F445239

General Info

Members Datasets Scaffolds Average Seq Length
444 250 888 135

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_101549403|Ga0070708_1015494031
Length 159
Sequence MAKPLPGMEQLFKALADATRLRILGLLLTGEVCVCHIHESLRIPQPKASRHLAYLRHAGLVDTRREGLWVHYRMASLTDPVLGAIGGAVRHALTHIDVVQRDAQRLRKKTGCCLPAPEAIGAAACCSTRPSSSAPRGDAKSSQRASGHARRVVVGRQGR

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
166 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
167 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
247 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.31
Nodule 0
Rhizoplane 3.6
Rhizosphere 89.86
Stem 0
Stem Tuber 0
Unclassified 13.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_101549403 3300005445 Unclassified 617
2 Ga0065714_10070916 3300005288 Bacteria 3728
3 Ga0065712_10000733 3300005290 Bacteria 8445
4 Ga0065715_10000217 3300005293 Bacteria 35543
5 Ga0065707_10409913 3300005295 Bacteria 842
6 Ga0065707_10776063 3300005295 Bacteria 608
7 Ga0070683_100020578 3300005329 Bacteria 5872
8 Ga0070683_100052000 3300005329 Bacteria 3795
9 Ga0070683_100084129 3300005329 Bacteria 2981
10 Ga0070690_101218214 3300005330 Bacteria 601
11 Ga0070670_100001636 3300005331 Bacteria 18122
12 Ga0070670_100003152 3300005331 Bacteria 13635
13 Ga0070670_100166173 3300005331 Bacteria 1913
14 Ga0070670_100582037 3300005331 Bacteria 1000
15 Ga0068869_100602472 3300005334 Bacteria 928
16 Ga0070666_10141736 3300005335 Bacteria 1674
17 Ga0070666_10308204 3300005335 Bacteria 1128
18 Ga0070680_100488228 3300005336 Bacteria 1053
19 Ga0068868_100263566 3300005338 Bacteria 1454
20 Ga0068868_100344470 3300005338 Bacteria 1275
21 Ga0070660_100105566 3300005339 Bacteria 2236
22 Ga0070687_100017744 3300005343 Bacteria 3280
23 Ga0070661_101429412 3300005344 Unclassified 582
24 Ga0070668_100111022 3300005347 Bacteria 2182
25 Ga0070669_100087190 3300005353 Bacteria 2333
26 Ga0070669_100125970 3300005353 Bacteria 1960
27 Ga0070669_101271676 3300005353 Bacteria 637
28 Ga0070675_100001790 3300005354 Bacteria 15858
29 Ga0070675_100004351 3300005354 Bacteria 10798
30 Ga0070675_100025683 3300005354 Bacteria 4722
31 Ga0070671_100134261 3300005355 Bacteria 2086
32 Ga0070671_101846265 3300005355 Unclassified 537
33 Ga0070674_100016700 3300005356 Bacteria 4604
34 Ga0070674_100202941 3300005356 Bacteria 1532
35 Ga0070674_100528027 3300005356 Unclassified 987
36 Ga0070673_100010156 3300005364 Bacteria 6356
37 Ga0070673_100122225 3300005364 Bacteria 2174
38 Ga0070673_101394354 3300005364 Unclassified 659
39 Ga0070688_100126256 3300005365 Bacteria 1720
40 Ga0070688_100673677 3300005365 Bacteria 798
41 Ga0070688_101363626 3300005365 Unclassified 574
42 Ga0070667_100744910 3300005367 Bacteria 908
43 Ga0070667_100803566 3300005367 Bacteria 873
44 Ga0070709_10655604 3300005434 Bacteria 813
45 Ga0070701_10047757 3300005438 Bacteria 2206
46 Ga0070711_100813032 3300005439 Bacteria 793
47 Ga0070700_100299025 3300005441 Unclassified 1174
48 Ga0070694_100001500 3300005444 Bacteria 13699
49 Ga0070708_100109142 3300005445 Bacteria 2542
50 Ga0070663_101773614 3300005455 Bacteria 553
51 Ga0070663_101912830 3300005455 Unclassified 533
52 Ga0070678_100068505 3300005456 Bacteria 2646
53 Ga0070678_101023743 3300005456 Bacteria 760
54 Ga0070662_100011910 3300005457 Bacteria 5750
55 Ga0070681_10139254 3300005458 Bacteria 2357
56 Ga0068867_100403991 3300005459 Bacteria 1153
57 Ga0070685_10013454 3300005466 Bacteria 4316
58 Ga0070706_100301863 3300005467 Bacteria 1494
59 Ga0070706_101096594 3300005467 Unclassified 733
60 Ga0070706_101324439 3300005467 Bacteria 660
61 Ga0070707_100410800 3300005468 Bacteria 1314
62 Ga0070698_100016375 3300005471 Bacteria 7829
63 Ga0070698_101502566 3300005471 Bacteria 625
64 Ga0070698_101762987 3300005471 Bacteria 572
65 Ga0070699_100001525 3300005518 Bacteria 21179
66 Ga0070699_100214141 3300005518 Bacteria 1716
67 Ga0070699_100530916 3300005518 Bacteria 1070
68 Ga0070699_100822456 3300005518 Unclassified 850
69 Ga0070684_100007971 3300005535 Bacteria 8268
70 Ga0070684_100056201 3300005535 Bacteria 3434
71 Ga0070697_100242557 3300005536 Unclassified 1539
72 Ga0070697_100363623 3300005536 Unclassified 1251
73 Ga0070697_100651258 3300005536 Bacteria 928
74 Ga0070672_100006840 3300005543 Bacteria 7700
75 Ga0070672_100197925 3300005543 Bacteria 1680
76 Ga0070686_100085315 3300005544 Bacteria 2100
77 Ga0070695_100001592 3300005545 Bacteria 12695
78 Ga0070696_100035013 3300005546 Bacteria 3456
79 Ga0070696_100237950 3300005546 Bacteria 1372
80 Ga0070696_101114112 3300005546 Unclassified 664
81 Ga0070693_101450986 3300005547 Bacteria 535
82 Ga0070665_100025339 3300005548 Bacteria 5977
83 Ga0070665_100218765 3300005548 Bacteria 1905
84 Ga0070704_100305606 3300005549 Bacteria 1327
85 Ga0068855_100398655 3300005563 Bacteria 1508
86 Ga0068855_100987751 3300005563 Unclassified 885
87 Ga0070664_100008246 3300005564 Bacteria 8424
88 Ga0070664_100020786 3300005564 Bacteria 5407
89 Ga0070664_100093852 3300005564 Bacteria 2601
90 Ga0070664_100920121 3300005564 Bacteria 820
91 Ga0068857_100012638 3300005577 Bacteria 7356
92 Ga0068857_102380979 3300005577 Unclassified 520
93 Ga0068854_100060164 3300005578 Bacteria 2747
94 Ga0068856_100084031 3300005614 Bacteria 3162
95 Ga0068852_101171925 3300005616 Bacteria 789
96 Ga0068852_101915488 3300005616 Bacteria 615
97 Ga0068859_100006437 3300005617 Bacteria 11915
98 Ga0068859_100791679 3300005617 Bacteria 1036
99 Ga0068864_100038610 3300005618 Bacteria 4079
100 Ga0068864_100152539 3300005618 Bacteria 2094
101 Ga0068864_100403821 3300005618 Bacteria 1299
102 Ga0068861_100214902 3300005719 Bacteria 1622
103 Ga0068861_100317760 3300005719 Unclassified 1355
104 Ga0068861_100837395 3300005719 Bacteria 866
105 Ga0068861_100897465 3300005719 Bacteria 839
106 Ga0068870_10010979 3300005840 Bacteria 4184
107 Ga0068870_10501125 3300005840 Bacteria 809
108 Ga0068870_10607300 3300005840 Bacteria 744
109 Ga0068863_100036567 3300005841 Bacteria 4677
110 Ga0068863_100064308 3300005841 Bacteria 3470
111 Ga0068860_100659788 3300005843 Bacteria 1054
112 Ga0068860_100784419 3300005843 Bacteria 966
113 Ga0068860_101465585 3300005843 Unclassified 704
114 Ga0068862_100197191 3300005844 Bacteria 1814
115 Ga0081455_10107807 3300005937 Bacteria 2220
116 Ga0081455_10979102 3300005937 Unclassified 524
117 Ga0070717_10061129 3300006028 Bacteria 3121
118 Ga0075365_10057486 3300006038 Unclassified 2588
119 Ga0075365_10259751 3300006038 Bacteria 1221
120 Ga0075368_10213764 3300006042 Unclassified 818
121 Ga0075364_10007745 3300006051 Bacteria 6396
122 Ga0075364_10012607 3300006051 Bacteria 5177
123 Ga0075364_10222614 3300006051 Bacteria 1281
124 Ga0070716_100137517 3300006173 Bacteria 1553
125 Ga0070716_100996812 3300006173 Archaea 662
126 Ga0075362_10000685 3300006177 Bacteria 10013
127 Ga0075367_10068020 3300006178 Bacteria 2136
128 Ga0075367_10141998 3300006178 Bacteria 1488
129 Ga0075367_10332483 3300006178 Bacteria 958
130 Ga0075366_10028529 3300006195 Bacteria 3276
131 Ga0097621_100038476 3300006237 Bacteria 3839
132 Ga0075370_10003877 3300006353 Bacteria 7168
133 Ga0075370_10227150 3300006353 Bacteria 1104
134 Ga0068871_100187680 3300006358 Unclassified 1779
135 Ga0068871_101255532 3300006358 Bacteria 696
136 Ga0075428_100019373 3300006844 Bacteria 7530
137 Ga0075428_100520969 3300006844 Bacteria 1272
138 Ga0075428_101243917 3300006844 Bacteria 784
139 Ga0075430_100115500 3300006846 Bacteria 2236
140 Ga0075430_100352809 3300006846 Bacteria 1215
141 Ga0075430_100395593 3300006846 Bacteria 1140
142 Ga0075431_100883925 3300006847 Bacteria 864
143 Ga0075433_10086886 3300006852 Bacteria 2762
144 Ga0075433_10258837 3300006852 Bacteria 1543
145 Ga0075433_10973118 3300006852 Bacteria 739
146 Ga0075434_100229389 3300006871 Bacteria 1876
147 Ga0075434_101065285 3300006871 Bacteria 822
148 Ga0075429_100149803 3300006880 Bacteria 2042
149 Ga0075429_100256593 3300006880 Bacteria 1531
150 Ga0068865_100401194 3300006881 Bacteria 1123
151 Ga0068865_100733838 3300006881 Bacteria 847
152 Ga0075436_100276608 3300006914 Bacteria 1200
153 Ga0075436_100846642 3300006914 Bacteria 682
154 Ga0097620_100006437 3300006931 Bacteria 11915
155 Ga0097620_100791806 3300006931 Bacteria 1036
156 Ga0075435_100019239 3300007076 Bacteria 5210
157 Ga0075435_100242880 3300007076 Unclassified 1532
158 Ga0099794_10148359 3300007265 Bacteria 1190
159 Ga0105240_10402565 3300009093 Bacteria 1541
160 Ga0111539_13416648 3300009094 Unclassified 510
161 Ga0105245_10096941 3300009098 Bacteria 2722
162 Ga0105247_10018207 3300009101 Bacteria 4213
163 Ga0105247_10682251 3300009101 Bacteria 771
164 Ga0114129_10012188 3300009147 Bacteria 12231
165 Ga0114129_10277776 3300009147 Bacteria 2239
166 Ga0114129_10368890 3300009147 Bacteria 1898
167 Ga0105243_10831318 3300009148 Bacteria 913
168 Ga0105243_12182147 3300009148 Bacteria 590
169 Ga0105241_10409234 3300009174 Bacteria 1191
170 Ga0105241_10712669 3300009174 Bacteria 917
171 Ga0105242_10314125 3300009176 Bacteria 1435
172 Ga0105248_10052810 3300009177 Bacteria 4561
173 Ga0105248_10096871 3300009177 Bacteria 3323
174 Ga0105248_11551821 3300009177 Bacteria 750
175 Ga0105237_10353620 3300009545 Bacteria 1474
176 Ga0105238_11001737 3300009551 Unclassified 856
177 Ga0105249_10049429 3300009553 Bacteria 3835
178 Ga0105239_13296880 3300010375 Unclassified 525
179 Ga0105246_10638565 3300011119 Bacteria 925
180 Ga0105246_10648396 3300011119 Bacteria 919
181 Ga0105246_10758542 3300011119 Bacteria 857
182 Ga0157369_11161115 3300013105 Bacteria 788
183 Ga0157374_10101474 3300013296 Bacteria 2759
184 Ga0157374_10222395 3300013296 Bacteria 1853
185 Ga0157374_10321434 3300013296 Bacteria 1533
186 Ga0163162_10014249 3300013306 Bacteria 7767
187 Ga0163162_12995546 3300013306 Bacteria 543
188 Ga0157375_10177539 3300013308 Bacteria 2280
189 Ga0157375_11576568 3300013308 Bacteria 776
190 Ga0157375_13259653 3300013308 Bacteria 541
191 Ga0163163_10027201 3300014325 Bacteria 5477
192 Ga0163163_10031195 3300014325 Bacteria 5143
193 Ga0163163_10035269 3300014325 Bacteria 4852
194 Ga0163163_10108128 3300014325 Bacteria 2808
195 Ga0163163_10276324 3300014325 Bacteria 1731
196 Ga0163163_10445482 3300014325 Bacteria 1355
197 Ga0163163_11151868 3300014325 Bacteria 838
198 Ga0157380_10022715 3300014326 Bacteria 4728
199 Ga0157380_10079629 3300014326 Bacteria 2676
200 Ga0157380_10251707 3300014326 Bacteria 1599
201 Ga0157377_10314266 3300014745 Bacteria 1039
202 Ga0157376_10040775 3300014969 Bacteria 3797
203 Ga0157376_10607925 3300014969 Bacteria 1089
204 Ga0157376_11678903 3300014969 Unclassified 670
205 Ga0157376_12166709 3300014969 Unclassified 594
206 Ga0207697_10039117 3300025315 Bacteria 1946
207 Ga0207680_10092127 3300025903 Bacteria 1930
208 Ga0207680_10283998 3300025903 Bacteria 1150
209 Ga0207699_10352067 3300025906 Bacteria 1040
210 Ga0207699_10842032 3300025906 Bacteria 675
211 Ga0207643_10009483 3300025908 Bacteria 5229
212 Ga0207643_10200632 3300025908 Bacteria 1214
213 Ga0207643_10359936 3300025908 Bacteria 914
214 Ga0207684_10453853 3300025910 Bacteria 1100
215 Ga0207707_10116941 3300025912 Bacteria 2330
216 Ga0207707_10290466 3300025912 Bacteria 1415
217 Ga0207663_10326456 3300025916 Bacteria 1155
218 Ga0207660_10077206 3300025917 Bacteria 2438
219 Ga0207662_10090212 3300025918 Bacteria 1884
220 Ga0207657_10111448 3300025919 Bacteria 2259
221 Ga0207649_11555392 3300025920 Unclassified 523
222 Ga0207681_10110800 3300025923 Bacteria 1996
223 Ga0207681_10117348 3300025923 Bacteria 1946
224 Ga0207681_10405517 3300025923 Bacteria 1102
225 Ga0207650_10016867 3300025925 Bacteria 5108
226 Ga0207650_10074774 3300025925 Bacteria 2555
227 Ga0207650_10116165 3300025925 Bacteria 2078
228 Ga0207650_10137951 3300025925 Bacteria 1915
229 Ga0207650_10640961 3300025925 Bacteria 895
230 Ga0207650_10800597 3300025925 Bacteria 799
231 Ga0207659_10002808 3300025926 Bacteria 10381
232 Ga0207659_10031032 3300025926 Bacteria 3655
233 Ga0207659_10325525 3300025926 Bacteria 1269
234 Ga0207687_10833452 3300025927 Bacteria 787
235 Ga0207700_10072066 3300025928 Bacteria 2663
236 Ga0207644_10021256 3300025931 Bacteria 4419
237 Ga0207706_10881724 3300025933 Bacteria 756
238 Ga0207686_10202890 3300025934 Bacteria 1421
239 Ga0207670_10321176 3300025936 Bacteria 1218
240 Ga0207670_10398089 3300025936 Bacteria 1100
241 Ga0207669_10015273 3300025937 Bacteria 3869
242 Ga0207669_10369190 3300025937 Bacteria 1115
243 Ga0207704_10431597 3300025938 Bacteria 1047
244 Ga0207704_11142370 3300025938 Bacteria 663
245 Ga0207665_10125614 3300025939 Bacteria 1816
246 Ga0207691_10037196 3300025940 Bacteria 4508
247 Ga0207711_10108759 3300025941 Bacteria 2463
248 Ga0207711_10405965 3300025941 Bacteria 1266
249 Ga0207689_10339625 3300025942 Bacteria 1247
250 Ga0207661_10013216 3300025944 Bacteria 6029
251 Ga0207661_10241784 3300025944 Bacteria 1602
252 Ga0207661_10726083 3300025944 Bacteria 914
253 Ga0207661_11468465 3300025944 Unclassified 625
254 Ga0207679_10007751 3300025945 Bacteria 6822
255 Ga0207679_10493548 3300025945 Unclassified 1092
256 Ga0207679_10919755 3300025945 Bacteria 800
257 Ga0207667_10321335 3300025949 Bacteria 1581
258 Ga0207651_10053211 3300025960 Bacteria 2766
259 Ga0207651_10280201 3300025960 Bacteria 1377
260 Ga0207651_10333259 3300025960 Bacteria 1272
261 Ga0207651_10498163 3300025960 Bacteria 1053
262 Ga0207651_11118466 3300025960 Unclassified 706
263 Ga0207712_10214600 3300025961 Bacteria 1535
264 Ga0207668_10107864 3300025972 Bacteria 2083
265 Ga0207658_11067050 3300025986 Bacteria 738
266 Ga0207703_10102783 3300026035 Bacteria 2425
267 Ga0207708_10540961 3300026075 Archaea 981
268 Ga0207702_11528836 3300026078 Bacteria 661
269 Ga0207641_10134251 3300026088 Bacteria 2226
270 Ga0207641_10134705 3300026088 Bacteria 2222
271 Ga0207641_10203638 3300026088 Bacteria 1826
272 Ga0207641_11061707 3300026088 Unclassified 808
273 Ga0207648_10383578 3300026089 Bacteria 1271
274 Ga0207676_10061279 3300026095 Bacteria 2978
275 Ga0207676_10132542 3300026095 Bacteria 2121
276 Ga0207674_10006302 3300026116 Bacteria 13979
277 Ga0207675_100156197 3300026118 Unclassified 2174
278 Ga0207675_101097020 3300026118 Unclassified 816
279 Ga0207683_10215715 3300026121 Bacteria 1748
280 Ga0207698_10952349 3300026142 Bacteria 868
281 Ga0209813_10215427 3300027866 Unclassified 717
282 Ga0268265_11227907 3300028380 Unclassified 748
283 Ga0268264_10723697 3300028381 Bacteria 990
284 Ga0268264_11571508 3300028381 Bacteria 668
285 Ga0265332_10040667 3300031238 Bacteria 2012
286 Ga0265320_10167622 3300031240 Bacteria 987
287 Ga0307416_101051985 3300032002 Bacteria 918
288 Ga0373936_0014257 3300035113 Bacteria 3038
289 Ga0373945_0136436 3300035116 Bacteria 986
290 Ga0373957_0099445 3300035120 Bacteria 1163
291 Ga0373943_0010671 3300035170 Bacteria 4123
292 Ga0373943_0686894 3300035170 Unclassified 606
293 Ga0373946_0002035 3300035171 Bacteria 7093
294 Ga0373955_0037641 3300035172 Bacteria 2573
295 Ga0373955_0432854 3300035172 Bacteria 801
296 Ga0373924_0018016 3300035410 Bacteria 2717
297 Ga0373931_1277571 3300035691 Bacteria 504
298 Ga0373935_0044356 3300035692 Bacteria 2802
299 Ga0373935_0783942 3300035692 Unclassified 703
300 Ga0373937_0241830 3300036401 Bacteria 1701
301 Ga0373937_0315505 3300036401 Bacteria 1479
302 Ga0373937_1109238 3300036401 Unclassified 740
303 Ga0242420_150683 3300038996 Unclassified 522
304 Ga0451793_1287735 3300041452 Unclassified 523
305 Ga0451802_0860437 3300041460 Bacteria 665
306 Ga0451853_0703430 3300041512 Unclassified 959
307 Ga0450923_039700 3300042125 Bacteria 986
308 Ga0495603_0014170 3300046455 Bacteria 4824
309 Ga0495629_0040543 3300046459 Bacteria 3276
310 Ga0495629_1087519 3300046459 Bacteria 517
311 Ga0495653_0669737 3300046463 Unclassified 632
312 Ga0495580_0893870 3300046472 Unclassified 571
313 Ga0495639_0317438 3300046475 Bacteria 779
314 Ga0495662_0587730 3300046476 Bacteria 545
315 Ga0495594_0028459 3300046499 Bacteria 3016
316 Ga0495666_0326202 3300046526 Unclassified 693
317 Ga0495640_0413564 3300046533 Unclassified 827
318 Ga0495586_0181629 3300046535 Bacteria 1190
319 Ga0495667_0095477 3300046559 Bacteria 1925
320 Ga0495656_0130227 3300046615 Bacteria 1197
321 Ga0495657_0629625 3300046675 Unclassified 619
322 Ga0495658_0072757 3300046683 Bacteria 2000
323 Ga0495658_0258498 3300046683 Bacteria 1096
324 Ga0495658_0303046 3300046683 Bacteria 1011
325 Ga0495669_0032854 3300046684 Bacteria 2282
326 Ga0495613_0723204 3300046689 Bacteria 654
327 Ga0495676_0127698 3300047321 Bacteria 1840
328 Ga0495676_0420801 3300047321 Bacteria 884
329 Ga0496100_1156921 3300048903 Bacteria 610
330 Ga0496104_0021456 3300048907 Bacteria 5929
331 Ga0496104_0297896 3300048907 Bacteria 1525
332 Ga0496105_0762366 3300048908 Bacteria 738
333 Ga0496106_0063099 3300048909 Bacteria 2815
334 Ga0496108_0012736 3300048911 Bacteria 6848
335 Ga0496109_0005603 3300048912 Bacteria 10509
336 Ga0496109_0303459 3300048912 Unclassified 1506
337 Ga0496110_0001690 3300048913 Bacteria 16202
338 Ga0496111_0017703 3300048914 Bacteria 4928
339 Ga0496112_0039623 3300048915 Bacteria 4605
340 Ga0496112_0081209 3300048915 Bacteria 3206
341 Ga0496113_0103174 3300048916 Bacteria 2212
342 Ga0496114_0619606 3300048917 Unclassified 953
343 Ga0501031_0026682 3300049568 Bacteria 3765
344 Ga0501033_0011558 3300049570 Bacteria 6753
345 Ga0501033_0348437 3300049570 Bacteria 1038
346 Ga0501034_0109486 3300049571 Bacteria 2753
347 Ga0501036_0006935 3300049572 Bacteria 9212
348 Ga0501036_0007803 3300049572 Bacteria 8752
349 Ga0501037_0055868 3300049573 Bacteria 2885
350 Ga0501038_0022321 3300049574 Bacteria 5673
351 Ga0501039_0165246 3300049575 Bacteria 1740
352 Ga0501039_0166773 3300049575 Bacteria 1731
353 Ga0501040_0004370 3300049576 Bacteria 9186
354 Ga0501040_0281150 3300049576 Bacteria 1189
355 Ga0501041_0086014 3300049577 Bacteria 1939
356 Ga0501042_0023646 3300049578 Bacteria 4302
357 Ga0501042_0132598 3300049578 Bacteria 1796
358 Ga0501043_0005156 3300049579 Bacteria 10569
359 Ga0501046_0018671 3300049580 Bacteria 5764
360 Ga0501046_0047162 3300049580 Bacteria 3416
361 Ga0501047_0020080 3300049581 Bacteria 6415
362 Ga0501048_0012631 3300049582 Bacteria 6280
363 Ga0501048_0134330 3300049582 Bacteria 1748
364 Ga0501048_0330488 3300049582 Bacteria 1086
365 Ga0501048_0933957 3300049582 Unclassified 624
366 Ga0501067_0044469 3300049583 Bacteria 2467
367 Ga0501068_0006793 3300049584 Bacteria 6326
368 Ga0501069_0014586 3300049585 Bacteria 4202
369 Ga0501070_0036654 3300049586 Bacteria 4095
370 Ga0501071_0075885 3300049587 Bacteria 2454
371 Ga0501071_0156390 3300049587 Bacteria 1702
372 Ga0501071_0520130 3300049587 Bacteria 913
373 Ga0501072_0073386 3300049588 Bacteria 2705
374 Ga0501072_0125505 3300049588 Bacteria 2045
375 Ga0501073_0025998 3300049589 Bacteria 4195
376 Ga0501074_0021203 3300049590 Bacteria 4719
377 Ga0501075_0023349 3300049591 Bacteria 4527
378 Ga0501075_0315958 3300049591 Bacteria 1190
379 Ga0501076_0021754 3300049592 Bacteria 4923
380 Ga0501076_0203193 3300049592 Bacteria 1618
381 Ga0501076_1057602 3300049592 Bacteria 668
382 Ga0501077_0138693 3300049593 Bacteria 1542
383 Ga0501079_0005148 3300049741 Bacteria 9720
384 Ga0501079_0083002 3300049741 Bacteria 2479
385 Ga0501079_0097053 3300049741 Bacteria 2285
386 Ga0501079_0188709 3300049741 Bacteria 1609
387 Ga0501079_0965090 3300049741 Unclassified 671
388 Ga0501080_0120502 3300049742 Bacteria 2431
389 Ga0501080_0715930 3300049742 Bacteria 882
390 Ga0501081_0142018 3300049743 Bacteria 1721
391 Ga0501081_0142682 3300049743 Bacteria 1717
392 Ga0501083_0062498 3300049744 Bacteria 2484
393 Ga0501083_0462091 3300049744 Unclassified 826
394 Ga0501035_0098441 3300049822 Bacteria 2567
395 Ga0501044_0657250 3300049823 Bacteria 937
396 Ga0501045_0005512 3300049824 Bacteria 8756
397 Ga0501045_0510237 3300049824 Unclassified 893
398 nmdc:mga00v17_8201_c1 3300050491 Bacteria 5615
399 nmdc:mga0yw44_43378_c1 3300050492 Bacteria 2685
400 nmdc:mga0yw44_535925_c1 3300050492 Unclassified 795
401 nmdc:mga0k408_12124_c1 3300050493 Bacteria 4708
402 nmdc:mga0k408_62980_c1 3300050493 Bacteria 2157
403 nmdc:mga0k408_81517_c1 3300050493 Bacteria 1895
404 nmdc:mga06z11_142099_c1 3300050494 Unclassified 1358
405 nmdc:mga06z11_227790_c1 3300050494 Bacteria 1091
406 nmdc:mga06z11_54154_c1 3300050494 Bacteria 2067
407 nmdc:mga07m45_30446_c1 3300050496 Bacteria 2989
408 nmdc:mga07m45_605322_c1 3300050496 Unclassified 633
409 nmdc:mga05p37_217569_c1 3300050507 Bacteria 2307
410 nmdc:mga05p37_238238_c1 3300050507 Bacteria 2189
411 nmdc:mga09592_205976_c1 3300050508 Bacteria 1704
412 nmdc:mga09592_321847_c1 3300050508 Bacteria 1339
413 nmdc:mga0qj67_454902_c1 3300050509 Bacteria 1031
414 nmdc:mga06r32_774716_c1 3300050510 Bacteria 921
415 nmdc:mga06r32_842228_c1 3300050510 Bacteria 876
416 nmdc:mga0n895_1155643_c1 3300050512 Bacteria 750
417 nmdc:mga0n895_988780_c1 3300050512 Bacteria 823
418 nmdc:mga0rr50_11315_c1 3300050513 Bacteria 5706
419 nmdc:mga0rr50_45029_c1 3300050513 Unclassified 3240
420 nmdc:mga0rr50_959735_c1 3300050513 Bacteria 729
421 nmdc:mga08x19_215840_c1 3300050514 Unclassified 1317
422 nmdc:mga08x19_72356_c1 3300050514 Bacteria 2249
423 nmdc:mga08x19_728961_c1 3300050514 Bacteria 704
424 nmdc:mga08x19_84432_c1 3300050514 Bacteria 2089
425 nmdc:mga0a205_182975_c1 3300050515 Bacteria 1989
426 nmdc:mga0a205_278082_c1 3300050515 Bacteria 1550
427 nmdc:mga0a205_593842_c1 3300050515 Bacteria 961
428 nmdc:mga0a205_706964_c1 3300050515 Bacteria 857
429 nmdc:mga0sz30_473136_c1 3300050516 Bacteria 563
430 Ga0495601_0027355 3300053077 Bacteria 3526
431 Ga0495601_0292816 3300053077 Bacteria 1061
432 Ga0495619_0057764 3300053085 Bacteria 2575
433 Ga0500641_0058060 3300053096 Bacteria 1606
434 Ga0500628_031326 3300053129 Bacteria 1156
435 Ga0501084_0011738 3300054114 Bacteria 7253
436 Ga0501084_0165223 3300054114 Bacteria 1868
437 Ga0501084_0277698 3300054114 Bacteria 1415
438 Ga0501084_0356452 3300054114 Bacteria 1236
439 Ga0501084_1051099 3300054114 Unclassified 684
440 Ga0501082_0118417 3300060353 Bacteria 2294
441 Ga0501082_0183926 3300060353 Bacteria 1818
442 Ga0501082_0623778 3300060353 Bacteria 943
443 Ga0530510_0022217 3300061734 Bacteria 4518
444 Ga0530510_0327753 3300061734 Bacteria 1148
445 Ga0070708_101549403
446 Ga0065714_10070916
447 Ga0065712_10000733
448 Ga0065715_10000217
449 Ga0065707_10409913
450 Ga0065707_10776063
451 Ga0070683_100020578
452 Ga0070683_100052000
453 Ga0070683_100084129
454 Ga0070690_101218214
455 Ga0070670_100001636
456 Ga0070670_100003152
457 Ga0070670_100166173
458 Ga0070670_100582037
459 Ga0068869_100602472
460 Ga0070666_10141736
461 Ga0070666_10308204
462 Ga0070680_100488228
463 Ga0068868_100263566
464 Ga0068868_100344470
465 Ga0070660_100105566
466 Ga0070687_100017744
467 Ga0070661_101429412
468 Ga0070668_100111022
469 Ga0070669_100087190
470 Ga0070669_100125970
471 Ga0070669_101271676
472 Ga0070675_100001790
473 Ga0070675_100004351
474 Ga0070675_100025683
475 Ga0070671_100134261
476 Ga0070671_101846265
477 Ga0070674_100016700
478 Ga0070674_100202941
479 Ga0070674_100528027
480 Ga0070673_100010156
481 Ga0070673_100122225
482 Ga0070673_101394354
483 Ga0070688_100126256
484 Ga0070688_100673677
485 Ga0070688_101363626
486 Ga0070667_100744910
487 Ga0070667_100803566
488 Ga0070709_10655604
489 Ga0070701_10047757
490 Ga0070711_100813032
491 Ga0070700_100299025
492 Ga0070694_100001500
493 Ga0070708_100109142
494 Ga0070663_101773614
495 Ga0070663_101912830
496 Ga0070678_100068505
497 Ga0070678_101023743
498 Ga0070662_100011910
499 Ga0070681_10139254
500 Ga0068867_100403991
501 Ga0070685_10013454
502 Ga0070706_100301863
503 Ga0070706_101096594
504 Ga0070706_101324439
505 Ga0070707_100410800
506 Ga0070698_100016375
507 Ga0070698_101502566
508 Ga0070698_101762987
509 Ga0070699_100001525
510 Ga0070699_100214141
511 Ga0070699_100530916
512 Ga0070699_100822456
513 Ga0070684_100007971
514 Ga0070684_100056201
515 Ga0070697_100242557
516 Ga0070697_100363623
517 Ga0070697_100651258
518 Ga0070672_100006840
519 Ga0070672_100197925
520 Ga0070686_100085315
521 Ga0070695_100001592
522 Ga0070696_100035013
523 Ga0070696_100237950
524 Ga0070696_101114112
525 Ga0070693_101450986
526 Ga0070665_100025339
527 Ga0070665_100218765
528 Ga0070704_100305606
529 Ga0068855_100398655
530 Ga0068855_100987751
531 Ga0070664_100008246
532 Ga0070664_100020786
533 Ga0070664_100093852
534 Ga0070664_100920121
535 Ga0068857_100012638
536 Ga0068857_102380979
537 Ga0068854_100060164
538 Ga0068856_100084031
539 Ga0068852_101171925
540 Ga0068852_101915488
541 Ga0068859_100006437
542 Ga0068859_100791679
543 Ga0068864_100038610
544 Ga0068864_100152539
545 Ga0068864_100403821
546 Ga0068861_100214902
547 Ga0068861_100317760
548 Ga0068861_100837395
549 Ga0068861_100897465
550 Ga0068870_10010979
551 Ga0068870_10501125
552 Ga0068870_10607300
553 Ga0068863_100036567
554 Ga0068863_100064308
555 Ga0068860_100659788
556 Ga0068860_100784419
557 Ga0068860_101465585
558 Ga0068862_100197191
559 Ga0081455_10107807
560 Ga0081455_10979102
561 Ga0070717_10061129
562 Ga0075365_10057486
563 Ga0075365_10259751
564 Ga0075368_10213764
565 Ga0075364_10007745
566 Ga0075364_10012607
567 Ga0075364_10222614
568 Ga0070716_100137517
569 Ga0070716_100996812
570 Ga0075362_10000685
571 Ga0075367_10068020
572 Ga0075367_10141998
573 Ga0075367_10332483
574 Ga0075366_10028529
575 Ga0097621_100038476
576 Ga0075370_10003877
577 Ga0075370_10227150
578 Ga0068871_100187680
579 Ga0068871_101255532
580 Ga0075428_100019373
581 Ga0075428_100520969
582 Ga0075428_101243917
583 Ga0075430_100115500
584 Ga0075430_100352809
585 Ga0075430_100395593
586 Ga0075431_100883925
587 Ga0075433_10086886
588 Ga0075433_10258837
589 Ga0075433_10973118
590 Ga0075434_100229389
591 Ga0075434_101065285
592 Ga0075429_100149803
593 Ga0075429_100256593
594 Ga0068865_100401194
595 Ga0068865_100733838
596 Ga0075436_100276608
597 Ga0075436_100846642
598 Ga0097620_100006437
599 Ga0097620_100791806
600 Ga0075435_100019239
601 Ga0075435_100242880
602 Ga0099794_10148359
603 Ga0105240_10402565
604 Ga0111539_13416648
605 Ga0105245_10096941
606 Ga0105247_10018207
607 Ga0105247_10682251
608 Ga0114129_10012188
609 Ga0114129_10277776
610 Ga0114129_10368890
611 Ga0105243_10831318
612 Ga0105243_12182147
613 Ga0105241_10409234
614 Ga0105241_10712669
615 Ga0105242_10314125
616 Ga0105248_10052810
617 Ga0105248_10096871
618 Ga0105248_11551821
619 Ga0105237_10353620
620 Ga0105238_11001737
621 Ga0105249_10049429
622 Ga0105239_13296880
623 Ga0105246_10638565
624 Ga0105246_10648396
625 Ga0105246_10758542
626 Ga0157369_11161115
627 Ga0157374_10101474
628 Ga0157374_10222395
629 Ga0157374_10321434
630 Ga0163162_10014249
631 Ga0163162_12995546
632 Ga0157375_10177539
633 Ga0157375_11576568
634 Ga0157375_13259653
635 Ga0163163_10027201
636 Ga0163163_10031195
637 Ga0163163_10035269
638 Ga0163163_10108128
639 Ga0163163_10276324
640 Ga0163163_10445482
641 Ga0163163_11151868
642 Ga0157380_10022715
643 Ga0157380_10079629
644 Ga0157380_10251707
645 Ga0157377_10314266
646 Ga0157376_10040775
647 Ga0157376_10607925
648 Ga0157376_11678903
649 Ga0157376_12166709
650 Ga0207697_10039117
651 Ga0207680_10092127
652 Ga0207680_10283998
653 Ga0207699_10352067
654 Ga0207699_10842032
655 Ga0207643_10009483
656 Ga0207643_10200632
657 Ga0207643_10359936
658 Ga0207684_10453853
659 Ga0207707_10116941
660 Ga0207707_10290466
661 Ga0207663_10326456
662 Ga0207660_10077206
663 Ga0207662_10090212
664 Ga0207657_10111448
665 Ga0207649_11555392
666 Ga0207681_10110800
667 Ga0207681_10117348
668 Ga0207681_10405517
669 Ga0207650_10016867
670 Ga0207650_10074774
671 Ga0207650_10116165
672 Ga0207650_10137951
673 Ga0207650_10640961
674 Ga0207650_10800597
675 Ga0207659_10002808
676 Ga0207659_10031032
677 Ga0207659_10325525
678 Ga0207687_10833452
679 Ga0207700_10072066
680 Ga0207644_10021256
681 Ga0207706_10881724
682 Ga0207686_10202890
683 Ga0207670_10321176
684 Ga0207670_10398089
685 Ga0207669_10015273
686 Ga0207669_10369190
687 Ga0207704_10431597
688 Ga0207704_11142370
689 Ga0207665_10125614
690 Ga0207691_10037196
691 Ga0207711_10108759
692 Ga0207711_10405965
693 Ga0207689_10339625
694 Ga0207661_10013216
695 Ga0207661_10241784
696 Ga0207661_10726083
697 Ga0207661_11468465
698 Ga0207679_10007751
699 Ga0207679_10493548
700 Ga0207679_10919755
701 Ga0207667_10321335
702 Ga0207651_10053211
703 Ga0207651_10280201
704 Ga0207651_10333259
705 Ga0207651_10498163
706 Ga0207651_11118466
707 Ga0207712_10214600
708 Ga0207668_10107864
709 Ga0207658_11067050
710 Ga0207703_10102783
711 Ga0207708_10540961
712 Ga0207702_11528836
713 Ga0207641_10134251
714 Ga0207641_10134705
715 Ga0207641_10203638
716 Ga0207641_11061707
717 Ga0207648_10383578
718 Ga0207676_10061279
719 Ga0207676_10132542
720 Ga0207674_10006302
721 Ga0207675_100156197
722 Ga0207675_101097020
723 Ga0207683_10215715
724 Ga0207698_10952349
725 Ga0209813_10215427
726 Ga0268265_11227907
727 Ga0268264_10723697
728 Ga0268264_11571508
729 Ga0265332_10040667
730 Ga0265320_10167622
731 Ga0307416_101051985
732 Ga0373936_0014257
733 Ga0373945_0136436
734 Ga0373957_0099445
735 Ga0373943_0010671
736 Ga0373943_0686894
737 Ga0373946_0002035
738 Ga0373955_0037641
739 Ga0373955_0432854
740 Ga0373924_0018016
741 Ga0373931_1277571
742 Ga0373935_0044356
743 Ga0373935_0783942
744 Ga0373937_0241830
745 Ga0373937_0315505
746 Ga0373937_1109238
747 Ga0242420_150683
748 Ga0451793_1287735
749 Ga0451802_0860437
750 Ga0451853_0703430
751 Ga0450923_039700
752 Ga0495603_0014170
753 Ga0495629_0040543
754 Ga0495629_1087519
755 Ga0495653_0669737
756 Ga0495580_0893870
757 Ga0495639_0317438
758 Ga0495662_0587730
759 Ga0495594_0028459
760 Ga0495666_0326202
761 Ga0495640_0413564
762 Ga0495586_0181629
763 Ga0495667_0095477
764 Ga0495656_0130227
765 Ga0495657_0629625
766 Ga0495658_0072757
767 Ga0495658_0258498
768 Ga0495658_0303046
769 Ga0495669_0032854
770 Ga0495613_0723204
771 Ga0495676_0127698
772 Ga0495676_0420801
773 Ga0496100_1156921
774 Ga0496104_0021456
775 Ga0496104_0297896
776 Ga0496105_0762366
777 Ga0496106_0063099
778 Ga0496108_0012736
779 Ga0496109_0005603
780 Ga0496109_0303459
781 Ga0496110_0001690
782 Ga0496111_0017703
783 Ga0496112_0039623
784 Ga0496112_0081209
785 Ga0496113_0103174
786 Ga0496114_0619606
787 Ga0501031_0026682
788 Ga0501033_0011558
789 Ga0501033_0348437
790 Ga0501034_0109486
791 Ga0501036_0006935
792 Ga0501036_0007803
793 Ga0501037_0055868
794 Ga0501038_0022321
795 Ga0501039_0165246
796 Ga0501039_0166773
797 Ga0501040_0004370
798 Ga0501040_0281150
799 Ga0501041_0086014
800 Ga0501042_0023646
801 Ga0501042_0132598
802 Ga0501043_0005156
803 Ga0501046_0018671
804 Ga0501046_0047162
805 Ga0501047_0020080
806 Ga0501048_0012631
807 Ga0501048_0134330
808 Ga0501048_0330488
809 Ga0501048_0933957
810 Ga0501067_0044469
811 Ga0501068_0006793
812 Ga0501069_0014586
813 Ga0501070_0036654
814 Ga0501071_0075885
815 Ga0501071_0156390
816 Ga0501071_0520130
817 Ga0501072_0073386
818 Ga0501072_0125505
819 Ga0501073_0025998
820 Ga0501074_0021203
821 Ga0501075_0023349
822 Ga0501075_0315958
823 Ga0501076_0021754
824 Ga0501076_0203193
825 Ga0501076_1057602
826 Ga0501077_0138693
827 Ga0501079_0005148
828 Ga0501079_0083002
829 Ga0501079_0097053
830 Ga0501079_0188709
831 Ga0501079_0965090
832 Ga0501080_0120502
833 Ga0501080_0715930
834 Ga0501081_0142018
835 Ga0501081_0142682
836 Ga0501083_0062498
837 Ga0501083_0462091
838 Ga0501035_0098441
839 Ga0501044_0657250
840 Ga0501045_0005512
841 Ga0501045_0510237
842 nmdc:mga00v17_8201_c1
843 nmdc:mga0yw44_43378_c1
844 nmdc:mga0yw44_535925_c1
845 nmdc:mga0k408_12124_c1
846 nmdc:mga0k408_62980_c1
847 nmdc:mga0k408_81517_c1
848 nmdc:mga06z11_142099_c1
849 nmdc:mga06z11_227790_c1
850 nmdc:mga06z11_54154_c1
851 nmdc:mga07m45_30446_c1
852 nmdc:mga07m45_605322_c1
853 nmdc:mga05p37_217569_c1
854 nmdc:mga05p37_238238_c1
855 nmdc:mga09592_205976_c1
856 nmdc:mga09592_321847_c1
857 nmdc:mga0qj67_454902_c1
858 nmdc:mga06r32_774716_c1
859 nmdc:mga06r32_842228_c1
860 nmdc:mga0n895_1155643_c1
861 nmdc:mga0n895_988780_c1
862 nmdc:mga0rr50_11315_c1
863 nmdc:mga0rr50_45029_c1
864 nmdc:mga0rr50_959735_c1
865 nmdc:mga08x19_215840_c1
866 nmdc:mga08x19_72356_c1
867 nmdc:mga08x19_728961_c1
868 nmdc:mga08x19_84432_c1
869 nmdc:mga0a205_182975_c1
870 nmdc:mga0a205_278082_c1
871 nmdc:mga0a205_593842_c1
872 nmdc:mga0a205_706964_c1
873 nmdc:mga0sz30_473136_c1
874 Ga0495601_0027355
875 Ga0495601_0292816
876 Ga0495619_0057764
877 Ga0500641_0058060
878 Ga0500628_031326
879 Ga0501084_0011738
880 Ga0501084_0165223
881 Ga0501084_0277698
882 Ga0501084_0356452
883 Ga0501084_1051099
884 Ga0501082_0118417
885 Ga0501082_0183926
886 Ga0501082_0623778
887 Ga0530510_0022217
888 Ga0530510_0327753

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

17

63

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ija-assembly1.cif.gz_A structure of s. aureus methicillin resistance factor mecr2 0.9298 20 75
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9242 20 75
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9229 20 76
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9037 26 76
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9022 18 74
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.958 17 73 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9513 15 74 1.10.10.10
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.941 19 74 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9394 20 76 1.10.10.10
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9317 17 76 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A430RUP9-F1-model_v4 ArsR family transcriptional regulator 0.965 5 75 GO:0003700
AF-M3HKB8-F1-model_v4 Transcriptional regulator, ArsR family 0.9639 6 74 GO:0003700
AF-A0A523ZZJ4-F1-model_v4 ArsR family transcriptional regulator 0.9526 2 75 GO:0003700
AF-A0A2R6CW36-F1-model_v4 Transcriptional regulator 0.948 1 75 GO:0003700
AF-A0A3A4PK29-F1-model_v4 Methyltransferase domain-containing protein 0.9443 9 109 GO:0003700
GO:0008168
GO:0032259

Map