858_100046963
549 Ga0068860_100111023
550 Ga0068862_100028701
551 Ga0081455_10001199
552 Ga0081455_10001558
553 Ga0081455_10003494
554 Ga0081455_10004277
555 Ga0081455_10048514
556 Ga0081455_10055847
557 Ga0081538_10006152
558 Ga0081538_10012463
559 Ga0075432_10008518
560 Ga0075432_10017711
561 Ga0070716_100003747
562 Ga0070712_100002745
563 Ga0068871_100098746
564 Ga0075428_100034904
565 Ga0075428_100098220
566 Ga0075428_100175864
567 Ga0075430_100000679
568 Ga0075430_100050198
569 Ga0075430_100076239
570 Ga0075431_100000281
571 Ga0075431_100000841
572 Ga0075431_100014398
573 Ga0075431_100029650
574 Ga0075431_100074468
575 Ga0075433_10010172
576 Ga0075433_10011431
577 Ga0075433_10062366
578 Ga0075434_100004151
579 Ga0075434_100013305
580 Ga0075434_100018458
581 Ga0075434_100018515
582 Ga0075434_100039576
583 Ga0075434_100112202
584 Ga0075434_100191408
585 Ga0075429_100000341
586 Ga0075429_100101327
587 Ga0075429_100146533
588 Ga0075436_100070349
589 Ga0075436_100072685
590 Ga0097620_100013971
591 Ga0097620_100020358
592 Ga0097620_100149311
593 Ga0075435_100001409
594 Ga0075435_100005296
595 Ga0075435_100077388
596 Ga0105240_10025748
597 Ga0111539_10003279
598 Ga0111539_10004706
599 Ga0111539_10011917
600 Ga0111539_10012772
601 Ga0111539_10085311
602 Ga0105247_10059388
603 Ga0114129_10004971
604 Ga0114129_10032196
605 Ga0114129_10041536
606 Ga0114129_10059175
607 Ga0114129_10073936
608 Ga0114129_10086326
609 Ga0114129_10260895
610 Ga0114129_10272237
611 Ga0105243_10011358
612 Ga0105243_10088713
613 Ga0105241_10000707
614 Ga0105241_10020890
615 Ga0105242_10071537
616 Ga0105237_10072192
617 Ga0105238_10007188
618 Ga0105249_10009297
619 Ga0105249_10036171
620 Ga0157373_10000135
621 Ga0157369_10009196
622 Ga0157369_10055994
623 Ga0157374_10096327
624 Ga0157378_10113418
625 Ga0163162_10009195
626 Ga0163162_10087831
627 Ga0163162_10146950
628 Ga0157372_10001621
629 Ga0157372_10016306
630 Ga0157372_10059706
631 Ga0157375_10174833
632 Ga0157375_10244732
633 Ga0163163_10061967
634 Ga0163163_10104816
635 Ga0157380_10087857
636 Ga0157380_10124639
637 Ga0157379_10131467
638 Ga0207653_10019799
639 Ga0207647_10093132
640 Ga0207645_10000639
641 Ga0207643_10000086
642 Ga0207643_10000110
643 Ga0207684_10000400
644 Ga0207684_10004604
645 Ga0207684_10007838
646 Ga0207684_10009149
647 Ga0207684_10028939
648 Ga0207684_10071581
649 Ga0207654_10000471
650 Ga0207707_10000019
651 Ga0207693_10006029
652 Ga0207660_10000163
653 Ga0207657_10000233
654 Ga0207657_10007160
655 Ga0207649_10004694
656 Ga0207649_10041259
657 Ga0207652_10000357
658 Ga0207646_10003573
659 Ga0207646_10006091
660 Ga0207646_10019129
661 Ga0207646_10037525
662 Ga0207646_10041827
663 Ga0207646_10081240
664 Ga0207646_10083953
665 Ga0207646_10117687
666 Ga0207681_10075765
667 Ga0207694_10020211
668 Ga0207650_10050838
669 Ga0207644_10049271
670 Ga0207690_10002423
671 Ga0207706_10003062
672 Ga0207709_10011764
673 Ga0207709_10150268
674 Ga0207670_10042269
675 Ga0207669_10002360
676 Ga0207665_10001755
677 Ga0207691_10034892
678 Ga0207689_10001778
679 Ga0207689_10013999
680 Ga0207689_10074934
681 Ga0207679_10000555
682 Ga0207679_10003451
683 Ga0207667_10008234
684 Ga0207667_10036091
685 Ga0207651_10011120
686 Ga0207640_10022558
687 Ga0207639_10000989
688 Ga0207678_10001255
689 Ga0207678_10038994
690 Ga0207708_10026664
691 Ga0207702_10002481
692 Ga0207702_10027108
693 Ga0207648_10003307
694 Ga0207676_10000813
695 Ga0207676_10107344
696 Ga0207674_10000046
697 Ga0207674_10000471
698 Ga0207674_10058559
699 Ga0207674_10076578
700 Ga0207675_100001759
701 Ga0207675_100086488
702 Ga0207698_10220797
703 Ga0209968_1002146
704 Ga0209999_1002995
705 Ga0209971_1000032
706 Ga0209966_1000076
707 Ga0209998_10000053
708 Ga0207428_10000299
709 Ga0207428_10011098
710 Ga0207428_10022273
711 Ga0268265_10042034
712 Ga0268265_10194918
713 Ga0268264_10002911
714 Ga0268264_10044511
715 Ga0268264_10052535
716 Ga0307415_100042682
717 Ga0373948_0006919
718 Ga0373949_0003264
719 Ga0373960_0015928
720 Ga0373931_0020296
721 Ga0395899_0009327
722 Ga0395900_0002218
723 Ga0395900_0013801
724 Ga0395900_0017871
725 Ga0395898_0050224
726 Ga0395898_0118908
727 Ga0395905_0010386
728 Ga0395901_0003631
729 Ga0395901_0005429
730 Ga0395901_0061729
731 Ga0400489_20133
732 Ga0439460_0002745
733 Ga0439460_0012433
734 Ga0451577_0001992
735 Ga0453683_0009320
736 Ga0453683_0020858
737 Ga0453683_0096182
738 Ga0453684_0000089
739 Ga0453684_0009126
740 Ga0453684_0182114
741 Ga0451576_0059757
742 Ga0451576_0149097
743 Ga0495603_0002562
744 Ga0495603_0004006
745 Ga0495641_0022980
746 Ga0495580_0024774
747 Ga0495580_0135275
748 Ga0495584_0039987
749 Ga0495585_0060393
750 Ga0495644_0004620
751 Ga0495656_0088958
752 Ga0495659_0011108
753 Ga0495659_0020858
754 Ga0495636_0053165
755 Ga0496106_0104959
756 Ga0496110_0273888
757 Ga0496113_0035298
758 Ga0501031_0012605
759 Ga0501033_0005511
760 Ga0501034_0014580
761 Ga0501036_0018179
762 Ga0501036_0045123
763 Ga0501037_0015391
764 Ga0501038_0057914
765 Ga0501039_0022743
766 Ga0501040_0000438
767 Ga0501040_0001237
768 Ga0501040_0007684
769 Ga0501040_0012642
770 Ga0501040_0022474
771 Ga0501040_0022957
772 Ga0501040_0041201
773 Ga0501040_0076289
774 Ga0501041_0014540
775 Ga0501041_0014793
776 Ga0501041_0027612
777 Ga0501042_0002328
778 Ga0501042_0005249
779 Ga0501042_0044749
780 Ga0501042_0118024
781 Ga0501042_0153965
782 Ga0501043_0006561
783 Ga0501043_0130701
784 Ga0501046_0000662
785 Ga0501046_0043531
786 Ga0501046_0131966
787 Ga0501047_0032664
788 Ga0501048_0004611
789 Ga0501048_0007299
790 Ga0501048_0025578
791 Ga0501048_0041825
792 Ga0501068_0005167
793 Ga0501069_0012326
794 Ga0501069_0028979
795 Ga0501070_0065317
796 Ga0501071_0002243
797 Ga0501071_0053371
798 Ga0501071_0093842
799 Ga0501072_0016757
800 Ga0501072_0045657
801 Ga0501072_0112970
802 Ga0501072_0190784
803 Ga0501074_0002847
804 Ga0501074_0007211
805 Ga0501075_0010692
806 Ga0501075_0045671
807 Ga0501075_0052607
808 Ga0501075_0068527
809 Ga0501076_0004545
810 Ga0501076_0008399
811 Ga0501076_0017581
812 Ga0501076_0021751
813 Ga0501076_0038636
814 Ga0501077_0028942
815 Ga0501077_0056873
816 Ga0501077_0062598
817 Ga0501077_0133780
818 Ga0501079_0000183
819 Ga0501079_0009309
820 Ga0501079_0011962
821 Ga0501079_0025004
822 Ga0501079_0135950
823 Ga0501080_0011600
824 Ga0501080_0012830
825 Ga0501080_0064010
826 Ga0501080_0135824
827 Ga0501080_0141206
828 Ga0501080_0142862
829 Ga0501081_0006799
830 Ga0501081_0007833
831 Ga0501081_0009279
832 Ga0501081_0015676
833 Ga0501083_0011808
834 Ga0501083_0020226
835 Ga0501083_0025444
836 Ga0501035_0024684
837 Ga0501035_0068474
838 Ga0501044_0011685
839 Ga0501045_0004182
840 Ga0501045_0017176
841 Ga0501045_0035886
842 nmdc:mga05p37_105119_c1
843 nmdc:mga05p37_182757_c1
844 nmdc:mga05p37_20273_c1
845 nmdc:mga05p37_204144_c1
846 nmdc:mga05p37_39319_c1
847 nmdc:mga05p37_39345_c1
848 nmdc:mga05p37_6217_c1
849 nmdc:mga09592_114742_c1
850 nmdc:mga09592_171588_c1
851 nmdc:mga09592_2362_c1
852 nmdc:mga0qj67_3106_c1
853 nmdc:mga06r32_125969_c1
854 nmdc:mga06r32_133401_c1
855 nmdc:mga06r32_180270_c1
856 nmdc:mga06r32_191280_c1
857 nmdc:mga06r32_2190_c1
858 nmdc:mga06r32_27544_c1
859 nmdc:mga06r32_7140_c1
860 nmdc:mga08y16_110127_c1
861 nmdc:mga08y16_258477_c1
862 nmdc:mga0n895_1080_c1
863 nmdc:mga0n895_167267_c1
864 nmdc:mga0n895_91946_c1
865 nmdc:mga0rr50_157517_c1
866 nmdc:mga0rr50_4859_c1
867 nmdc:mga08x19_34109_c1
868 nmdc:mga08x19_4137_c1
869 nmdc:mga0a205_118719_c1
870 nmdc:mga0a205_12274_c2
871 nmdc:mga0a205_16958_c1
872 nmdc:mga0a205_4600_c1
873 nmdc:mga0a205_58417_c1
874 nmdc:mga0a205_6164_c1
875 Ga0501084_0004054
876 Ga0501084_0006016
877 Ga0501084_0017127
878 Ga0501084_0027831
879 Ga0501084_0035685
880 Ga0501084_0096885
881 Ga0501084_0166387
882 Ga0501082_0009075
883 Ga0501082_0017300
884 Ga0501082_0070575
885 Ga0530510_0012091
886 Ga0530510_0042473
887 Ga0530510_0042905
888 Ga0530510_0070763

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03841

SelA

L-seryl-tRNA selenium transferase

120

486

1

PF12390

Se-cys_synth_N

Selenocysteine synthase N terminal

40

79

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w1i-assembly1.cif.gz_E crystal structure of the n-terminal truncated selenocysteine synthase sela 0.9406 22 397
3wco-assembly1.cif.gz_A crystal structure of the depentamerized mutant of n-terminal truncated selenocysteine synthase sela 0.9368 21 396
3wco-assembly1.cif.gz_B crystal structure of the depentamerized mutant of n-terminal truncated selenocysteine synthase sela 0.9291 21 396
3wcn-assembly1.cif.gz_B crystal structure of the depentamerized mutant of selenocysteine synthase sela 0.9251 1 397
3w1h-assembly1.cif.gz_A crystal structure of the selenocysteine synthase sela from aquifex aeolicus 0.921 3 397
ID Description Score Start End Superfamily
3wcnB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9375 38 293 3.40.640.10
3wcnB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9304 38 293 3.40.640.10
3w1iA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8485 296 397 3.90.1150.180
1pffB01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8176 73 279 3.40.640.10
3e6gD01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8164 71 276 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A1J5B7M6-F1-model_v4 L-seryl-tRNA(Sec) selenium transferase 0.9754 88 283 GO:0001514
GO:0004125
GO:0005737
AF-A0A656KYA9-F1-model_v4 deleted 0.9712 87 277
AF-X1MGE2-F1-model_v4 L-seryl-tRNA selenium transferase N-terminal domain-containing protein 0.9688 53 315 GO:0001514
GO:0004125
GO:0005737
AF-A0A7X5WN91-F1-model_v4 L-seryl-tRNA(Sec) selenium transferase (EC 2.9.1.1) 0.9682 74 259 GO:0001514
GO:0004125
GO:0005737
AF-A0A0A0CWA9-F1-model_v4 Selenocysteine synthase 0.9671 24 270 GO:0001514
GO:0004125
GO:0005737

Map