F445254

General Info

Members Datasets Scaffolds Average Seq Length
444 229 888 103

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10670088|Ga0070717_106700881
Length 117
Sequence MIRTAVILRPMDDPNRPERQINIHFSPEIMAGVYANFANVSHSEYEFTVTFARVDHEVEEEEIPGVVVSRINLSPKFMRELIDAMQDNYSKWETREGIKNLPEYPGRPDYDEPESDE

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 0
Rhizoplane 5.41
Rhizosphere 79.05
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10670088 3300006028 Bacteria 942
2 CNAas_1016809 3300000532 Bacteria 522
3 JGI24737J22298_10106918 3300001990 Bacteria 829
4 JGI24738J21930_10056596 3300002075 Bacteria 802
5 JGI24034J26672_10078782 3300002239 Bacteria 599
6 JGI25407J50210_10005341 3300003373 Bacteria 3154
7 JGI25407J50210_10054989 3300003373 Bacteria 1005
8 Ga0058862_10015823 3300004803 Bacteria 798
9 Ga0070658_10099012 3300005327 Bacteria 2409
10 Ga0070658_10881457 3300005327 Bacteria 778
11 Ga0070683_100046638 3300005329 Bacteria 4004
12 Ga0070680_100522227 3300005336 Bacteria 1016
13 Ga0070682_100115822 3300005337 Bacteria 1792
14 Ga0068868_100029726 3300005338 Bacteria 4186
15 Ga0068868_101081805 3300005338 Bacteria 737
16 Ga0068868_102171692 3300005338 Bacteria 529
17 Ga0070660_100092477 3300005339 Bacteria 2387
18 Ga0070691_10361435 3300005341 Bacteria 809
19 Ga0070661_101176745 3300005344 Bacteria 641
20 Ga0070692_10548839 3300005345 Bacteria 757
21 Ga0070659_100203817 3300005366 Bacteria 1629
22 Ga0070709_10053083 3300005434 Bacteria 2551
23 Ga0070709_11121417 3300005434 Bacteria 630
24 Ga0070713_100257743 3300005436 Bacteria 1593
25 Ga0070710_10146284 3300005437 Bacteria 1454
26 Ga0070711_100378102 3300005439 Bacteria 1145
27 Ga0070700_100729365 3300005441 Bacteria 791
28 Ga0070694_100161180 3300005444 Bacteria 1646
29 Ga0070694_101850945 3300005444 Bacteria 515
30 Ga0070678_100846430 3300005456 Bacteria 833
31 Ga0070681_10083290 3300005458 Bacteria 3152
32 Ga0070679_100194079 3300005530 Bacteria 1998
33 Ga0070684_102157182 3300005535 Bacteria 526
34 Ga0070686_100314951 3300005544 Bacteria 1165
35 Ga0070665_101355717 3300005548 Bacteria 721
36 Ga0068855_101600435 3300005563 Bacteria 666
37 Ga0068857_100415222 3300005577 Bacteria 1254
38 Ga0068854_100073743 3300005578 Bacteria 2502
39 Ga0070702_100375977 3300005615 Bacteria 1009
40 Ga0068852_100210695 3300005616 Bacteria 1843
41 Ga0068866_10172155 3300005718 Bacteria 1272
42 Ga0068858_100678866 3300005842 Bacteria 1002
43 Ga0081455_10110298 3300005937 Bacteria 2187
44 Ga0081538_10001367 3300005981 Bacteria 25112
45 Ga0081538_10006138 3300005981 Bacteria 10659
46 Ga0081538_10014967 3300005981 Bacteria 6037
47 Ga0081538_10153071 3300005981 Bacteria 1040
48 Ga0081538_10385904 3300005981 Bacteria 505
49 Ga0070717_10055474 3300006028 Bacteria 3270
50 Ga0070717_10113672 3300006028 Bacteria 2312
51 Ga0070717_10367894 3300006028 Bacteria 1288
52 Ga0075363_100212288 3300006048 Bacteria 1108
53 Ga0075364_10752524 3300006051 Bacteria 665
54 Ga0070716_100218438 3300006173 Bacteria 1279
55 Ga0070712_100018433 3300006175 Bacteria 4535
56 Ga0070712_100174452 3300006175 Bacteria 1671
57 Ga0070712_100660634 3300006175 Bacteria 889
58 Ga0075367_10592925 3300006178 Bacteria 704
59 Ga0097621_101430479 3300006237 Bacteria 655
60 Ga0075431_101022591 3300006847 Bacteria 793
61 Ga0075434_100000388 3300006871 Bacteria 32133
62 Ga0068865_102140495 3300006881 Bacteria 509
63 Ga0075436_100004450 3300006914 Bacteria 9614
64 Ga0075435_100006282 3300007076 Bacteria 8388
65 Ga0105240_10036109 3300009093 Bacteria 6362
66 Ga0111539_12579691 3300009094 Bacteria 589
67 Ga0105245_10074558 3300009098 Bacteria 3088
68 Ga0105247_10157652 3300009101 Bacteria 1500
69 Ga0114129_11788578 3300009147 Bacteria 748
70 Ga0105243_10671483 3300009148 Bacteria 1007
71 Ga0105241_10569224 3300009174 Bacteria 1020
72 Ga0105242_10898777 3300009176 Bacteria 885
73 Ga0105237_10628082 3300009545 Bacteria 1081
74 Ga0105238_10132651 3300009551 Bacteria 2469
75 Ga0105239_10153398 3300010375 Bacteria 2571
76 Ga0105239_10336102 3300010375 Bacteria 1704
77 Ga0105246_10018493 3300011119 Bacteria 4443
78 Ga0157342_1046034 3300012507 Unclassified 599
79 Ga0157370_10154007 3300013104 Bacteria 2139
80 Ga0157369_10133576 3300013105 Bacteria 2628
81 Ga0157369_11278408 3300013105 Bacteria 748
82 Ga0157374_10059987 3300013296 Bacteria 3559
83 Ga0157378_11870226 3300013297 Bacteria 649
84 Ga0163162_11985060 3300013306 Bacteria 667
85 Ga0157372_10184512 3300013307 Bacteria 2416
86 Ga0157372_10263127 3300013307 Bacteria 2003
87 Ga0157372_11150692 3300013307 Bacteria 897
88 Ga0157372_11678092 3300013307 Bacteria 731
89 Ga0157375_12742956 3300013308 Bacteria 589
90 Ga0157377_10220181 3300014745 Bacteria 1215
91 Ga0157376_10657204 3300014969 Bacteria 1049
92 Ga0157376_10773595 3300014969 Bacteria 971
93 Ga0206356_11317595 3300020070 Bacteria 1248
94 Ga0206354_10572613 3300020081 Bacteria 856
95 Ga0154015_1141571 3300020610 Bacteria 621
96 Ga0213874_10005657 3300021377 Bacteria 2924
97 Ga0213874_10046800 3300021377 Bacteria 1314
98 Ga0213874_10131915 3300021377 Bacteria 859
99 Ga0213874_10458858 3300021377 Bacteria 504
100 Ga0213876_10012464 3300021384 Bacteria 4525
101 Ga0213876_10029325 3300021384 Unclassified 2899
102 Ga0213876_10038369 3300021384 Bacteria 2528
103 Ga0213876_10060383 3300021384 Bacteria 2000
104 Ga0213876_10113138 3300021384 Bacteria 1440
105 Ga0213875_10000095 3300021388 Bacteria 102332
106 Ga0213875_10036537 3300021388 Bacteria 2316
107 Ga0213875_10118607 3300021388 Bacteria 1236
108 Ga0213875_10241168 3300021388 Bacteria 852
109 Ga0213875_10347312 3300021388 Bacteria 704
110 Ga0213875_10443083 3300021388 Bacteria 621
111 Ga0207692_10088117 3300025898 Bacteria 1677
112 Ga0207642_10254018 3300025899 Bacteria 999
113 Ga0207699_10020116 3300025906 Bacteria 3572
114 Ga0207699_10144710 3300025906 Bacteria 1566
115 Ga0207699_11147674 3300025906 Bacteria 575
116 Ga0207705_10319368 3300025909 Bacteria 1193
117 Ga0207654_10727308 3300025911 Bacteria 714
118 Ga0207707_10074006 3300025912 Bacteria 2971
119 Ga0207695_10301032 3300025913 Bacteria 1495
120 Ga0207671_10509209 3300025914 Bacteria 960
121 Ga0207671_10900902 3300025914 Bacteria 699
122 Ga0207693_10041340 3300025915 Bacteria 3629
123 Ga0207693_10769114 3300025915 Bacteria 743
124 Ga0207663_10062848 3300025916 Bacteria 2362
125 Ga0207660_10265997 3300025917 Bacteria 1357
126 Ga0207657_10038152 3300025919 Bacteria 4281
127 Ga0207694_10535497 3300025924 Bacteria 982
128 Ga0207700_10071535 3300025928 Bacteria 2671
129 Ga0207700_10091170 3300025928 Bacteria 2407
130 Ga0207700_10253009 3300025928 Bacteria 1506
131 Ga0207664_10100480 3300025929 Bacteria 2388
132 Ga0207664_10201845 3300025929 Bacteria 1717
133 Ga0207664_10216393 3300025929 Bacteria 1660
134 Ga0207644_10733605 3300025931 Bacteria 825
135 Ga0207686_10601605 3300025934 Bacteria 865
136 Ga0207709_10438194 3300025935 Bacteria 1007
137 Ga0207704_10325790 3300025938 Bacteria 1187
138 Ga0207665_10289338 3300025939 Bacteria 1222
139 Ga0207665_10313948 3300025939 Bacteria 1175
140 Ga0207711_10049524 3300025941 Bacteria 3596
141 Ga0207661_10460158 3300025944 Bacteria 1159
142 Ga0207661_11284430 3300025944 Bacteria 673
143 Ga0207661_11296916 3300025944 Bacteria 669
144 Ga0207667_11434206 3300025949 Bacteria 663
145 Ga0207640_10534833 3300025981 Bacteria 982
146 Ga0207677_10489627 3300026023 Bacteria 1061
147 Ga0207674_10087097 3300026116 Bacteria 3117
148 Ga0209813_10332031 3300027866 Bacteria 598
149 Ga0268266_10068490 3300028379 Bacteria 3073
150 Ga0268266_11048143 3300028379 Bacteria 789
151 Ga0307405_10032025 3300031731 Bacteria 3102
152 Ga0307413_10033251 3300031824 Bacteria 2934
153 Ga0307410_10098915 3300031852 Bacteria 2087
154 Ga0307406_10005176 3300031901 Bacteria 7121
155 Ga0307407_10313364 3300031903 Bacteria 1098
156 Ga0307412_10223021 3300031911 Unclassified 1446
157 Ga0307409_100029525 3300031995 Bacteria 3925
158 Ga0307409_100292454 3300031995 Bacteria 1511
159 Ga0307409_101175066 3300031995 Bacteria 790
160 Ga0307416_100075436 3300032002 Bacteria 2822
161 Ga0307411_10261876 3300032005 Bacteria 1366
162 Ga0307415_100001837 3300032126 Bacteria 10407
163 Ga0307415_101162675 3300032126 Bacteria 725
164 Ga0373954_0033613 3300035118 Bacteria 2373
165 Ga0373956_0092156 3300035119 Bacteria 1399
166 Ga0373943_0307230 3300035170 Bacteria 902
167 Ga0373946_0340650 3300035171 Bacteria 748
168 Ga0373955_0596814 3300035172 Bacteria 676
169 Ga0373931_0351328 3300035691 Bacteria 923
170 Ga0373935_1233961 3300035692 Bacteria 558
171 Ga0373935_1443619 3300035692 Bacteria 515
172 Ga0373947_0356770 3300035725 Bacteria 982
173 Ga0373947_1050983 3300035725 Bacteria 555
174 Ga0395899_0127795 3300037312 Unclassified 1817
175 Ga0395900_0081329 3300037418 Bacteria 3328
176 Ga0395898_0148893 3300037466 Unclassified 2240
177 Ga0395898_1127651 3300037466 Bacteria 717
178 Ga0395905_0109378 3300037471 Bacteria 2595
179 Ga0436364_0055825 3300037853 Bacteria 1665
180 Ga0436364_0076845 3300037853 Bacteria 2249
181 Ga0436364_0205244 3300037853 Bacteria 846
182 Ga0436364_0221062 3300037853 Bacteria 4320
183 Ga0436364_0287262 3300037853 Bacteria 10374
184 Ga0436364_0300582 3300037853 Bacteria 9432
185 Ga0436364_0357463 3300037853 Bacteria 720
186 Ga0436364_0776080 3300037853 Bacteria 570
187 Ga0436364_0897576 3300037853 Bacteria 947
188 Ga0436364_1029330 3300037853 Bacteria 2776
189 Ga0436364_1056446 3300037853 Bacteria 11279
190 Ga0436364_1179857 3300037853 Bacteria 943
191 Ga0436364_1294613 3300037853 Bacteria 100298
192 Ga0436364_1417216 3300037853 Bacteria 9840
193 Ga0395901_0018298 3300038443 Bacteria 7153
194 Ga0395901_0399884 3300038443 Bacteria 1411
195 Ga0395901_0591350 3300038443 Bacteria 1120
196 Ga0436365_0025097 3300039437 Bacteria 2252
197 Ga0436365_0172991 3300039437 Bacteria 904
198 Ga0436365_0500775 3300039437 Bacteria 1210
199 Ga0436365_0891817 3300039437 Bacteria 1723
200 Ga0436365_0912124 3300039437 Bacteria 5815
201 Ga0436365_1002678 3300039437 Bacteria 16809
202 Ga0436365_1075923 3300039437 Bacteria 899
203 Ga0436365_1115023 3300039437 Bacteria 536
204 Ga0436365_1429388 3300039437 Bacteria 4771
205 Ga0436365_1472006 3300039437 Bacteria 1497
206 Ga0436365_1596534 3300039437 Bacteria 1111
207 Ga0436365_1792536 3300039437 Bacteria 2319
208 Ga0436365_1859971 3300039437 Bacteria 708
209 Ga0436360_0102495 3300039438 Bacteria 542
210 Ga0436360_0782364 3300039438 Bacteria 619
211 Ga0436360_1113055 3300039438 Bacteria 851
212 Ga0436361_0022653 3300039447 Bacteria 1365
213 Ga0436361_0846301 3300039447 Bacteria 769
214 Ga0436363_0212268 3300039450 Bacteria 3676
215 Ga0436363_0325175 3300039450 Bacteria 4036
216 Ga0436363_0459325 3300039450 Bacteria 795
217 Ga0436363_0510790 3300039450 Bacteria 7648
218 Ga0436363_0521182 3300039450 Bacteria 591
219 Ga0436363_0629398 3300039450 Bacteria 773
220 Ga0436363_0633694 3300039450 Bacteria 1061
221 Ga0436363_0666531 3300039450 Bacteria 1018
222 Ga0436363_0756466 3300039450 Bacteria 768
223 Ga0436363_1089702 3300039450 Bacteria 762
224 Ga0436363_1168151 3300039450 Bacteria 870
225 Ga0436363_1240269 3300039450 Bacteria 1228
226 Ga0436363_1263281 3300039450 Bacteria 824
227 Ga0436363_1388612 3300039450 Bacteria 898
228 Ga0436362_0254972 3300039453 Bacteria 1156
229 Ga0436362_0258901 3300039453 Bacteria 524
230 Ga0436362_0298307 3300039453 Bacteria 595
231 Ga0436362_0607827 3300039453 Bacteria 521
232 Ga0436362_0612740 3300039453 Bacteria 607
233 Ga0436362_0682063 3300039453 Bacteria 5087
234 Ga0436362_0688486 3300039453 Bacteria 1655
235 Ga0436362_0826062 3300039453 Bacteria 2975
236 Ga0436362_1155476 3300039453 Bacteria 2300
237 Ga0451853_0931589 3300041512 Bacteria 675
238 Ga0451853_3409768 3300041512 Bacteria 1232
239 Ga0439459_0216293 3300042438 Bacteria 529
240 Ga0466969_0028461 3300044656 Bacteria 2856
241 Ga0466969_0511807 3300044656 Bacteria 548
242 Ga0466965_0200415 3300044683 Bacteria 1058
243 Ga0466965_0385957 3300044683 Bacteria 772
244 Ga0466965_0765264 3300044683 Bacteria 557
245 Ga0466966_0046269 3300044684 Bacteria 2779
246 Ga0466966_0069768 3300044684 Bacteria 2204
247 Ga0466966_0241805 3300044684 Unclassified 1088
248 Ga0466966_0253753 3300044684 Bacteria 1059
249 Ga0466966_0547344 3300044684 Bacteria 696
250 Ga0466961_0007269 3300044693 Bacteria 7045
251 Ga0466961_0056280 3300044693 Bacteria 2506
252 Ga0466961_0207654 3300044693 Unclassified 1210
253 Ga0466961_0310279 3300044693 Bacteria 963
254 Ga0466961_0695010 3300044693 Bacteria 609
255 Ga0466963_0000273 3300044694 Bacteria 22985
256 Ga0466963_0001512 3300044694 Bacteria 12575
257 Ga0466963_0002501 3300044694 Bacteria 10288
258 Ga0466963_0003004 3300044694 Bacteria 9545
259 Ga0466963_0009736 3300044694 Bacteria 5798
260 Ga0466963_0054039 3300044694 Bacteria 2668
261 Ga0466963_0319786 3300044694 Bacteria 1092
262 Ga0466963_0754688 3300044694 Bacteria 686
263 Ga0466964_0014186 3300044706 Bacteria 3028
264 Ga0466964_0065533 3300044706 Bacteria 1522
265 Ga0466964_0067218 3300044706 Bacteria 1506
266 Ga0466971_0019308 3300044719 Bacteria 3026
267 Ga0466971_0125520 3300044719 Bacteria 1189
268 Ga0466971_0193602 3300044719 Bacteria 958
269 Ga0466971_0237230 3300044719 Unclassified 867
270 Ga0466968_0018561 3300044735 Bacteria 2791
271 Ga0466968_0042445 3300044735 Bacteria 1923
272 Ga0466968_0083523 3300044735 Bacteria 1407
273 Ga0466968_0096654 3300044735 Bacteria 1315
274 Ga0466968_0339624 3300044735 Bacteria 728
275 Ga0466968_0577848 3300044735 Bacteria 566
276 Ga0466968_0640724 3300044735 Bacteria 539
277 Ga0466970_0127104 3300044765 Bacteria 1398
278 Ga0466970_0146896 3300044765 Bacteria 1301
279 Ga0466970_0221132 3300044765 Bacteria 1057
280 Ga0466957_0006370 3300044842 Bacteria 6660
281 Ga0466957_0028198 3300044842 Bacteria 3341
282 Ga0466957_0140962 3300044842 Bacteria 1553
283 Ga0466957_0187279 3300044842 Bacteria 1354
284 Ga0466957_0298294 3300044842 Bacteria 1082
285 Ga0466957_0466484 3300044842 Unclassified 872
286 Ga0466957_0556333 3300044842 Bacteria 800
287 Ga0466957_0724349 3300044842 Bacteria 703
288 Ga0466957_0862889 3300044842 Bacteria 646
289 Ga0466957_1111333 3300044842 Bacteria 570
290 Ga0466960_0020114 3300044901 Bacteria 2953
291 Ga0466960_0203654 3300044901 Bacteria 1082
292 Ga0466960_0234230 3300044901 Bacteria 1014
293 Ga0466960_0274940 3300044901 Bacteria 942
294 Ga0466960_0798693 3300044901 Bacteria 571
295 Ga0466959_0006088 3300045049 Bacteria 8327
296 Ga0466959_0008059 3300045049 Bacteria 7426
297 Ga0466959_0067083 3300045049 Bacteria 2602
298 Ga0466959_0084678 3300045049 Bacteria 2282
299 Ga0466959_0159079 3300045049 Bacteria 1589
300 Ga0466959_0203027 3300045049 Bacteria 1379
301 Ga0466959_0239705 3300045049 Bacteria 1253
302 Ga0466959_0335975 3300045049 Bacteria 1031
303 Ga0466959_0413040 3300045049 Bacteria 916
304 Ga0466959_0595271 3300045049 Bacteria 744
305 Ga0466959_1175756 3300045049 Bacteria 510
306 Ga0466959_1183586 3300045049 Bacteria 508
307 Ga0466958_0002323 3300045836 Bacteria 9488
308 Ga0466958_0003716 3300045836 Bacteria 7970
309 Ga0466958_0010161 3300045836 Bacteria 5263
310 Ga0466958_0016844 3300045836 Bacteria 4216
311 Ga0466958_0029912 3300045836 Bacteria 3232
312 Ga0466958_0224213 3300045836 Bacteria 1199
313 Ga0466958_0293773 3300045836 Bacteria 1043
314 Ga0466958_0325059 3300045836 Bacteria 989
315 Ga0466958_0641921 3300045836 Bacteria 691
316 Ga0466967_0005548 3300045976 Bacteria 8760
317 Ga0466967_0011177 3300045976 Bacteria 6783
318 Ga0466967_0018788 3300045976 Bacteria 5537
319 Ga0466967_0035300 3300045976 Bacteria 4254
320 Ga0466967_0156541 3300045976 Bacteria 2135
321 Ga0466967_0203936 3300045976 Bacteria 1873
322 Ga0466967_0659463 3300045976 Bacteria 1035
323 Ga0466967_0886509 3300045976 Bacteria 887
324 Ga0466967_0987592 3300045976 Bacteria 838
325 Ga0495603_0071041 3300046455 Bacteria 2046
326 Ga0495641_0025584 3300046461 Bacteria 2896
327 Ga0495582_0095665 3300046473 Unclassified 1659
328 Ga0495639_0427473 3300046475 Unclassified 671
329 Ga0495664_0506720 3300046477 Bacteria 721
330 Ga0495608_0310742 3300046511 Bacteria 975
331 Ga0495630_0204258 3300046517 Bacteria 1508
332 Ga0495630_0707569 3300046517 Bacteria 771
333 Ga0495631_0233831 3300046518 Bacteria 784
334 Ga0495652_0116329 3300046529 Bacteria 2141
335 Ga0495652_0246250 3300046529 Bacteria 1327
336 Ga0495654_0278454 3300046530 Bacteria 689
337 Ga0495667_0506246 3300046559 Bacteria 756
338 Ga0495667_0592899 3300046559 Bacteria 691
339 Ga0495667_0762127 3300046559 Bacteria 598
340 Ga0495588_0189028 3300046674 Bacteria 1088
341 Ga0495646_0280311 3300046680 Bacteria 886
342 Ga0495658_0432722 3300046683 Bacteria 840
343 Ga0495649_0376364 3300046694 Bacteria 715
344 Ga0495581_0478020 3300047315 Bacteria 725
345 Ga0495581_0519855 3300047315 Bacteria 692
346 Ga0495604_0122211 3300047317 Bacteria 1883
347 Ga0495604_0285271 3300047317 Bacteria 1114
348 Ga0495672_0339452 3300047320 Bacteria 700
349 Ga0495683_0413685 3300047323 Bacteria 559
350 Ga0495614_0390295 3300048089 Bacteria 653
351 Ga0495626_0091031 3300048091 Bacteria 1341
352 Ga0496100_0034390 3300048903 Bacteria 3180
353 Ga0496101_0006777 3300048904 Bacteria 7387
354 Ga0496101_0884950 3300048904 Bacteria 703
355 Ga0496102_0211444 3300048905 Bacteria 1828
356 Ga0496102_0546845 3300048905 Bacteria 1081
357 Ga0496102_0631398 3300048905 Bacteria 994
358 Ga0496103_0219244 3300048906 Bacteria 1224
359 Ga0496104_0016308 3300048907 Bacteria 6744
360 Ga0496104_0055901 3300048907 Bacteria 3732
361 Ga0496104_0781690 3300048907 Bacteria 861
362 Ga0496105_0451561 3300048908 Bacteria 1015
363 Ga0496106_0949792 3300048909 Bacteria 677
364 Ga0496107_0068211 3300048910 Bacteria 2581
365 Ga0496108_0056813 3300048911 Bacteria 3289
366 Ga0496109_0077186 3300048912 Bacteria 3065
367 Ga0496109_0090000 3300048912 Bacteria 2838
368 Ga0496110_0021879 3300048913 Bacteria 5422
369 Ga0496110_0319102 3300048913 Bacteria 1415
370 Ga0496111_0092291 3300048914 Bacteria 2219
371 Ga0496112_0474971 3300048915 Bacteria 1187
372 Ga0496113_0328139 3300048916 Bacteria 1227
373 Ga0496113_0428313 3300048916 Bacteria 1063
374 Ga0496114_0005929 3300048917 Bacteria 9606
375 Ga0496114_0179717 3300048917 Bacteria 1847
376 Ga0496122_0447046 3300048925 Bacteria 642
377 Ga0501031_0225052 3300049568 Bacteria 1221
378 Ga0501031_0252034 3300049568 Bacteria 1147
379 Ga0501033_0992735 3300049570 Bacteria 561
380 Ga0501036_0034674 3300049572 Bacteria 4269
381 Ga0501036_0241574 3300049572 Bacteria 1514
382 Ga0501038_0746251 3300049574 Bacteria 730
383 Ga0501039_0043950 3300049575 Bacteria 3451
384 Ga0501041_0007935 3300049577 Bacteria 6241
385 Ga0501041_0022140 3300049577 Bacteria 3806
386 Ga0501041_0409380 3300049577 Bacteria 859
387 Ga0501042_0095207 3300049578 Bacteria 2139
388 Ga0501046_0530880 3300049580 Bacteria 840
389 Ga0501046_1011212 3300049580 Bacteria 577
390 Ga0501048_0188286 3300049582 Bacteria 1462
391 Ga0501067_0022279 3300049583 Bacteria 3506
392 Ga0501067_0043536 3300049583 Bacteria 2493
393 Ga0501068_0195708 3300049584 Bacteria 1282
394 Ga0501069_0016154 3300049585 Bacteria 4005
395 Ga0501069_0171581 3300049585 Bacteria 1252
396 Ga0501070_0815997 3300049586 Bacteria 732
397 Ga0501071_0024375 3300049587 Bacteria 4232
398 Ga0501071_0104016 3300049587 Bacteria 2095
399 Ga0501071_0374847 3300049587 Bacteria 1085
400 Ga0501071_0987984 3300049587 Bacteria 650
401 Ga0501072_0073239 3300049588 Bacteria 2708
402 Ga0501072_0232281 3300049588 Bacteria 1469
403 Ga0501072_0262597 3300049588 Bacteria 1374
404 Ga0501073_0209902 3300049589 Bacteria 1346
405 Ga0501074_0852912 3300049590 Bacteria 641
406 Ga0501075_0104813 3300049591 Bacteria 2149
407 Ga0501075_0619051 3300049591 Bacteria 826
408 Ga0501076_0024186 3300049592 Bacteria 4692
409 Ga0501076_0130553 3300049592 Bacteria 2037
410 Ga0501076_0909374 3300049592 Bacteria 725
411 Ga0501077_0073281 3300049593 Bacteria 2169
412 Ga0501079_0080297 3300049741 Bacteria 2522
413 Ga0501079_0264036 3300049741 Bacteria 1346
414 Ga0501081_0031867 3300049743 Bacteria 3573
415 Ga0501081_1453979 3300049743 Bacteria 520
416 Ga0501083_0949642 3300049744 Bacteria 559
417 Ga0501035_0057401 3300049822 Bacteria 3471
418 Ga0501045_0078249 3300049824 Bacteria 2438
419 Ga0501045_0562421 3300049824 Bacteria 845
420 nmdc:mga03n38_64950_c1 3300050490 Bacteria 1672
421 nmdc:mga00v17_783586_c1 3300050491 Bacteria 608
422 nmdc:mga06z11_535575_c1 3300050494 Bacteria 710
423 nmdc:mga05p37_1806651_c1 3300050507 Bacteria 589
424 nmdc:mga0n895_2502_c1 3300050512 Bacteria 14383
425 nmdc:mga0rr50_6122_c1 3300050513 Bacteria 7279
426 nmdc:mga0rr50_876624_c1 3300050513 Bacteria 765
427 nmdc:mga08x19_3461_c1 3300050514 Bacteria 9413
428 nmdc:mga08x19_661273_c1 3300050514 Bacteria 741
429 Ga0495601_0279688 3300053077 Bacteria 1088
430 Ga0495595_0118266 3300053084 Bacteria 1290
431 Ga0495595_0146602 3300053084 Bacteria 1160
432 Ga0495619_0758784 3300053085 Bacteria 658
433 Ga0500556_0000817 3300053104 Bacteria 17987
434 Ga0500616_0006286 3300053153 Bacteria 7810
435 Ga0500599_000627 3300053736 Bacteria 3761
436 Ga0501084_0111819 3300054114 Bacteria 2295
437 Ga0501084_0125200 3300054114 Bacteria 2162
438 Ga0590077_078870 3300059426 Bacteria 757
439 Ga0466962_0038065 3300061719 Bacteria 2304
440 Ga0466962_0144384 3300061719 Bacteria 1153
441 Ga0466962_0239994 3300061719 Bacteria 889
442 Ga0530510_0023703 3300061734 Bacteria 4376
443 Ga0530510_0042277 3300061734 Bacteria 3292
444 Ga0530510_0122342 3300061734 Bacteria 1911
445 Ga0070717_10670088
446 CNAas_1016809
447 JGI24737J22298_10106918
448 JGI24738J21930_10056596
449 JGI24034J26672_10078782
450 JGI25407J50210_10005341
451 JGI25407J50210_10054989
452 Ga0058862_10015823
453 Ga0070658_10099012
454 Ga0070658_10881457
455 Ga0070683_100046638
456 Ga0070680_100522227
457 Ga0070682_100115822
458 Ga0068868_100029726
459 Ga0068868_101081805
460 Ga0068868_102171692
461 Ga0070660_100092477
462 Ga0070691_10361435
463 Ga0070661_101176745
464 Ga0070692_10548839
465 Ga0070659_100203817
466 Ga0070709_10053083
467 Ga0070709_11121417
468 Ga0070713_100257743
469 Ga0070710_10146284
470 Ga0070711_100378102
471 Ga0070700_100729365
472 Ga0070694_100161180
473 Ga0070694_101850945
474 Ga0070678_100846430
475 Ga0070681_10083290
476 Ga0070679_100194079
477 Ga0070684_102157182
478 Ga0070686_100314951
479 Ga0070665_101355717
480 Ga0068855_101600435
481 Ga0068857_100415222
482 Ga0068854_100073743
483 Ga0070702_100375977
484 Ga0068852_100210695
485 Ga0068866_10172155
486 Ga0068858_100678866
487 Ga0081455_10110298
488 Ga0081538_10001367
489 Ga0081538_10006138
490 Ga0081538_10014967
491 Ga0081538_10153071
492 Ga0081538_10385904
493 Ga0070717_10055474
494 Ga0070717_10113672
495 Ga0070717_10367894
496 Ga0075363_100212288
497 Ga0075364_10752524
498 Ga0070716_100218438
499 Ga0070712_100018433
500 Ga0070712_100174452
501 Ga0070712_100660634
502 Ga0075367_10592925
503 Ga0097621_101430479
504 Ga0075431_101022591
505 Ga0075434_100000388
506 Ga0068865_102140495
507 Ga0075436_100004450
508 Ga0075435_100006282
509 Ga0105240_10036109
510 Ga0111539_12579691
511 Ga0105245_10074558
512 Ga0105247_10157652
513 Ga0114129_11788578
514 Ga0105243_10671483
515 Ga0105241_10569224
516 Ga0105242_10898777
517 Ga0105237_10628082
518 Ga0105238_10132651
519 Ga0105239_10153398
520 Ga0105239_10336102
521 Ga0105246_10018493
522 Ga0157342_1046034
523 Ga0157370_10154007
524 Ga0157369_10133576
525 Ga0157369_11278408
526 Ga0157374_10059987
527 Ga0157378_11870226
528 Ga0163162_11985060
529 Ga0157372_10184512
530 Ga0157372_10263127
531 Ga0157372_11150692
532 Ga0157372_11678092
533 Ga0157375_12742956
534 Ga0157377_10220181
535 Ga0157376_10657204
536 Ga0157376_10773595
537 Ga0206356_11317595
538 Ga0206354_10572613
539 Ga0154015_1141571
540 Ga0213874_10005657
541 Ga0213874_10046800
542 Ga0213874_10131915
543 Ga0213874_10458858
544 Ga0213876_10012464
545 Ga0213876_10029325
546 Ga0213876_10038369
547 Ga0213876_10060383
548 Ga0213876_10113138
549 Ga0213875_10000095
550 Ga0213875_10036537
551 Ga0213875_10118607
552 Ga0213875_10241168
553 Ga0213875_10347312
554 Ga0213875_10443083
555 Ga0207692_10088117
556 Ga0207642_10254018
557 Ga0207699_10020116
558 Ga0207699_10144710
559 Ga0207699_11147674
560 Ga0207705_10319368
561 Ga0207654_10727308
562 Ga0207707_10074006
563 Ga0207695_10301032
564 Ga0207671_10509209
565 Ga0207671_10900902
566 Ga0207693_10041340
567 Ga0207693_10769114
568 Ga0207663_10062848
569 Ga0207660_10265997
570 Ga0207657_10038152
571 Ga0207694_10535497
572 Ga0207700_10071535
573 Ga0207700_10091170
574 Ga0207700_10253009
575 Ga0207664_10100480
576 Ga0207664_10201845
577 Ga0207664_10216393
578 Ga0207644_10733605
579 Ga0207686_10601605
580 Ga0207709_10438194
581 Ga0207704_10325790
582 Ga0207665_10289338
583 Ga0207665_10313948
584 Ga0207711_10049524
585 Ga0207661_10460158
586 Ga0207661_11284430
587 Ga0207661_11296916
588 Ga0207667_11434206
589 Ga0207640_10534833
590 Ga0207677_10489627
591 Ga0207674_10087097
592 Ga0209813_10332031
593 Ga0268266_10068490
594 Ga0268266_11048143
595 Ga0307405_10032025
596 Ga0307413_10033251
597 Ga0307410_10098915
598 Ga0307406_10005176
599 Ga0307407_10313364
600 Ga0307412_10223021
601 Ga0307409_100029525
602 Ga0307409_100292454
603 Ga0307409_101175066
604 Ga0307416_100075436
605 Ga0307411_10261876
606 Ga0307415_100001837
607 Ga0307415_101162675
608 Ga0373954_0033613
609 Ga0373956_0092156
610 Ga0373943_0307230
611 Ga0373946_0340650
612 Ga0373955_0596814
613 Ga0373931_0351328
614 Ga0373935_1233961
615 Ga0373935_1443619
616 Ga0373947_0356770
617 Ga0373947_1050983
618 Ga0395899_0127795
619 Ga0395900_0081329
620 Ga0395898_0148893
621 Ga0395898_1127651
622 Ga0395905_0109378
623 Ga0436364_0055825
624 Ga0436364_0076845
625 Ga0436364_0205244
626 Ga0436364_0221062
627 Ga0436364_0287262
628 Ga0436364_0300582
629 Ga0436364_0357463
630 Ga0436364_0776080
631 Ga0436364_0897576
632 Ga0436364_1029330
633 Ga0436364_1056446
634 Ga0436364_1179857
635 Ga0436364_1294613
636 Ga0436364_1417216
637 Ga0395901_0018298
638 Ga0395901_0399884
639 Ga0395901_0591350
640 Ga0436365_0025097
641 Ga0436365_0172991
642 Ga0436365_0500775
643 Ga0436365_0891817
644 Ga0436365_0912124
645 Ga0436365_1002678
646 Ga0436365_1075923
647 Ga0436365_1115023
648 Ga0436365_1429388
649 Ga0436365_1472006
650 Ga0436365_1596534
651 Ga0436365_1792536
652 Ga0436365_1859971
653 Ga0436360_0102495
654 Ga0436360_0782364
655 Ga0436360_1113055
656 Ga0436361_0022653
657 Ga0436361_0846301
658 Ga0436363_0212268
659 Ga0436363_0325175
660 Ga0436363_0459325
661 Ga0436363_0510790
662 Ga0436363_0521182
663 Ga0436363_0629398
664 Ga0436363_0633694
665 Ga0436363_0666531
666 Ga0436363_0756466
667 Ga0436363_1089702
668 Ga0436363_1168151
669 Ga0436363_1240269
670 Ga0436363_1263281
671 Ga0436363_1388612
672 Ga0436362_0254972
673 Ga0436362_0258901
674 Ga0436362_0298307
675 Ga0436362_0607827
676 Ga0436362_0612740
677 Ga0436362_0682063
678 Ga0436362_0688486
679 Ga0436362_0826062
680 Ga0436362_1155476
681 Ga0451853_0931589
682 Ga0451853_3409768
683 Ga0439459_0216293
684 Ga0466969_0028461
685 Ga0466969_0511807
686 Ga0466965_0200415
687 Ga0466965_0385957
688 Ga0466965_0765264
689 Ga0466966_0046269
690 Ga0466966_0069768
691 Ga0466966_0241805
692 Ga0466966_0253753
693 Ga0466966_0547344
694 Ga0466961_0007269
695 Ga0466961_0056280
696 Ga0466961_0207654
697 Ga0466961_0310279
698 Ga0466961_0695010
699 Ga0466963_0000273
700 Ga0466963_0001512
701 Ga0466963_0002501
702 Ga0466963_0003004
703 Ga0466963_0009736
704 Ga0466963_0054039
705 Ga0466963_0319786
706 Ga0466963_0754688
707 Ga0466964_0014186
708 Ga0466964_0065533
709 Ga0466964_0067218
710 Ga0466971_0019308
711 Ga0466971_0125520
712 Ga0466971_0193602
713 Ga0466971_0237230
714 Ga0466968_0018561
715 Ga0466968_0042445
716 Ga0466968_0083523
717 Ga0466968_0096654
718 Ga0466968_0339624
719 Ga0466968_0577848
720 Ga0466968_0640724
721 Ga0466970_0127104
722 Ga0466970_0146896
723 Ga0466970_0221132
724 Ga0466957_0006370
725 Ga0466957_0028198
726 Ga0466957_0140962
727 Ga0466957_0187279
728 Ga0466957_0298294
729 Ga0466957_0466484
730 Ga0466957_0556333
731 Ga0466957_0724349
732 Ga0466957_0862889
733 Ga0466957_1111333
734 Ga0466960_0020114
735 Ga0466960_0203654
736 Ga0466960_0234230
737 Ga0466960_0274940
738 Ga0466960_0798693
739 Ga0466959_0006088
740 Ga0466959_0008059
741 Ga0466959_0067083
742 Ga0466959_0084678
743 Ga0466959_0159079
744 Ga0466959_0203027
745 Ga0466959_0239705
746 Ga0466959_0335975
747 Ga0466959_0413040
748 Ga0466959_0595271
749 Ga0466959_1175756
750 Ga0466959_1183586
751 Ga0466958_0002323
752 Ga0466958_0003716
753 Ga0466958_0010161
754 Ga0466958_0016844
755 Ga0466958_0029912
756 Ga0466958_0224213
757 Ga0466958_0293773
758 Ga0466958_0325059
759 Ga0466958_0641921
760 Ga0466967_0005548
761 Ga0466967_0011177
762 Ga0466967_0018788
763 Ga0466967_0035300
764 Ga0466967_0156541
765 Ga0466967_0203936
766 Ga0466967_0659463
767 Ga0466967_0886509
768 Ga0466967_0987592
769 Ga0495603_0071041
770 Ga0495641_0025584
771 Ga0495582_0095665
772 Ga0495639_0427473
773 Ga0495664_0506720
774 Ga0495608_0310742
775 Ga0495630_0204258
776 Ga0495630_0707569
777 Ga0495631_0233831
778 Ga0495652_0116329
779 Ga0495652_0246250
780 Ga0495654_0278454
781 Ga0495667_0506246
782 Ga0495667_0592899
783 Ga0495667_0762127
784 Ga0495588_0189028
785 Ga0495646_0280311
786 Ga0495658_0432722
787 Ga0495649_0376364
788 Ga0495581_0478020
789 Ga0495581_0519855
790 Ga0495604_0122211
791 Ga0495604_0285271
792 Ga0495672_0339452
793 Ga0495683_0413685
794 Ga0495614_0390295
795 Ga0495626_0091031
796 Ga0496100_0034390
797 Ga0496101_0006777
798 Ga0496101_0884950
799 Ga0496102_0211444
800 Ga0496102_0546845
801 Ga0496102_0631398
802 Ga0496103_0219244
803 Ga0496104_0016308
804 Ga0496104_0055901
805 Ga0496104_0781690
806 Ga0496105_0451561
807 Ga0496106_0949792
808 Ga0496107_0068211
809 Ga0496108_0056813
810 Ga0496109_0077186
811 Ga0496109_0090000
812 Ga0496110_0021879
813 Ga0496110_0319102
814 Ga0496111_0092291
815 Ga0496112_0474971
816 Ga0496113_0328139
817 Ga0496113_0428313
818 Ga0496114_0005929
819 Ga0496114_0179717
820 Ga0496122_0447046
821 Ga0501031_0225052
822 Ga0501031_0252034
823 Ga0501033_0992735
824 Ga0501036_0034674
825 Ga0501036_0241574
826 Ga0501038_0746251
827 Ga0501039_0043950
828 Ga0501041_0007935
829 Ga0501041_0022140
830 Ga0501041_0409380
831 Ga0501042_0095207
832 Ga0501046_0530880
833 Ga0501046_1011212
834 Ga0501048_0188286
835 Ga0501067_0022279
836 Ga0501067_0043536
837 Ga0501068_0195708
838 Ga0501069_0016154
839 Ga0501069_0171581
840 Ga0501070_0815997
841 Ga0501071_0024375
842 Ga0501071_0104016
843 Ga0501071_0374847
844 Ga0501071_0987984
845 Ga0501072_0073239
846 Ga0501072_0232281
847 Ga0501072_0262597
848 Ga0501073_0209902
849 Ga0501074_0852912
850 Ga0501075_0104813
851 Ga0501075_0619051
852 Ga0501076_0024186
853 Ga0501076_0130553
854 Ga0501076_0909374
855 Ga0501077_0073281
856 Ga0501079_0080297
857 Ga0501079_0264036
858 Ga0501081_0031867
859 Ga0501081_1453979
860 Ga0501083_0949642
861 Ga0501035_0057401
862 Ga0501045_0078249
863 Ga0501045_0562421
864 nmdc:mga03n38_64950_c1
865 nmdc:mga00v17_783586_c1
866 nmdc:mga06z11_535575_c1
867 nmdc:mga05p37_1806651_c1
868 nmdc:mga0n895_2502_c1
869 nmdc:mga0rr50_6122_c1
870 nmdc:mga0rr50_876624_c1
871 nmdc:mga08x19_3461_c1
872 nmdc:mga08x19_661273_c1
873 Ga0495601_0279688
874 Ga0495595_0118266
875 Ga0495595_0146602
876 Ga0495619_0758784
877 Ga0500556_0000817
878 Ga0500616_0006286
879 Ga0500599_000627
880 Ga0501084_0111819
881 Ga0501084_0125200
882 Ga0590077_078870
883 Ga0466962_0038065
884 Ga0466962_0144384
885 Ga0466962_0239994
886 Ga0530510_0023703
887 Ga0530510_0042277
888 Ga0530510_0122342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11950

DUF3467

Protein of unknown function (DUF3467)

9

99

0.83

Map