F445247

General Info

Members Datasets Scaffolds Average Seq Length
444 217 888 130

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100447193|Ga0068856_1004471933
Length 152
Sequence MDRPTEPPAGTASHQGPRNVDELSVTGIECFAHHGVFEHEKREGQVFVIDLVLGVDTSAAAASDDLHDTVDYGSLVAHVKAAVESDPVDLIETLAQRISDVCLLDDRVEWARVTVHKPGAPIDATFADVTLTITRPITDRSLTDLQPVRCDP

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
97 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
120 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
123 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
124 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
125 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
126 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
129 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
130 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
131 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
197 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
198 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
212 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
217 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.45
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.05
Nodule 0
Rhizoplane 11.71
Rhizosphere 81.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100447193 3300005614 Bacteria 1313
2 JGI24737J22298_10033606 3300001990 Bacteria 1592
3 rootH1_10098558 3300003316 Bacteria 2095
4 Ga0070658_10009547 3300005327 Bacteria 7792
5 Ga0070683_100053987 3300005329 Bacteria 3724
6 Ga0070683_100791453 3300005329 Bacteria 909
7 Ga0070683_100842816 3300005329 Bacteria 879
8 Ga0070683_101509411 3300005329 Bacteria 646
9 Ga0070683_101852678 3300005329 Bacteria 580
10 Ga0068869_100247405 3300005334 Bacteria 1423
11 Ga0070680_100410569 3300005336 Bacteria 1155
12 Ga0070682_100003667 3300005337 Bacteria 8520
13 Ga0070682_100058496 3300005337 Bacteria 2431
14 Ga0070682_101750589 3300005337 Bacteria 541
15 Ga0070660_100152483 3300005339 Bacteria 1858
16 Ga0070687_100126577 3300005343 Bacteria 1469
17 Ga0070661_101326505 3300005344 Bacteria 604
18 Ga0070692_10019847 3300005345 Bacteria 3250
19 Ga0070674_100913113 3300005356 Bacteria 766
20 Ga0070673_100972405 3300005364 Bacteria 789
21 Ga0070659_100162437 3300005366 Bacteria 1827
22 Ga0070667_101972009 3300005367 Bacteria 550
23 Ga0070678_100540625 3300005456 Bacteria 1033
24 Ga0070684_100032964 3300005535 Bacteria 4419
25 Ga0070684_100053011 3300005535 Bacteria 3529
26 Ga0070684_101069094 3300005535 Bacteria 758
27 Ga0070684_101150527 3300005535 Bacteria 729
28 Ga0068853_100488663 3300005539 Bacteria 1161
29 Ga0070686_100162905 3300005544 Bacteria 1572
30 Ga0070665_100001178 3300005548 Bacteria 32035
31 Ga0070665_100301603 3300005548 Bacteria 1605
32 Ga0070665_100358541 3300005548 Bacteria 1464
33 Ga0068857_100062184 3300005577 Bacteria 3319
34 Ga0068857_100874365 3300005577 Bacteria 861
35 Ga0068857_101089094 3300005577 Bacteria 771
36 Ga0068856_100419890 3300005614 Bacteria 1357
37 Ga0068852_100200582 3300005616 Bacteria 1888
38 Ga0068852_100305674 3300005616 Bacteria 1541
39 Ga0068864_100394612 3300005618 Bacteria 1314
40 Ga0068864_100927743 3300005618 Bacteria 861
41 Ga0068870_10920450 3300005840 Bacteria 619
42 Ga0068863_100212908 3300005841 Bacteria 1861
43 Ga0068858_100044169 3300005842 Bacteria 4132
44 Ga0068860_100103038 3300005843 Bacteria 2724
45 Ga0068860_100230505 3300005843 Bacteria 1800
46 Ga0068862_100116345 3300005844 Bacteria 2352
47 Ga0081455_10424771 3300005937 Bacteria 915
48 Ga0081539_10080571 3300005985 Bacteria 1712
49 Ga0081539_10166625 3300005985 Bacteria 1045
50 Ga0075365_10073821 3300006038 Bacteria 2300
51 Ga0075365_10110250 3300006038 Bacteria 1891
52 Ga0075365_10171085 3300006038 Bacteria 1516
53 Ga0075365_10215753 3300006038 Bacteria 1345
54 Ga0075365_10990322 3300006038 Bacteria 592
55 Ga0075364_10197555 3300006051 Bacteria 1363
56 Ga0075364_11228101 3300006051 Bacteria 508
57 Ga0070715_10550660 3300006163 Bacteria 669
58 Ga0070716_101143062 3300006173 Bacteria 623
59 Ga0097621_100779060 3300006237 Bacteria 885
60 Ga0075370_10169050 3300006353 Bacteria 1285
61 Ga0075370_10225508 3300006353 Bacteria 1108
62 Ga0068871_100440689 3300006358 Bacteria 1166
63 Ga0068865_100028948 3300006881 Bacteria 3670
64 Ga0111539_12778396 3300009094 Bacteria 567
65 Ga0105245_10035243 3300009098 Bacteria 4441
66 Ga0105245_11557239 3300009098 Bacteria 712
67 Ga0105247_10269912 3300009101 Bacteria 1170
68 Ga0105243_10121101 3300009148 Bacteria 2206
69 Ga0105241_11863037 3300009174 Bacteria 589
70 Ga0105242_10114860 3300009176 Bacteria 2301
71 Ga0105242_11489290 3300009176 Bacteria 707
72 Ga0105248_10135384 3300009177 Bacteria 2779
73 Ga0105248_10462998 3300009177 Bacteria 1429
74 Ga0105248_12242429 3300009177 Bacteria 621
75 Ga0105237_10201947 3300009545 Bacteria 1988
76 Ga0105239_10009882 3300010375 Bacteria 10717
77 Ga0105246_10021565 3300011119 Bacteria 4147
78 Ga0105246_10248947 3300011119 Bacteria 1409
79 Ga0105246_10529922 3300011119 Bacteria 1006
80 Ga0157316_1049329 3300012510 Bacteria 576
81 Ga0157370_10860751 3300013104 Bacteria 823
82 Ga0157369_10249215 3300013105 Bacteria 1854
83 Ga0157369_11970486 3300013105 Bacteria 593
84 Ga0157374_11455214 3300013296 Bacteria 708
85 Ga0163162_10070937 3300013306 Bacteria 3536
86 Ga0163162_11191312 3300013306 Bacteria 864
87 Ga0163162_12225299 3300013306 Bacteria 629
88 Ga0157372_10021504 3300013307 Bacteria 6970
89 Ga0157372_10208282 3300013307 Bacteria 2266
90 Ga0157372_10718683 3300013307 Bacteria 1162
91 Ga0157372_11486930 3300013307 Bacteria 780
92 Ga0157375_10023832 3300013308 Bacteria 5655
93 Ga0157375_10069852 3300013308 Bacteria 3520
94 Ga0157375_10468951 3300013308 Bacteria 1424
95 Ga0157375_11026782 3300013308 Bacteria 963
96 Ga0163163_10131207 3300014325 Bacteria 2546
97 Ga0163163_10285109 3300014325 Bacteria 1703
98 Ga0163163_10468087 3300014325 Bacteria 1321
99 Ga0163163_11345125 3300014325 Bacteria 776
100 Ga0157380_10457654 3300014326 Bacteria 1227
101 Ga0157377_10820096 3300014745 Bacteria 688
102 Ga0157379_10065156 3300014968 Bacteria 3257
103 Ga0157376_12961929 3300014969 Bacteria 514
104 Ga0163161_10331031 3300017792 Bacteria 1206
105 Ga0206354_11163214 3300020081 Bacteria 2040
106 Ga0207688_10015524 3300025901 Bacteria 4130
107 Ga0207688_10222315 3300025901 Bacteria 1138
108 Ga0207688_10664080 3300025901 Bacteria 658
109 Ga0207647_10163355 3300025904 Bacteria 1298
110 Ga0207647_10698344 3300025904 Bacteria 553
111 Ga0207643_10401286 3300025908 Bacteria 867
112 Ga0207705_10097001 3300025909 Bacteria 2164
113 Ga0207705_10679432 3300025909 Bacteria 801
114 Ga0207707_10269625 3300025912 Bacteria 1475
115 Ga0207671_10496240 3300025914 Bacteria 973
116 Ga0207660_11482037 3300025917 Bacteria 549
117 Ga0207662_10038997 3300025918 Bacteria 2785
118 Ga0207657_10139873 3300025919 Bacteria 1978
119 Ga0207652_10772874 3300025921 Bacteria 854
120 Ga0207650_11760439 3300025925 Bacteria 525
121 Ga0207687_10005647 3300025927 Bacteria 8276
122 Ga0207706_11404657 3300025933 Bacteria 573
123 Ga0207686_10315178 3300025934 Bacteria 1166
124 Ga0207709_10395017 3300025935 Bacteria 1056
125 Ga0207669_10834917 3300025937 Bacteria 766
126 Ga0207691_11500975 3300025940 Bacteria 551
127 Ga0207711_10134563 3300025941 Bacteria 2219
128 Ga0207689_10174364 3300025942 Bacteria 1773
129 Ga0207661_10045321 3300025944 Bacteria 3480
130 Ga0207661_11620139 3300025944 Bacteria 592
131 Ga0207667_10434030 3300025949 Bacteria 1336
132 Ga0207658_10710640 3300025986 Bacteria 909
133 Ga0207703_10274299 3300026035 Bacteria 1529
134 Ga0207639_10225004 3300026041 Bacteria 1623
135 Ga0207702_10145375 3300026078 Bacteria 2151
136 Ga0207676_10222970 3300026095 Bacteria 1680
137 Ga0207674_10187418 3300026116 Bacteria 2019
138 Ga0207674_11231184 3300026116 Bacteria 718
139 Ga0207683_10340683 3300026121 Bacteria 1375
140 Ga0207683_10925524 3300026121 Bacteria 809
141 Ga0207698_10374654 3300026142 Bacteria 1352
142 Ga0207698_10468622 3300026142 Bacteria 1219
143 Ga0268266_10002984 3300028379 Bacteria 17445
144 Ga0268266_10220015 3300028379 Bacteria 1745
145 Ga0268265_10046104 3300028380 Bacteria 3257
146 Ga0268264_10041044 3300028381 Bacteria 3825
147 Ga0268264_10849177 3300028381 Bacteria 914
148 Ga0314311_1215389 3300030733 Bacteria 744
149 Ga0316181_1240337 3300030744 Bacteria 1144
150 Ga0307516_10185153 3300031730 Bacteria 1813
151 Ga0307405_10069125 3300031731 Bacteria 2263
152 Ga0307405_10234380 3300031731 Bacteria 1355
153 Ga0307413_10069436 3300031824 Bacteria 2211
154 Ga0307413_10145537 3300031824 Bacteria 1644
155 Ga0307413_10506634 3300031824 Bacteria 970
156 Ga0307410_10372110 3300031852 Bacteria 1147
157 Ga0307406_10100235 3300031901 Bacteria 1971
158 Ga0307406_12116359 3300031901 Bacteria 504
159 Ga0307407_10245198 3300031903 Bacteria 1224
160 Ga0307407_10266310 3300031903 Bacteria 1181
161 Ga0307412_10010452 3300031911 Bacteria 5345
162 Ga0307412_10107675 3300031911 Bacteria 1984
163 Ga0307412_10184499 3300031911 Bacteria 1572
164 Ga0307412_10396473 3300031911 Bacteria 1122
165 Ga0307409_100001670 3300031995 Bacteria 11156
166 Ga0307409_100028778 3300031995 Bacteria 3965
167 Ga0307409_100061132 3300031995 Bacteria 2942
168 Ga0307409_101112550 3300031995 Bacteria 811
169 Ga0307409_101707035 3300031995 Bacteria 658
170 Ga0307409_102181416 3300031995 Bacteria 583
171 Ga0307416_100000233 3300032002 Bacteria 29604
172 Ga0307416_100009435 3300032002 Bacteria 6387
173 Ga0307416_100682202 3300032002 Bacteria 1115
174 Ga0307416_101277334 3300032002 Bacteria 840
175 Ga0307414_10038907 3300032004 Bacteria 3199
176 Ga0307414_10164210 3300032004 Bacteria 1768
177 Ga0307411_10360854 3300032005 Bacteria 1188
178 Ga0307415_100000040 3300032126 Bacteria 56119
179 Ga0307415_100102890 3300032126 Bacteria 2100
180 Ga0307415_100120902 3300032126 Bacteria 1963
181 Ga0307415_100195040 3300032126 Bacteria 1601
182 Ga0307415_100458792 3300032126 Bacteria 1104
183 Ga0373931_0131378 3300035691 Bacteria 1442
184 Ga0373937_0630974 3300036401 Bacteria 1017
185 Ga0373925_1091437 3300037068 Bacteria 657
186 Ga0395899_0022737 3300037312 Bacteria 4750
187 Ga0395900_0275489 3300037418 Bacteria 1676
188 Ga0395900_0677871 3300037418 Bacteria 966
189 Ga0395898_0318553 3300037466 Bacteria 1483
190 Ga0395905_0143518 3300037471 Bacteria 2246
191 Ga0395905_0890668 3300037471 Bacteria 793
192 Ga0395901_0026233 3300038443 Bacteria 5982
193 Ga0395901_0163987 3300038443 Bacteria 2333
194 Ga0436365_0222679 3300039437 Bacteria 1084
195 Ga0439447_045402 3300041407 Bacteria 1060
196 Ga0439465_0079685 3300041413 Bacteria 1109
197 Ga0439465_0420409 3300041413 Bacteria 510
198 Ga0451793_0545620 3300041452 Bacteria 735
199 Ga0451835_1235983 3300041492 Bacteria 643
200 Ga0451837_1243843 3300041494 Bacteria 1615
201 Ga0451839_1128694 3300041496 Bacteria 606
202 Ga0451839_1596090 3300041496 Bacteria 804
203 Ga0451841_0656640 3300041498 Bacteria 598
204 Ga0451841_0721568 3300041498 Bacteria 720
205 Ga0451843_1012522 3300041509 Bacteria 621
206 Ga0451853_1096745 3300041512 Bacteria 2110
207 Ga0439431_0020485 3300041997 Bacteria 1580
208 Ga0439432_094603 3300042006 Bacteria 897
209 Ga0439446_0033901 3300042156 Bacteria 1484
210 Ga0439434_0005354 3300042435 Bacteria 3756
211 Ga0466969_0021919 3300044656 Bacteria 3302
212 Ga0466972_0015212 3300044658 Bacteria 3847
213 Ga0466965_0013743 3300044683 Bacteria 3824
214 Ga0466965_0156033 3300044683 Bacteria 1195
215 Ga0466966_0003051 3300044684 Bacteria 11049
216 Ga0466966_0016012 3300044684 Bacteria 4957
217 Ga0466961_0083004 3300044693 Bacteria 2026
218 Ga0466961_0186644 3300044693 Bacteria 1286
219 Ga0466961_0503333 3300044693 Bacteria 731
220 Ga0466963_0001511 3300044694 Bacteria 12579
221 Ga0466963_0102900 3300044694 Bacteria 1956
222 Ga0466963_0124138 3300044694 Bacteria 1779
223 Ga0466963_0181323 3300044694 Bacteria 1470
224 Ga0466963_0543761 3300044694 Bacteria 820
225 Ga0466963_0600286 3300044694 Bacteria 777
226 Ga0466963_0690338 3300044694 Bacteria 720
227 Ga0466964_0009434 3300044706 Bacteria 3675
228 Ga0466964_0122329 3300044706 Bacteria 1175
229 Ga0466964_0150943 3300044706 Bacteria 1077
230 Ga0466964_0727049 3300044706 Bacteria 555
231 Ga0466971_0037420 3300044719 Bacteria 2174
232 Ga0466971_0045928 3300044719 Bacteria 1962
233 Ga0466971_0140032 3300044719 Bacteria 1126
234 Ga0466971_0200809 3300044719 Bacteria 941
235 Ga0466968_0310520 3300044735 Bacteria 760
236 Ga0466970_0045916 3300044765 Bacteria 2326
237 Ga0466970_0064727 3300044765 Bacteria 1961
238 Ga0466970_0085350 3300044765 Bacteria 1710
239 Ga0466970_0182202 3300044765 Bacteria 1165
240 Ga0466970_0247396 3300044765 Bacteria 998
241 Ga0466957_0049616 3300044842 Bacteria 2552
242 Ga0466957_0067066 3300044842 Bacteria 2213
243 Ga0466957_0161420 3300044842 Bacteria 1456
244 Ga0466957_0340703 3300044842 Bacteria 1015
245 Ga0466957_0795471 3300044842 Bacteria 672
246 Ga0466960_0002792 3300044901 Bacteria 6610
247 Ga0466960_0037928 3300044901 Bacteria 2263
248 Ga0466960_0040395 3300044901 Bacteria 2206
249 Ga0466960_0053262 3300044901 Bacteria 1960
250 Ga0466960_0065944 3300044901 Bacteria 1789
251 Ga0466960_0211183 3300044901 Bacteria 1064
252 Ga0466960_0357109 3300044901 Bacteria 834
253 Ga0466960_0779241 3300044901 Bacteria 578
254 Ga0466960_0836165 3300044901 Bacteria 559
255 Ga0466959_0040507 3300045049 Bacteria 3441
256 Ga0466959_0639550 3300045049 Bacteria 714
257 Ga0466967_0006676 3300045976 Bacteria 8202
258 Ga0466967_0093919 3300045976 Bacteria 2730
259 Ga0466967_0121947 3300045976 Bacteria 2410
260 Ga0466967_0247921 3300045976 Bacteria 1700
261 Ga0466967_0256366 3300045976 Bacteria 1672
262 Ga0466967_0257200 3300045976 Bacteria 1670
263 Ga0466967_0527605 3300045976 Bacteria 1161
264 Ga0466967_0554511 3300045976 Bacteria 1131
265 Ga0466967_0799494 3300045976 Bacteria 936
266 Ga0495641_0057190 3300046461 Bacteria 1767
267 Ga0495582_0051109 3300046473 Bacteria 2279
268 Ga0495582_0564608 3300046473 Bacteria 658
269 Ga0495594_0405290 3300046499 Bacteria 776
270 Ga0495630_0368302 3300046517 Bacteria 1100
271 Ga0495588_0400890 3300046674 Bacteria 720
272 Ga0495624_0374041 3300046690 Bacteria 856
273 Ga0495600_0635114 3300046809 Bacteria 647
274 Ga0495581_0157757 3300047315 Bacteria 1326
275 Ga0495674_0701892 3300047319 Bacteria 794
276 Ga0496100_0120832 3300048903 Bacteria 1832
277 Ga0496101_0084181 3300048904 Bacteria 2355
278 Ga0496101_0689389 3300048904 Bacteria 807
279 Ga0496101_0896339 3300048904 Bacteria 698
280 Ga0496101_1615990 3300048904 Bacteria 503
281 Ga0496102_0046037 3300048905 Bacteria 3961
282 Ga0496102_0068038 3300048905 Bacteria 3267
283 Ga0496102_0211464 3300048905 Bacteria 1828
284 Ga0496102_0963523 3300048905 Bacteria 774
285 Ga0496102_1663855 3300048905 Bacteria 556
286 Ga0496103_0003630 3300048906 Bacteria 9404
287 Ga0496103_0074076 3300048906 Bacteria 2134
288 Ga0496103_0288648 3300048906 Bacteria 1055
289 Ga0496103_0679062 3300048906 Bacteria 653
290 Ga0496104_0007837 3300048907 Bacteria 9465
291 Ga0496104_0923189 3300048907 Bacteria 778
292 Ga0496105_0014935 3300048908 Bacteria 6181
293 Ga0496105_0164880 3300048908 Bacteria 1818
294 Ga0496105_0945192 3300048908 Bacteria 647
295 Ga0496106_0014834 3300048909 Bacteria 5762
296 Ga0496106_0126934 3300048909 Bacteria 1998
297 Ga0496106_0442776 3300048909 Bacteria 1044
298 Ga0496107_0145729 3300048910 Bacteria 1751
299 Ga0496107_0158507 3300048910 Bacteria 1676
300 Ga0496107_0250173 3300048910 Bacteria 1319
301 Ga0496107_0445921 3300048910 Bacteria 961
302 Ga0496107_0732161 3300048910 Bacteria 726
303 Ga0496108_0233334 3300048911 Bacteria 1600
304 Ga0496108_0272560 3300048911 Bacteria 1473
305 Ga0496108_0278769 3300048911 Bacteria 1455
306 Ga0496109_0012238 3300048912 Bacteria 7404
307 Ga0496109_0065311 3300048912 Bacteria 3331
308 Ga0496109_0123623 3300048912 Bacteria 2412
309 Ga0496109_0169424 3300048912 Bacteria 2048
310 Ga0496109_0215987 3300048912 Bacteria 1803
311 Ga0496109_0309819 3300048912 Bacteria 1489
312 Ga0496110_0014816 3300048913 Bacteria 6478
313 Ga0496110_0080745 3300048913 Bacteria 2898
314 Ga0496110_0593848 3300048913 Bacteria 1005
315 Ga0496111_0009247 3300048914 Bacteria 6568
316 Ga0496111_0693432 3300048914 Bacteria 741
317 Ga0496112_0739387 3300048915 Bacteria 910
318 Ga0496112_0931957 3300048915 Bacteria 790
319 Ga0496113_0711186 3300048916 Bacteria 801
320 Ga0496114_0021387 3300048917 Bacteria 5263
321 Ga0496114_0024823 3300048917 Bacteria 4893
322 Ga0496114_0054724 3300048917 Bacteria 3327
323 Ga0496114_0142499 3300048917 Bacteria 2076
324 Ga0496114_0392159 3300048917 Bacteria 1229
325 Ga0496114_0715471 3300048917 Bacteria 877
326 Ga0496115_0003375 3300048918 Bacteria 11456
327 Ga0501317_006322 3300049533 Bacteria 1299
328 Ga0501031_0685349 3300049568 Bacteria 658
329 Ga0501032_0086523 3300049569 Bacteria 2083
330 Ga0501032_0798990 3300049569 Bacteria 596
331 Ga0501033_0098278 3300049570 Bacteria 2138
332 Ga0501033_0175909 3300049570 Bacteria 1536
333 Ga0501033_0253239 3300049570 Bacteria 1247
334 Ga0501034_0004259 3300049571 Bacteria 15957
335 Ga0501036_0072532 3300049572 Bacteria 2910
336 Ga0501036_0169829 3300049572 Bacteria 1838
337 Ga0501036_0639932 3300049572 Bacteria 881
338 Ga0501036_0739441 3300049572 Bacteria 812
339 Ga0501037_0024628 3300049573 Bacteria 4450
340 Ga0501037_0053606 3300049573 Bacteria 2950
341 Ga0501038_0004838 3300049574 Bacteria 12510
342 Ga0501038_0010906 3300049574 Bacteria 8300
343 Ga0501038_0488289 3300049574 Bacteria 943
344 Ga0501039_0034650 3300049575 Bacteria 3895
345 Ga0501039_0040702 3300049575 Bacteria 3587
346 Ga0501039_0094826 3300049575 Bacteria 2326
347 Ga0501039_0207958 3300049575 Bacteria 1539
348 Ga0501039_0870822 3300049575 Bacteria 702
349 Ga0501039_1112075 3300049575 Bacteria 612
350 Ga0501041_0074295 3300049577 Bacteria 2089
351 Ga0501041_0139840 3300049577 Bacteria 1510
352 Ga0501041_0207461 3300049577 Bacteria 1229
353 Ga0501042_0024870 3300049578 Bacteria 4203
354 Ga0501042_0051712 3300049578 Bacteria 2931
355 Ga0501042_0121917 3300049578 Bacteria 1877
356 Ga0501042_0628677 3300049578 Bacteria 781
357 Ga0501043_0299314 3300049579 Bacteria 1229
358 Ga0501046_0019301 3300049580 Bacteria 5656
359 Ga0501046_0389918 3300049580 Bacteria 1007
360 Ga0501047_0038882 3300049581 Bacteria 4602
361 Ga0501048_0029049 3300049582 Bacteria 4013
362 Ga0501048_0060545 3300049582 Bacteria 2683
363 Ga0501048_0062106 3300049582 Bacteria 2645
364 Ga0501048_0749395 3300049582 Bacteria 702
365 Ga0501068_0586564 3300049584 Bacteria 726
366 Ga0501068_0761738 3300049584 Bacteria 634
367 Ga0501069_0019629 3300049585 Bacteria 3657
368 Ga0501069_0028706 3300049585 Bacteria 3051
369 Ga0501069_0404723 3300049585 Bacteria 808
370 Ga0501069_0802253 3300049585 Bacteria 571
371 Ga0501070_0002693 3300049586 Bacteria 15512
372 Ga0501070_0133680 3300049586 Bacteria 2048
373 Ga0501070_0452497 3300049586 Bacteria 1035
374 Ga0501070_0886569 3300049586 Bacteria 696
375 Ga0501070_0903831 3300049586 Bacteria 689
376 Ga0501071_0003000 3300049587 Bacteria 10449
377 Ga0501071_0267108 3300049587 Bacteria 1293
378 Ga0501071_0562790 3300049587 Bacteria 876
379 Ga0501071_0741263 3300049587 Bacteria 757
380 Ga0501071_0776297 3300049587 Bacteria 738
381 Ga0501072_0039521 3300049588 Bacteria 3704
382 Ga0501073_0037629 3300049589 Bacteria 3434
383 Ga0501073_0075325 3300049589 Bacteria 2349
384 Ga0501073_0484103 3300049589 Bacteria 856
385 Ga0501074_0007028 3300049590 Bacteria 8128
386 Ga0501074_0089042 3300049590 Bacteria 2210
387 Ga0501075_0015058 3300049591 Bacteria 5548
388 Ga0501075_0029485 3300049591 Bacteria 4059
389 Ga0501075_0231551 3300049591 Bacteria 1409
390 Ga0501076_0096081 3300049592 Bacteria 2386
391 Ga0501076_0318711 3300049592 Bacteria 1275
392 Ga0501077_0020423 3300049593 Bacteria 4193
393 Ga0501235_059605 3300049669 Bacteria 893
394 Ga0501240_080847 3300049673 Bacteria 602
395 Ga0501261_097834 3300049690 Bacteria 554
396 Ga0501079_0023672 3300049741 Bacteria 4713
397 Ga0501079_0079822 3300049741 Bacteria 2530
398 Ga0501079_0195594 3300049741 Bacteria 1579
399 Ga0501080_0034000 3300049742 Bacteria 4760
400 Ga0501081_0091785 3300049743 Bacteria 2136
401 Ga0501081_0103496 3300049743 Bacteria 2015
402 Ga0501081_0138133 3300049743 Bacteria 1746
403 Ga0501035_0010253 3300049822 Bacteria 8694
404 Ga0501035_0305714 3300049822 Bacteria 1339
405 Ga0501035_0844452 3300049822 Bacteria 729
406 Ga0501035_1490249 3300049822 Bacteria 516
407 Ga0501044_0096455 3300049823 Bacteria 2978
408 Ga0501044_0265292 3300049823 Bacteria 1655
409 Ga0501044_1032121 3300049823 Bacteria 693
410 Ga0501045_0013568 3300049824 Bacteria 5756
411 Ga0501045_0023030 3300049824 Bacteria 4463
412 Ga0501045_0047485 3300049824 Bacteria 3128
413 Ga0501045_0176260 3300049824 Bacteria 1593
414 Ga0501045_0253667 3300049824 Bacteria 1309
415 nmdc:mga00v17_377680_c1 3300050491 Bacteria 921
416 nmdc:mga0yw44_122727_c1 3300050492 Bacteria 1675
417 nmdc:mga0yw44_251020_c1 3300050492 Bacteria 1177
418 nmdc:mga0yw44_337148_c1 3300050492 Bacteria 1014
419 nmdc:mga0yw44_384256_c1 3300050492 Bacteria 948
420 nmdc:mga07m45_187481_c1 3300050496 Bacteria 1202
421 nmdc:mga07m45_210526_c1 3300050496 Bacteria 1131
422 Ga0495655_0054699 3300053083 Bacteria 1069
423 Ga0495595_0031720 3300053084 Bacteria 2376
424 Ga0495595_0196453 3300053084 Bacteria 1004
425 Ga0495619_0014297 3300053085 Bacteria 5015
426 Ga0495619_0453720 3300053085 Bacteria 884
427 Ga0495619_0679280 3300053085 Bacteria 701
428 Ga0500562_086306 3300053108 Bacteria 850
429 Ga0500573_0041385 3300053140 Bacteria 2660
430 Ga0501084_0035723 3300054114 Bacteria 4154
431 Ga0501084_0177901 3300054114 Bacteria 1796
432 Ga0501084_0215500 3300054114 Bacteria 1620
433 Ga0501082_0015346 3300060353 Bacteria 6591
434 Ga0501082_0682204 3300060353 Bacteria 899
435 Ga0501082_1477219 3300060353 Bacteria 594
436 Ga0501082_1477720 3300060353 Bacteria 593
437 Ga0466962_0018493 3300061719 Bacteria 3352
438 Ga0466962_0020522 3300061719 Bacteria 3175
439 Ga0466962_0162899 3300061719 Bacteria 1084
440 Ga0466962_0178338 3300061719 Bacteria 1036
441 Ga0530510_0097967 3300061734 Bacteria 2144
442 Ga0530510_0147775 3300061734 Bacteria 1734
443 Ga0530510_1287630 3300061734 Bacteria 561
444 2855388045 2855386786 Bacteria 4752232
445 Ga0068856_100447193
446 JGI24737J22298_10033606
447 rootH1_10098558
448 Ga0070658_10009547
449 Ga0070683_100053987
450 Ga0070683_100791453
451 Ga0070683_100842816
452 Ga0070683_101509411
453 Ga0070683_101852678
454 Ga0068869_100247405
455 Ga0070680_100410569
456 Ga0070682_100003667
457 Ga0070682_100058496
458 Ga0070682_101750589
459 Ga0070660_100152483
460 Ga0070687_100126577
461 Ga0070661_101326505
462 Ga0070692_10019847
463 Ga0070674_100913113
464 Ga0070673_100972405
465 Ga0070659_100162437
466 Ga0070667_101972009
467 Ga0070678_100540625
468 Ga0070684_100032964
469 Ga0070684_100053011
470 Ga0070684_101069094
471 Ga0070684_101150527
472 Ga0068853_100488663
473 Ga0070686_100162905
474 Ga0070665_100001178
475 Ga0070665_100301603
476 Ga0070665_100358541
477 Ga0068857_100062184
478 Ga0068857_100874365
479 Ga0068857_101089094
480 Ga0068856_100419890
481 Ga0068852_100200582
482 Ga0068852_100305674
483 Ga0068864_100394612
484 Ga0068864_100927743
485 Ga0068870_10920450
486 Ga0068863_100212908
487 Ga0068858_100044169
488 Ga0068860_100103038
489 Ga0068860_100230505
490 Ga0068862_100116345
491 Ga0081455_10424771
492 Ga0081539_10080571
493 Ga0081539_10166625
494 Ga0075365_10073821
495 Ga0075365_10110250
496 Ga0075365_10171085
497 Ga0075365_10215753
498 Ga0075365_10990322
499 Ga0075364_10197555
500 Ga0075364_11228101
501 Ga0070715_10550660
502 Ga0070716_101143062
503 Ga0097621_100779060
504 Ga0075370_10169050
505 Ga0075370_10225508
506 Ga0068871_100440689
507 Ga0068865_100028948
508 Ga0111539_12778396
509 Ga0105245_10035243
510 Ga0105245_11557239
511 Ga0105247_10269912
512 Ga0105243_10121101
513 Ga0105241_11863037
514 Ga0105242_10114860
515 Ga0105242_11489290
516 Ga0105248_10135384
517 Ga0105248_10462998
518 Ga0105248_12242429
519 Ga0105237_10201947
520 Ga0105239_10009882
521 Ga0105246_10021565
522 Ga0105246_10248947
523 Ga0105246_10529922
524 Ga0157316_1049329
525 Ga0157370_10860751
526 Ga0157369_10249215
527 Ga0157369_11970486
528 Ga0157374_11455214
529 Ga0163162_10070937
530 Ga0163162_11191312
531 Ga0163162_12225299
532 Ga0157372_10021504
533 Ga0157372_10208282
534 Ga0157372_10718683
535 Ga0157372_11486930
536 Ga0157375_10023832
537 Ga0157375_10069852
538 Ga0157375_10468951
539 Ga0157375_11026782
540 Ga0163163_10131207
541 Ga0163163_10285109
542 Ga0163163_10468087
543 Ga0163163_11345125
544 Ga0157380_10457654
545 Ga0157377_10820096
546 Ga0157379_10065156
547 Ga0157376_12961929
548 Ga0163161_10331031
549 Ga0206354_11163214
550 Ga0207688_10015524
551 Ga0207688_10222315
552 Ga0207688_10664080
553 Ga0207647_10163355
554 Ga0207647_10698344
555 Ga0207643_10401286
556 Ga0207705_10097001
557 Ga0207705_10679432
558 Ga0207707_10269625
559 Ga0207671_10496240
560 Ga0207660_11482037
561 Ga0207662_10038997
562 Ga0207657_10139873
563 Ga0207652_10772874
564 Ga0207650_11760439
565 Ga0207687_10005647
566 Ga0207706_11404657
567 Ga0207686_10315178
568 Ga0207709_10395017
569 Ga0207669_10834917
570 Ga0207691_11500975
571 Ga0207711_10134563
572 Ga0207689_10174364
573 Ga0207661_10045321
574 Ga0207661_11620139
575 Ga0207667_10434030
576 Ga0207658_10710640
577 Ga0207703_10274299
578 Ga0207639_10225004
579 Ga0207702_10145375
580 Ga0207676_10222970
581 Ga0207674_10187418
582 Ga0207674_11231184
583 Ga0207683_10340683
584 Ga0207683_10925524
585 Ga0207698_10374654
586 Ga0207698_10468622
587 Ga0268266_10002984
588 Ga0268266_10220015
589 Ga0268265_10046104
590 Ga0268264_10041044
591 Ga0268264_10849177
592 Ga0314311_1215389
593 Ga0316181_1240337
594 Ga0307516_10185153
595 Ga0307405_10069125
596 Ga0307405_10234380
597 Ga0307413_10069436
598 Ga0307413_10145537
599 Ga0307413_10506634
600 Ga0307410_10372110
601 Ga0307406_10100235
602 Ga0307406_12116359
603 Ga0307407_10245198
604 Ga0307407_10266310
605 Ga0307412_10010452
606 Ga0307412_10107675
607 Ga0307412_10184499
608 Ga0307412_10396473
609 Ga0307409_100001670
610 Ga0307409_100028778
611 Ga0307409_100061132
612 Ga0307409_101112550
613 Ga0307409_101707035
614 Ga0307409_102181416
615 Ga0307416_100000233
616 Ga0307416_100009435
617 Ga0307416_100682202
618 Ga0307416_101277334
619 Ga0307414_10038907
620 Ga0307414_10164210
621 Ga0307411_10360854
622 Ga0307415_100000040
623 Ga0307415_100102890
624 Ga0307415_100120902
625 Ga0307415_100195040
626 Ga0307415_100458792
627 Ga0373931_0131378
628 Ga0373937_0630974
629 Ga0373925_1091437
630 Ga0395899_0022737
631 Ga0395900_0275489
632 Ga0395900_0677871
633 Ga0395898_0318553
634 Ga0395905_0143518
635 Ga0395905_0890668
636 Ga0395901_0026233
637 Ga0395901_0163987
638 Ga0436365_0222679
639 Ga0439447_045402
640 Ga0439465_0079685
641 Ga0439465_0420409
642 Ga0451793_0545620
643 Ga0451835_1235983
644 Ga0451837_1243843
645 Ga0451839_1128694
646 Ga0451839_1596090
647 Ga0451841_0656640
648 Ga0451841_0721568
649 Ga0451843_1012522
650 Ga0451853_1096745
651 Ga0439431_0020485
652 Ga0439432_094603
653 Ga0439446_0033901
654 Ga0439434_0005354
655 Ga0466969_0021919
656 Ga0466972_0015212
657 Ga0466965_0013743
658 Ga0466965_0156033
659 Ga0466966_0003051
660 Ga0466966_0016012
661 Ga0466961_0083004
662 Ga0466961_0186644
663 Ga0466961_0503333
664 Ga0466963_0001511
665 Ga0466963_0102900
666 Ga0466963_0124138
667 Ga0466963_0181323
668 Ga0466963_0543761
669 Ga0466963_0600286
670 Ga0466963_0690338
671 Ga0466964_0009434
672 Ga0466964_0122329
673 Ga0466964_0150943
674 Ga0466964_0727049
675 Ga0466971_0037420
676 Ga0466971_0045928
677 Ga0466971_0140032
678 Ga0466971_0200809
679 Ga0466968_0310520
680 Ga0466970_0045916
681 Ga0466970_0064727
682 Ga0466970_0085350
683 Ga0466970_0182202
684 Ga0466970_0247396
685 Ga0466957_0049616
686 Ga0466957_0067066
687 Ga0466957_0161420
688 Ga0466957_0340703
689 Ga0466957_0795471
690 Ga0466960_0002792
691 Ga0466960_0037928
692 Ga0466960_0040395
693 Ga0466960_0053262
694 Ga0466960_0065944
695 Ga0466960_0211183
696 Ga0466960_0357109
697 Ga0466960_0779241
698 Ga0466960_0836165
699 Ga0466959_0040507
700 Ga0466959_0639550
701 Ga0466967_0006676
702 Ga0466967_0093919
703 Ga0466967_0121947
704 Ga0466967_0247921
705 Ga0466967_0256366
706 Ga0466967_0257200
707 Ga0466967_0527605
708 Ga0466967_0554511
709 Ga0466967_0799494
710 Ga0495641_0057190
711 Ga0495582_0051109
712 Ga0495582_0564608
713 Ga0495594_0405290
714 Ga0495630_0368302
715 Ga0495588_0400890
716 Ga0495624_0374041
717 Ga0495600_0635114
718 Ga0495581_0157757
719 Ga0495674_0701892
720 Ga0496100_0120832
721 Ga0496101_0084181
722 Ga0496101_0689389
723 Ga0496101_0896339
724 Ga0496101_1615990
725 Ga0496102_0046037
726 Ga0496102_0068038
727 Ga0496102_0211464
728 Ga0496102_0963523
729 Ga0496102_1663855
730 Ga0496103_0003630
731 Ga0496103_0074076
732 Ga0496103_0288648
733 Ga0496103_0679062
734 Ga0496104_0007837
735 Ga0496104_0923189
736 Ga0496105_0014935
737 Ga0496105_0164880
738 Ga0496105_0945192
739 Ga0496106_0014834
740 Ga0496106_0126934
741 Ga0496106_0442776
742 Ga0496107_0145729
743 Ga0496107_0158507
744 Ga0496107_0250173
745 Ga0496107_0445921
746 Ga0496107_0732161
747 Ga0496108_0233334
748 Ga0496108_0272560
749 Ga0496108_0278769
750 Ga0496109_0012238
751 Ga0496109_0065311
752 Ga0496109_0123623
753 Ga0496109_0169424
754 Ga0496109_0215987
755 Ga0496109_0309819
756 Ga0496110_0014816
757 Ga0496110_0080745
758 Ga0496110_0593848
759 Ga0496111_0009247
760 Ga0496111_0693432
761 Ga0496112_0739387
762 Ga0496112_0931957
763 Ga0496113_0711186
764 Ga0496114_0021387
765 Ga0496114_0024823
766 Ga0496114_0054724
767 Ga0496114_0142499
768 Ga0496114_0392159
769 Ga0496114_0715471
770 Ga0496115_0003375
771 Ga0501317_006322
772 Ga0501031_0685349
773 Ga0501032_0086523
774 Ga0501032_0798990
775 Ga0501033_0098278
776 Ga0501033_0175909
777 Ga0501033_0253239
778 Ga0501034_0004259
779 Ga0501036_0072532
780 Ga0501036_0169829
781 Ga0501036_0639932
782 Ga0501036_0739441
783 Ga0501037_0024628
784 Ga0501037_0053606
785 Ga0501038_0004838
786 Ga0501038_0010906
787 Ga0501038_0488289
788 Ga0501039_0034650
789 Ga0501039_0040702
790 Ga0501039_0094826
791 Ga0501039_0207958
792 Ga0501039_0870822
793 Ga0501039_1112075
794 Ga0501041_0074295
795 Ga0501041_0139840
796 Ga0501041_0207461
797 Ga0501042_0024870
798 Ga0501042_0051712
799 Ga0501042_0121917
800 Ga0501042_0628677
801 Ga0501043_0299314
802 Ga0501046_0019301
803 Ga0501046_0389918
804 Ga0501047_0038882
805 Ga0501048_0029049
806 Ga0501048_0060545
807 Ga0501048_0062106
808 Ga0501048_0749395
809 Ga0501068_0586564
810 Ga0501068_0761738
811 Ga0501069_0019629
812 Ga0501069_0028706
813 Ga0501069_0404723
814 Ga0501069_0802253
815 Ga0501070_0002693
816 Ga0501070_0133680
817 Ga0501070_0452497
818 Ga0501070_0886569
819 Ga0501070_0903831
820 Ga0501071_0003000
821 Ga0501071_0267108
822 Ga0501071_0562790
823 Ga0501071_0741263
824 Ga0501071_0776297
825 Ga0501072_0039521
826 Ga0501073_0037629
827 Ga0501073_0075325
828 Ga0501073_0484103
829 Ga0501074_0007028
830 Ga0501074_0089042
831 Ga0501075_0015058
832 Ga0501075_0029485
833 Ga0501075_0231551
834 Ga0501076_0096081
835 Ga0501076_0318711
836 Ga0501077_0020423
837 Ga0501235_059605
838 Ga0501240_080847
839 Ga0501261_097834
840 Ga0501079_0023672
841 Ga0501079_0079822
842 Ga0501079_0195594
843 Ga0501080_0034000
844 Ga0501081_0091785
845 Ga0501081_0103496
846 Ga0501081_0138133
847 Ga0501035_0010253
848 Ga0501035_0305714
849 Ga0501035_0844452
850 Ga0501035_1490249
851 Ga0501044_0096455
852 Ga0501044_0265292
853 Ga0501044_1032121
854 Ga0501045_0013568
855 Ga0501045_0023030
856 Ga0501045_0047485
857 Ga0501045_0176260
858 Ga0501045_0253667
859 nmdc:mga00v17_377680_c1
860 nmdc:mga0yw44_122727_c1
861 nmdc:mga0yw44_251020_c1
862 nmdc:mga0yw44_337148_c1
863 nmdc:mga0yw44_384256_c1
864 nmdc:mga07m45_187481_c1
865 nmdc:mga07m45_210526_c1
866 Ga0495655_0054699
867 Ga0495595_0031720
868 Ga0495595_0196453
869 Ga0495619_0014297
870 Ga0495619_0453720
871 Ga0495619_0679280
872 Ga0500562_086306
873 Ga0500573_0041385
874 Ga0501084_0035723
875 Ga0501084_0177901
876 Ga0501084_0215500
877 Ga0501082_0015346
878 Ga0501082_0682204
879 Ga0501082_1477219
880 Ga0501082_1477720
881 Ga0466962_0018493
882 Ga0466962_0020522
883 Ga0466962_0162899
884 Ga0466962_0178338
885 Ga0530510_0097967
886 Ga0530510_0147775
887 Ga0530510_1287630
888 2855388045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02152

FolB

Dihydroneopterin aldolase

23

134

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nbu-assembly1.cif.gz_G 7,8-dihydroneopterin aldolase complexed with product from mycobacterium tuberculosis 0.9188 3 118
1nbu-assembly1.cif.gz_C 7,8-dihydroneopterin aldolase complexed with product from mycobacterium tuberculosis 0.9182 3 118
1nbu-assembly1.cif.gz_D 7,8-dihydroneopterin aldolase complexed with product from mycobacterium tuberculosis 0.9157 3 118
2cg8-assembly1.cif.gz_C-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9098 3 118
5f3m-assembly1.cif.gz_A crystal structure of dihydroneopterin aldolase from bacillus anthracis complexed with l-neopterin at 1.5 angstroms resolution . 0.9054 3 118
ID Description Score Start End Superfamily
af_Q54YD9_1_116_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9156 3 118 3.30.1130.10
5farH00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8942 3 118 3.30.1130.10
2nm2B00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8937 1 118 3.30.1130.10
af_A0A0R0J0C6_26_148_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8936 3 118 3.30.1130.10
af_Q54YD9_1_116_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8933 3 118 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A5Q0NQ98-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.9453 2 120 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A2T0VB85-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.945 2 118 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A4T0ULD2-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.9447 3 119 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A2T8F9P8-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.944 1 120 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A6M5IV41-F1-model_v4 Bifunctional folate synthesis protein [Includes: Dihydroneopterin aldolase (DHNA) (EC 4.1.2.25) (7,8-dihydroneopterin aldolase); 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3) (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase) (PPPK) (7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase) (HPPK)] 0.943 1 123 GO:0003848
GO:0004150
GO:0005524
GO:0016301
GO:0046654
GO:0046656

Map