F445217

General Info

Members Datasets Scaffolds Average Seq Length
444 226 888 119

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10590197|Ga0070658_105901972
Length 125
Sequence MNEREFAQKLKPWLDRTAAGIGEVQATKLRAARLRALDAYRQPVRLWGLIPVGAGAADTLRYSVVQRSLLWLPLVALVAALAWHAAQQPQQLDIGDLDAQLLTQELPPDAFLDKDFRSWLDSSRG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
173 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
176 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
177 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.7
Nodule 0
Rhizoplane 0.68
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 5.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10590197 3300005327 Bacteria 962
2 Ga0065712_10260558 3300005290 Bacteria 938
3 Ga0070658_10016205 3300005327 Bacteria 5962
4 Ga0070658_10128943 3300005327 Bacteria 2107
5 Ga0070658_10506066 3300005327 Unclassified 1043
6 Ga0070658_11690513 3300005327 Bacteria 548
7 Ga0070676_10254820 3300005328 Bacteria 1172
8 Ga0070683_100319735 3300005329 Bacteria 1477
9 Ga0070683_100438957 3300005329 Bacteria 1246
10 Ga0070690_100163573 3300005330 Bacteria 1527
11 Ga0070690_100238817 3300005330 Unclassified 1281
12 Ga0070670_100400234 3300005331 Unclassified 1212
13 Ga0070670_101423599 3300005331 Bacteria 636
14 Ga0068869_100180710 3300005334 Bacteria 1654
15 Ga0068869_100246991 3300005334 Bacteria 1424
16 Ga0068869_100822730 3300005334 Bacteria 799
17 Ga0070680_100566468 3300005336 Bacteria 974
18 Ga0070680_100571056 3300005336 Bacteria 970
19 Ga0070680_100747591 3300005336 Bacteria 842
20 Ga0070682_101443898 3300005337 Bacteria 590
21 Ga0068868_100022405 3300005338 Bacteria 4766
22 Ga0068868_100346353 3300005338 Bacteria 1272
23 Ga0068868_101838338 3300005338 Bacteria 573
24 Ga0070660_100421713 3300005339 Bacteria 1105
25 Ga0070689_100017643 3300005340 Bacteria 5246
26 Ga0070689_100048979 3300005340 Bacteria 3260
27 Ga0070689_100243593 3300005340 Bacteria 1481
28 Ga0070661_100020519 3300005344 Bacteria 4714
29 Ga0070661_100327318 3300005344 Bacteria 1198
30 Ga0070661_100491547 3300005344 Bacteria 981
31 Ga0070661_100604855 3300005344 Bacteria 887
32 Ga0070661_101834355 3300005344 Bacteria 515
33 Ga0070692_10025162 3300005345 Bacteria 2933
34 Ga0070692_10779529 3300005345 Bacteria 651
35 Ga0070669_100139657 3300005353 Bacteria 1867
36 Ga0070675_100016154 3300005354 Bacteria 5918
37 Ga0070674_100064693 3300005356 Bacteria 2564
38 Ga0070674_100762015 3300005356 Unclassified 833
39 Ga0070674_100877681 3300005356 Bacteria 780
40 Ga0070673_100076016 3300005364 Bacteria 2710
41 Ga0070673_100100163 3300005364 Bacteria 2385
42 Ga0070688_100045493 3300005365 Bacteria 2712
43 Ga0070688_100280538 3300005365 Bacteria 1197
44 Ga0070659_100097156 3300005366 Bacteria 2367
45 Ga0070659_101002927 3300005366 Bacteria 733
46 Ga0070659_101740017 3300005366 Bacteria 558
47 Ga0070714_101415984 3300005435 Bacteria 679
48 Ga0070714_101419234 3300005435 Bacteria 678
49 Ga0070713_100019141 3300005436 Bacteria 5218
50 Ga0070713_100054819 3300005436 Bacteria 3310
51 Ga0070710_11026849 3300005437 Bacteria 602
52 Ga0070701_10195682 3300005438 Bacteria 1192
53 Ga0070701_10253350 3300005438 Bacteria 1064
54 Ga0070701_10455645 3300005438 Unclassified 822
55 Ga0070711_100064554 3300005439 Bacteria 2559
56 Ga0070711_100614820 3300005439 Bacteria 908
57 Ga0070705_100162088 3300005440 Bacteria 1496
58 Ga0070700_101775832 3300005441 Bacteria 531
59 Ga0070694_100819737 3300005444 Bacteria 764
60 Ga0070678_100098068 3300005456 Bacteria 2265
61 Ga0070662_100269629 3300005457 Bacteria 1374
62 Ga0070681_10083907 3300005458 Bacteria 3139
63 Ga0070681_10119782 3300005458 Bacteria 2568
64 Ga0070681_11227823 3300005458 Bacteria 672
65 Ga0068867_100355894 3300005459 Bacteria 1223
66 Ga0068867_101476005 3300005459 Unclassified 632
67 Ga0070685_10335930 3300005466 Bacteria 1029
68 Ga0070685_10398054 3300005466 Bacteria 953
69 Ga0070685_10510169 3300005466 Bacteria 852
70 Ga0070707_100206198 3300005468 Bacteria 1916
71 Ga0070698_100477014 3300005471 Bacteria 1184
72 Ga0070679_100134281 3300005530 Bacteria 2456
73 Ga0070679_100652396 3300005530 Bacteria 995
74 Ga0070679_100726425 3300005530 Bacteria 936
75 Ga0070684_100052196 3300005535 Bacteria 3555
76 Ga0070684_100249038 3300005535 Bacteria 1624
77 Ga0070684_100653144 3300005535 Bacteria 979
78 Ga0070697_100590160 3300005536 Bacteria 976
79 Ga0070697_101024694 3300005536 Bacteria 734
80 Ga0070697_101147977 3300005536 Bacteria 692
81 Ga0068853_100036312 3300005539 Bacteria 4190
82 Ga0068853_100382184 3300005539 Bacteria 1315
83 Ga0068853_101888653 3300005539 Unclassified 579
84 Ga0070672_100108952 3300005543 Bacteria 2255
85 Ga0070696_100342498 3300005546 Bacteria 1156
86 Ga0070696_100808798 3300005546 Bacteria 772
87 Ga0070693_100003062 3300005547 Bacteria 7759
88 Ga0070693_100504793 3300005547 Bacteria 858
89 Ga0070693_100805734 3300005547 Bacteria 696
90 Ga0070693_100938114 3300005547 Bacteria 651
91 Ga0070665_100199640 3300005548 Bacteria 2001
92 Ga0070665_100226269 3300005548 Bacteria 1871
93 Ga0070665_100605936 3300005548 Bacteria 1108
94 Ga0070665_100769473 3300005548 Bacteria 976
95 Ga0068855_100024330 3300005563 Bacteria 7249
96 Ga0068855_100035898 3300005563 Bacteria 5903
97 Ga0068855_100071988 3300005563 Bacteria 4018
98 Ga0068855_100081936 3300005563 Bacteria 3740
99 Ga0070664_100680350 3300005564 Bacteria 958
100 Ga0068857_100042864 3300005577 Bacteria 4014
101 Ga0068854_100513601 3300005578 Bacteria 1011
102 Ga0068854_101751855 3300005578 Unclassified 569
103 Ga0068856_100057004 3300005614 Bacteria 3856
104 Ga0070702_100128607 3300005615 Bacteria 1596
105 Ga0068852_100016657 3300005616 Bacteria 5742
106 Ga0068852_100021200 3300005616 Bacteria 5181
107 Ga0068852_100023897 3300005616 Bacteria 4930
108 Ga0068852_100068410 3300005616 Bacteria 3108
109 Ga0068852_100258255 3300005616 Bacteria 1672
110 Ga0068852_102077899 3300005616 Unclassified 590
111 Ga0068859_100120756 3300005617 Bacteria 2687
112 Ga0068859_100244799 3300005617 Bacteria 1883
113 Ga0068861_100196116 3300005719 Bacteria 1692
114 Ga0068851_10003487 3300005834 Bacteria 7006
115 Ga0068851_10189155 3300005834 Bacteria 1144
116 Ga0068863_100447224 3300005841 Bacteria 1268
117 Ga0068858_100000826 3300005842 Bacteria 32308
118 Ga0068858_101544643 3300005842 Bacteria 655
119 Ga0068858_102027659 3300005842 Unclassified 569
120 Ga0068860_100309408 3300005843 Bacteria 1549
121 Ga0081539_10276931 3300005985 Bacteria 732
122 Ga0075364_10008810 3300006051 Bacteria 6038
123 Ga0075367_10552462 3300006178 Bacteria 731
124 Ga0075369_10017685 3300006186 Bacteria 2895
125 Ga0075366_10000594 3300006195 Bacteria 16938
126 Ga0075366_10041043 3300006195 Bacteria 2738
127 Ga0097621_100024388 3300006237 Bacteria 4723
128 Ga0097621_100111846 3300006237 Bacteria 2308
129 Ga0097621_100476213 3300006237 Bacteria 1128
130 Ga0097621_101782138 3300006237 Unclassified 587
131 Ga0075370_10491779 3300006353 Bacteria 740
132 Ga0068871_100046070 3300006358 Bacteria 3511
133 Ga0068871_100081730 3300006358 Bacteria 2677
134 Ga0068871_100208523 3300006358 Bacteria 1689
135 Ga0075428_100004487 3300006844 Bacteria 15406
136 Ga0075433_10446674 3300006852 Bacteria 1140
137 Ga0075434_100240803 3300006871 Bacteria 1829
138 Ga0075434_100287466 3300006871 Bacteria 1664
139 Ga0097620_100120754 3300006931 Bacteria 2687
140 Ga0097620_100244784 3300006931 Bacteria 1883
141 Ga0105240_10050301 3300009093 Bacteria 5255
142 Ga0105240_10056013 3300009093 Bacteria 4935
143 Ga0105240_10069974 3300009093 Bacteria 4342
144 Ga0105240_10085610 3300009093 Bacteria 3862
145 Ga0105240_10214584 3300009093 Bacteria 2246
146 Ga0111539_10001137 3300009094 Bacteria 35183
147 Ga0105245_10055455 3300009098 Bacteria 3560
148 Ga0105245_10475724 3300009098 Bacteria 1262
149 Ga0105245_11337491 3300009098 Bacteria 766
150 Ga0114129_10605471 3300009147 Bacteria 1419
151 Ga0105243_10169819 3300009148 Bacteria 1888
152 Ga0105243_10613412 3300009148 Unclassified 1049
153 Ga0105243_11117994 3300009148 Bacteria 797
154 Ga0105243_11594350 3300009148 Bacteria 679
155 Ga0105243_12693410 3300009148 Unclassified 537
156 Ga0105241_10102749 3300009174 Bacteria 2275
157 Ga0105241_10577380 3300009174 Bacteria 1013
158 Ga0105241_10664841 3300009174 Bacteria 947
159 Ga0105242_10010873 3300009176 Bacteria 6989
160 Ga0105242_10022376 3300009176 Bacteria 4969
161 Ga0105242_10149773 3300009176 Bacteria 2033
162 Ga0105242_10490287 3300009176 Bacteria 1167
163 Ga0105248_10070664 3300009177 Bacteria 3920
164 Ga0105248_10194079 3300009177 Bacteria 2288
165 Ga0105248_10265895 3300009177 Bacteria 1930
166 Ga0105248_10428739 3300009177 Bacteria 1489
167 Ga0105237_10341149 3300009545 Bacteria 1503
168 Ga0105237_11038086 3300009545 Bacteria 826
169 Ga0105237_11417206 3300009545 Bacteria 701
170 Ga0105237_11964116 3300009545 Bacteria 593
171 Ga0105238_10034741 3300009551 Bacteria 5128
172 Ga0105238_10236196 3300009551 Bacteria 1805
173 Ga0105238_11215077 3300009551 Bacteria 778
174 Ga0105238_11661285 3300009551 Bacteria 669
175 Ga0105238_12016425 3300009551 Bacteria 611
176 Ga0105249_10175646 3300009553 Bacteria 2080
177 Ga0105239_10545202 3300010375 Bacteria 1321
178 Ga0157373_10582551 3300013100 Bacteria 813
179 Ga0157371_10149515 3300013102 Bacteria 1665
180 Ga0157370_10038599 3300013104 Bacteria 4619
181 Ga0157370_10358392 3300013104 Bacteria 1344
182 Ga0157370_10486845 3300013104 Bacteria 1133
183 Ga0157369_10009003 3300013105 Bacteria 11434
184 Ga0157369_10413788 3300013105 Bacteria 1398
185 Ga0157374_10072329 3300013296 Bacteria 3253
186 Ga0157374_10383072 3300013296 Bacteria 1401
187 Ga0157374_10877721 3300013296 Bacteria 914
188 Ga0157374_11249107 3300013296 Bacteria 764
189 Ga0157378_10205962 3300013297 Bacteria 1863
190 Ga0157378_10584118 3300013297 Bacteria 1126
191 Ga0163162_10039559 3300013306 Bacteria 4713
192 Ga0163162_10159515 3300013306 Bacteria 2377
193 Ga0163162_10523470 3300013306 Bacteria 1315
194 Ga0163162_10560355 3300013306 Bacteria 1270
195 Ga0163162_11308166 3300013306 Bacteria 824
196 Ga0157372_10000281 3300013307 Bacteria 56476
197 Ga0157372_10007839 3300013307 Bacteria 11345
198 Ga0157372_10325225 3300013307 Bacteria 1790
199 Ga0157372_11068091 3300013307 Bacteria 934
200 Ga0157372_11167392 3300013307 Bacteria 890
201 Ga0157375_10087857 3300013308 Bacteria 3162
202 Ga0157375_10432685 3300013308 Bacteria 1482
203 Ga0163163_10714236 3300014325 Bacteria 1066
204 Ga0163163_11896417 3300014325 Bacteria 656
205 Ga0157380_10030963 3300014326 Bacteria 4103
206 Ga0157380_10513727 3300014326 Bacteria 1167
207 Ga0157380_10675842 3300014326 Bacteria 1034
208 Ga0157380_10829968 3300014326 Bacteria 944
209 Ga0157380_11156332 3300014326 Unclassified 816
210 Ga0157380_11679458 3300014326 Bacteria 692
211 Ga0157380_11741588 3300014326 Bacteria 681
212 Ga0157380_11876007 3300014326 Bacteria 659
213 Ga0157380_12761650 3300014326 Bacteria 558
214 Ga0157377_10005259 3300014745 Bacteria 6061
215 Ga0157379_10041517 3300014968 Bacteria 4106
216 Ga0157379_10061811 3300014968 Bacteria 3350
217 Ga0157379_10252474 3300014968 Bacteria 1601
218 Ga0157376_10054518 3300014969 Bacteria 3333
219 Ga0157376_10089308 3300014969 Bacteria 2664
220 Ga0157376_10380326 3300014969 Bacteria 1360
221 Ga0163161_10042407 3300017792 Bacteria 3273
222 Ga0206356_10736874 3300020070 Bacteria 867
223 Ga0206356_11093282 3300020070 Bacteria 1241
224 Ga0213876_10194666 3300021384 Bacteria 1078
225 Ga0224712_10314267 3300022467 Bacteria 735
226 Ga0224712_10430396 3300022467 Bacteria 632
227 Ga0207656_10001103 3300025321 Bacteria 8866
228 Ga0207656_10128660 3300025321 Bacteria 1185
229 Ga0207682_10038566 3300025893 Bacteria 1939
230 Ga0207688_10198962 3300025901 Bacteria 1201
231 Ga0207685_10076275 3300025905 Bacteria 1374
232 Ga0207699_10761293 3300025906 Bacteria 711
233 Ga0207643_10039579 3300025908 Bacteria 2652
234 Ga0207705_10008949 3300025909 Bacteria 7291
235 Ga0207705_10014403 3300025909 Bacteria 5691
236 Ga0207705_10692041 3300025909 Bacteria 792
237 Ga0207705_10757797 3300025909 Bacteria 754
238 Ga0207705_10872279 3300025909 Bacteria 698
239 Ga0207654_10099677 3300025911 Bacteria 1788
240 Ga0207654_10455939 3300025911 Bacteria 897
241 Ga0207654_10898065 3300025911 Bacteria 642
242 Ga0207707_10042702 3300025912 Bacteria 3956
243 Ga0207707_10107329 3300025912 Bacteria 2441
244 Ga0207707_10507722 3300025912 Bacteria 1028
245 Ga0207695_10062176 3300025913 Bacteria 3856
246 Ga0207695_10074059 3300025913 Bacteria 3467
247 Ga0207695_10452273 3300025913 Bacteria 1167
248 Ga0207663_10044677 3300025916 Bacteria 2721
249 Ga0207660_10382926 3300025917 Bacteria 1131
250 Ga0207660_10811898 3300025917 Bacteria 763
251 Ga0207657_10320614 3300025919 Bacteria 1225
252 Ga0207649_10060704 3300025920 Bacteria 2377
253 Ga0207649_10399087 3300025920 Bacteria 1029
254 Ga0207649_10438824 3300025920 Bacteria 983
255 Ga0207649_10912964 3300025920 Bacteria 689
256 Ga0207649_11684417 3300025920 Bacteria 502
257 Ga0207652_10078909 3300025921 Bacteria 2875
258 Ga0207652_10571862 3300025921 Bacteria 1015
259 Ga0207646_10487489 3300025922 Unclassified 1111
260 Ga0207694_10015549 3300025924 Bacteria 5738
261 Ga0207694_10032730 3300025924 Bacteria 3981
262 Ga0207694_10229360 3300025924 Bacteria 1516
263 Ga0207694_10413925 3300025924 Bacteria 1122
264 Ga0207694_10709879 3300025924 Bacteria 848
265 Ga0207650_10286190 3300025925 Bacteria 1343
266 Ga0207659_10003188 3300025926 Bacteria 9808
267 Ga0207687_10018198 3300025927 Bacteria 4635
268 Ga0207687_10886838 3300025927 Bacteria 763
269 Ga0207687_11194624 3300025927 Bacteria 654
270 Ga0207700_10042289 3300025928 Bacteria 3340
271 Ga0207700_10079558 3300025928 Bacteria 2553
272 Ga0207700_11185544 3300025928 Bacteria 682
273 Ga0207664_10483445 3300025929 Bacteria 1108
274 Ga0207664_10500466 3300025929 Bacteria 1088
275 Ga0207664_10632379 3300025929 Bacteria 961
276 Ga0207690_10508671 3300025932 Bacteria 975
277 Ga0207690_11087068 3300025932 Bacteria 666
278 Ga0207706_10182405 3300025933 Bacteria 1843
279 Ga0207686_10003195 3300025934 Bacteria 8815
280 Ga0207686_10010163 3300025934 Bacteria 5118
281 Ga0207686_11231608 3300025934 Bacteria 613
282 Ga0207709_10189528 3300025935 Bacteria 1460
283 Ga0207709_11135806 3300025935 Bacteria 642
284 Ga0207709_11628778 3300025935 Unclassified 536
285 Ga0207670_10024019 3300025936 Bacteria 3804
286 Ga0207670_10028760 3300025936 Bacteria 3534
287 Ga0207670_10530807 3300025936 Bacteria 959
288 Ga0207670_11171182 3300025936 Unclassified 650
289 Ga0207669_10186526 3300025937 Bacteria 1492
290 Ga0207669_10226505 3300025937 Bacteria 1376
291 Ga0207669_10696970 3300025937 Unclassified 834
292 Ga0207669_11063276 3300025937 Bacteria 682
293 Ga0207691_10020733 3300025940 Bacteria 6215
294 Ga0207711_10117190 3300025941 Bacteria 2375
295 Ga0207711_10935312 3300025941 Bacteria 805
296 Ga0207689_10045312 3300025942 Bacteria 3637
297 Ga0207689_10162289 3300025942 Bacteria 1841
298 Ga0207689_10238436 3300025942 Bacteria 1503
299 Ga0207661_10120813 3300025944 Bacteria 2230
300 Ga0207661_10225096 3300025944 Bacteria 1659
301 Ga0207661_10397086 3300025944 Bacteria 1250
302 Ga0207679_10603596 3300025945 Bacteria 989
303 Ga0207679_10749840 3300025945 Bacteria 888
304 Ga0207679_11162435 3300025945 Bacteria 708
305 Ga0207667_10009600 3300025949 Bacteria 11385
306 Ga0207667_10014289 3300025949 Bacteria 9055
307 Ga0207667_10024816 3300025949 Bacteria 6574
308 Ga0207667_10127861 3300025949 Bacteria 2617
309 Ga0207651_10106346 3300025960 Bacteria 2095
310 Ga0207651_10462429 3300025960 Bacteria 1090
311 Ga0207712_10672232 3300025961 Bacteria 902
312 Ga0207640_10298233 3300025981 Bacteria 1274
313 Ga0207640_10438175 3300025981 Bacteria 1074
314 Ga0207658_11991597 3300025986 Bacteria 529
315 Ga0207677_10056887 3300026023 Bacteria 2682
316 Ga0207677_11116393 3300026023 Bacteria 719
317 Ga0207703_10008079 3300026035 Bacteria 8317
318 Ga0207703_10055900 3300026035 Bacteria 3212
319 Ga0207639_10173989 3300026041 Bacteria 1826
320 Ga0207639_10398980 3300026041 Bacteria 1239
321 Ga0207639_11911981 3300026041 Bacteria 554
322 Ga0207708_10028130 3300026075 Bacteria 4257
323 Ga0207708_10379124 3300026075 Unclassified 1166
324 Ga0207641_10106374 3300026088 Bacteria 2480
325 Ga0207648_10029400 3300026089 Bacteria 4874
326 Ga0207648_10063499 3300026089 Bacteria 3218
327 Ga0207648_11113684 3300026089 Bacteria 741
328 Ga0207648_11383024 3300026089 Unclassified 661
329 Ga0207676_10594886 3300026095 Bacteria 1062
330 Ga0207676_11210119 3300026095 Bacteria 749
331 Ga0207676_11445990 3300026095 Unclassified 684
332 Ga0207674_10080366 3300026116 Bacteria 3264
333 Ga0207674_10829986 3300026116 Bacteria 892
334 Ga0207675_100211020 3300026118 Bacteria 1867
335 Ga0207683_10045919 3300026121 Bacteria 3821
336 Ga0207683_10099405 3300026121 Bacteria 2597
337 Ga0207683_10114694 3300026121 Bacteria 2414
338 Ga0207683_10501345 3300026121 Bacteria 1121
339 Ga0207683_10579065 3300026121 Bacteria 1038
340 Ga0207698_10004235 3300026142 Bacteria 8728
341 Ga0207698_10016864 3300026142 Bacteria 4937
342 Ga0207698_10035681 3300026142 Bacteria 3641
343 Ga0207698_10321674 3300026142 Bacteria 1449
344 Ga0207698_10777221 3300026142 Bacteria 958
345 Ga0207698_11412179 3300026142 Bacteria 711
346 Ga0207428_10004113 3300027907 Bacteria 13942
347 Ga0268266_10260068 3300028379 Bacteria 1608
348 Ga0268266_10508780 3300028379 Bacteria 1150
349 Ga0268266_11064207 3300028379 Bacteria 783
350 Ga0268266_11583273 3300028379 Bacteria 631
351 Ga0268264_10337672 3300028381 Bacteria 1430
352 Ga0265332_10126699 3300031238 Bacteria 1072
353 Ga0265340_10025191 3300031247 Bacteria 3016
354 Ga0265316_10245788 3300031344 Bacteria 1315
355 Ga0307408_101297281 3300031548 Unclassified 682
356 Ga0265314_10171477 3300031711 Bacteria 1309
357 Ga0307405_10391758 3300031731 Bacteria 1085
358 Ga0307410_11182045 3300031852 Bacteria 666
359 Ga0307412_10706569 3300031911 Bacteria 866
360 Ga0307412_12008183 3300031911 Bacteria 535
361 Ga0307409_100673348 3300031995 Bacteria 1031
362 Ga0307416_100078095 3300032002 Bacteria 2784
363 Ga0307416_100457024 3300032002 Bacteria 1331
364 Ga0307416_100653503 3300032002 Bacteria 1136
365 Ga0307416_100852291 3300032002 Bacteria 1009
366 Ga0307411_10505389 3300032005 Bacteria 1023
367 Ga0307415_100558875 3300032126 Bacteria 1011
368 Ga0373929_0004307 3300035085 Bacteria 2555
369 Ga0373939_0420537 3300035114 Bacteria 557
370 Ga0373943_0085611 3300035170 Bacteria 1624
371 Ga0373942_0035099 3300035207 Bacteria 1344
372 Ga0373931_0463211 3300035691 Bacteria 812
373 Ga0395900_0028775 3300037418 Bacteria 5696
374 Ga0395905_0007895 3300037471 Bacteria 10528
375 Ga0395905_0160407 3300037471 Bacteria 2114
376 Ga0395901_0008080 3300038443 Bacteria 10629
377 Ga0436365_1253835 3300039437 Bacteria 1088
378 Ga0436365_1324168 3300039437 Bacteria 1293
379 Ga0439439_0064060 3300041406 Bacteria 979
380 Ga0451849_1393081 3300041505 Bacteria 1925
381 Ga0451853_3282905 3300041512 Bacteria 555
382 Ga0451853_4086467 3300041512 Bacteria 521
383 Ga0439441_098885 3300042001 Bacteria 652
384 Ga0439446_0280964 3300042156 Bacteria 580
385 Ga0439459_0144844 3300042438 Bacteria 617
386 Ga0451577_0107391 3300042876 Bacteria 2495
387 Ga0453683_0582650 3300044673 Bacteria 729
388 Ga0466966_0084561 3300044684 Bacteria 1973
389 Ga0466966_0359257 3300044684 Bacteria 875
390 Ga0453684_1175038 3300044712 Bacteria 807
391 Ga0466957_0091506 3300044842 Bacteria 1907
392 Ga0466959_0221974 3300045049 Bacteria 1310
393 Ga0451576_1616988 3300045051 Bacteria 672
394 Ga0451576_1828224 3300045051 Bacteria 628
395 Ga0466958_0022871 3300045836 Bacteria 3665
396 Ga0495592_0388792 3300046454 Unclassified 886
397 Ga0495603_0642857 3300046455 Bacteria 607
398 Ga0495664_0479288 3300046477 Bacteria 744
399 Ga0495608_0006141 3300046511 Bacteria 8528
400 Ga0495652_0141807 3300046529 Bacteria 1889
401 Ga0495587_0024832 3300046536 Bacteria 3669
402 Ga0495645_0006435 3300046543 Bacteria 8149
403 Ga0495635_0070554 3300046663 Bacteria 2395
404 Ga0495599_0075317 3300046678 Bacteria 2107
405 Ga0495623_0080771 3300046679 Bacteria 2012
406 Ga0495613_0462113 3300046689 Bacteria 859
407 Ga0495680_0275177 3300047322 Bacteria 1188
408 Ga0495675_0344579 3300047444 Bacteria 877
409 Ga0496104_0177962 3300048907 Bacteria 2037
410 Ga0496105_0166595 3300048908 Bacteria 1808
411 Ga0496110_0166162 3300048913 Bacteria 2001
412 Ga0501036_1687782 3300049572 Unclassified 511
413 Ga0501047_0043431 3300049581 Bacteria 4342
414 Ga0501047_0264131 3300049581 Bacteria 1568
415 Ga0501047_1061680 3300049581 Bacteria 623
416 Ga0501067_0097059 3300049583 Bacteria 1637
417 Ga0501069_0000641 3300049585 Bacteria 16214
418 Ga0501070_0001828 3300049586 Bacteria 18750
419 Ga0501072_0305813 3300049588 Unclassified 1264
420 Ga0501073_0036375 3300049589 Bacteria 3498
421 Ga0501074_0001233 3300049590 Bacteria 16873
422 Ga0501079_0003918 3300049741 Bacteria 10996
423 Ga0501080_0056858 3300049742 Bacteria 3642
424 Ga0501080_0091876 3300049742 Bacteria 2819
425 Ga0501080_0094098 3300049742 Bacteria 2783
426 Ga0501083_0016154 3300049744 Bacteria 5227
427 Ga0501035_0219899 3300049822 Bacteria 1622
428 Ga0501035_0451223 3300049822 Bacteria 1064
429 Ga0501044_0014671 3300049823 Bacteria 8448
430 Ga0501044_1035174 3300049823 Bacteria 692
431 nmdc:mga00v17_160138_c1 3300050491 Bacteria 1448
432 nmdc:mga00v17_20862_c1 3300050491 Bacteria 3759
433 nmdc:mga0k408_3673_c1 3300050493 Bacteria 8118
434 nmdc:mga07m45_365464_c1 3300050496 Bacteria 838
435 nmdc:mga05p37_617817_c1 3300050507 Bacteria 1220
436 nmdc:mga0qj67_450828_c1 3300050509 Bacteria 1036
437 nmdc:mga08y16_3558_c1 3300050511 Bacteria 16172
438 nmdc:mga0n895_528195_c1 3300050512 Bacteria 1187
439 nmdc:mga0n895_532805_c1 3300050512 Bacteria 1181
440 nmdc:mga0a205_676337_c1 3300050515 Bacteria 883
441 nmdc:mga0sz30_135589_c1 3300050516 Bacteria 1086
442 Ga0495601_0000996 3300053077 Bacteria 15491
443 Ga0500628_040766 3300053129 Bacteria 1059
444 Ga0501082_0063578 3300060353 Bacteria 3178
445 Ga0070658_10590197
446 Ga0065712_10260558
447 Ga0070658_10016205
448 Ga0070658_10128943
449 Ga0070658_10506066
450 Ga0070658_11690513
451 Ga0070676_10254820
452 Ga0070683_100319735
453 Ga0070683_100438957
454 Ga0070690_100163573
455 Ga0070690_100238817
456 Ga0070670_100400234
457 Ga0070670_101423599
458 Ga0068869_100180710
459 Ga0068869_100246991
460 Ga0068869_100822730
461 Ga0070680_100566468
462 Ga0070680_100571056
463 Ga0070680_100747591
464 Ga0070682_101443898
465 Ga0068868_100022405
466 Ga0068868_100346353
467 Ga0068868_101838338
468 Ga0070660_100421713
469 Ga0070689_100017643
470 Ga0070689_100048979
471 Ga0070689_100243593
472 Ga0070661_100020519
473 Ga0070661_100327318
474 Ga0070661_100491547
475 Ga0070661_100604855
476 Ga0070661_101834355
477 Ga0070692_10025162
478 Ga0070692_10779529
479 Ga0070669_100139657
480 Ga0070675_100016154
481 Ga0070674_100064693
482 Ga0070674_100762015
483 Ga0070674_100877681
484 Ga0070673_100076016
485 Ga0070673_100100163
486 Ga0070688_100045493
487 Ga0070688_100280538
488 Ga0070659_100097156
489 Ga0070659_101002927
490 Ga0070659_101740017
491 Ga0070714_101415984
492 Ga0070714_101419234
493 Ga0070713_100019141
494 Ga0070713_100054819
495 Ga0070710_11026849
496 Ga0070701_10195682
497 Ga0070701_10253350
498 Ga0070701_10455645
499 Ga0070711_100064554
500 Ga0070711_100614820
501 Ga0070705_100162088
502 Ga0070700_101775832
503 Ga0070694_100819737
504 Ga0070678_100098068
505 Ga0070662_100269629
506 Ga0070681_10083907
507 Ga0070681_10119782
508 Ga0070681_11227823
509 Ga0068867_100355894
510 Ga0068867_101476005
511 Ga0070685_10335930
512 Ga0070685_10398054
513 Ga0070685_10510169
514 Ga0070707_100206198
515 Ga0070698_100477014
516 Ga0070679_100134281
517 Ga0070679_100652396
518 Ga0070679_100726425
519 Ga0070684_100052196
520 Ga0070684_100249038
521 Ga0070684_100653144
522 Ga0070697_100590160
523 Ga0070697_101024694
524 Ga0070697_101147977
525 Ga0068853_100036312
526 Ga0068853_100382184
527 Ga0068853_101888653
528 Ga0070672_100108952
529 Ga0070696_100342498
530 Ga0070696_100808798
531 Ga0070693_100003062
532 Ga0070693_100504793
533 Ga0070693_100805734
534 Ga0070693_100938114
535 Ga0070665_100199640
536 Ga0070665_100226269
537 Ga0070665_100605936
538 Ga0070665_100769473
539 Ga0068855_100024330
540 Ga0068855_100035898
541 Ga0068855_100071988
542 Ga0068855_100081936
543 Ga0070664_100680350
544 Ga0068857_100042864
545 Ga0068854_100513601
546 Ga0068854_101751855
547 Ga0068856_100057004
548 Ga0070702_100128607
549 Ga0068852_100016657
550 Ga0068852_100021200
551 Ga0068852_100023897
552 Ga0068852_100068410
553 Ga0068852_100258255
554 Ga0068852_102077899
555 Ga0068859_100120756
556 Ga0068859_100244799
557 Ga0068861_100196116
558 Ga0068851_10003487
559 Ga0068851_10189155
560 Ga0068863_100447224
561 Ga0068858_100000826
562 Ga0068858_101544643
563 Ga0068858_102027659
564 Ga0068860_100309408
565 Ga0081539_10276931
566 Ga0075364_10008810
567 Ga0075367_10552462
568 Ga0075369_10017685
569 Ga0075366_10000594
570 Ga0075366_10041043
571 Ga0097621_100024388
572 Ga0097621_100111846
573 Ga0097621_100476213
574 Ga0097621_101782138
575 Ga0075370_10491779
576 Ga0068871_100046070
577 Ga0068871_100081730
578 Ga0068871_100208523
579 Ga0075428_100004487
580 Ga0075433_10446674
581 Ga0075434_100240803
582 Ga0075434_100287466
583 Ga0097620_100120754
584 Ga0097620_100244784
585 Ga0105240_10050301
586 Ga0105240_10056013
587 Ga0105240_10069974
588 Ga0105240_10085610
589 Ga0105240_10214584
590 Ga0111539_10001137
591 Ga0105245_10055455
592 Ga0105245_10475724
593 Ga0105245_11337491
594 Ga0114129_10605471
595 Ga0105243_10169819
596 Ga0105243_10613412
597 Ga0105243_11117994
598 Ga0105243_11594350
599 Ga0105243_12693410
600 Ga0105241_10102749
601 Ga0105241_10577380
602 Ga0105241_10664841
603 Ga0105242_10010873
604 Ga0105242_10022376
605 Ga0105242_10149773
606 Ga0105242_10490287
607 Ga0105248_10070664
608 Ga0105248_10194079
609 Ga0105248_10265895
610 Ga0105248_10428739
611 Ga0105237_10341149
612 Ga0105237_11038086
613 Ga0105237_11417206
614 Ga0105237_11964116
615 Ga0105238_10034741
616 Ga0105238_10236196
617 Ga0105238_11215077
618 Ga0105238_11661285
619 Ga0105238_12016425
620 Ga0105249_10175646
621 Ga0105239_10545202
622 Ga0157373_10582551
623 Ga0157371_10149515
624 Ga0157370_10038599
625 Ga0157370_10358392
626 Ga0157370_10486845
627 Ga0157369_10009003
628 Ga0157369_10413788
629 Ga0157374_10072329
630 Ga0157374_10383072
631 Ga0157374_10877721
632 Ga0157374_11249107
633 Ga0157378_10205962
634 Ga0157378_10584118
635 Ga0163162_10039559
636 Ga0163162_10159515
637 Ga0163162_10523470
638 Ga0163162_10560355
639 Ga0163162_11308166
640 Ga0157372_10000281
641 Ga0157372_10007839
642 Ga0157372_10325225
643 Ga0157372_11068091
644 Ga0157372_11167392
645 Ga0157375_10087857
646 Ga0157375_10432685
647 Ga0163163_10714236
648 Ga0163163_11896417
649 Ga0157380_10030963
650 Ga0157380_10513727
651 Ga0157380_10675842
652 Ga0157380_10829968
653 Ga0157380_11156332
654 Ga0157380_11679458
655 Ga0157380_11741588
656 Ga0157380_11876007
657 Ga0157380_12761650
658 Ga0157377_10005259
659 Ga0157379_10041517
660 Ga0157379_10061811
661 Ga0157379_10252474
662 Ga0157376_10054518
663 Ga0157376_10089308
664 Ga0157376_10380326
665 Ga0163161_10042407
666 Ga0206356_10736874
667 Ga0206356_11093282
668 Ga0213876_10194666
669 Ga0224712_10314267
670 Ga0224712_10430396
671 Ga0207656_10001103
672 Ga0207656_10128660
673 Ga0207682_10038566
674 Ga0207688_10198962
675 Ga0207685_10076275
676 Ga0207699_10761293
677 Ga0207643_10039579
678 Ga0207705_10008949
679 Ga0207705_10014403
680 Ga0207705_10692041
681 Ga0207705_10757797
682 Ga0207705_10872279
683 Ga0207654_10099677
684 Ga0207654_10455939
685 Ga0207654_10898065
686 Ga0207707_10042702
687 Ga0207707_10107329
688 Ga0207707_10507722
689 Ga0207695_10062176
690 Ga0207695_10074059
691 Ga0207695_10452273
692 Ga0207663_10044677
693 Ga0207660_10382926
694 Ga0207660_10811898
695 Ga0207657_10320614
696 Ga0207649_10060704
697 Ga0207649_10399087
698 Ga0207649_10438824
699 Ga0207649_10912964
700 Ga0207649_11684417
701 Ga0207652_10078909
702 Ga0207652_10571862
703 Ga0207646_10487489
704 Ga0207694_10015549
705 Ga0207694_10032730
706 Ga0207694_10229360
707 Ga0207694_10413925
708 Ga0207694_10709879
709 Ga0207650_10286190
710 Ga0207659_10003188
711 Ga0207687_10018198
712 Ga0207687_10886838
713 Ga0207687_11194624
714 Ga0207700_10042289
715 Ga0207700_10079558
716 Ga0207700_11185544
717 Ga0207664_10483445
718 Ga0207664_10500466
719 Ga0207664_10632379
720 Ga0207690_10508671
721 Ga0207690_11087068
722 Ga0207706_10182405
723 Ga0207686_10003195
724 Ga0207686_10010163
725 Ga0207686_11231608
726 Ga0207709_10189528
727 Ga0207709_11135806
728 Ga0207709_11628778
729 Ga0207670_10024019
730 Ga0207670_10028760
731 Ga0207670_10530807
732 Ga0207670_11171182
733 Ga0207669_10186526
734 Ga0207669_10226505
735 Ga0207669_10696970
736 Ga0207669_11063276
737 Ga0207691_10020733
738 Ga0207711_10117190
739 Ga0207711_10935312
740 Ga0207689_10045312
741 Ga0207689_10162289
742 Ga0207689_10238436
743 Ga0207661_10120813
744 Ga0207661_10225096
745 Ga0207661_10397086
746 Ga0207679_10603596
747 Ga0207679_10749840
748 Ga0207679_11162435
749 Ga0207667_10009600
750 Ga0207667_10014289
751 Ga0207667_10024816
752 Ga0207667_10127861
753 Ga0207651_10106346
754 Ga0207651_10462429
755 Ga0207712_10672232
756 Ga0207640_10298233
757 Ga0207640_10438175
758 Ga0207658_11991597
759 Ga0207677_10056887
760 Ga0207677_11116393
761 Ga0207703_10008079
762 Ga0207703_10055900
763 Ga0207639_10173989
764 Ga0207639_10398980
765 Ga0207639_11911981
766 Ga0207708_10028130
767 Ga0207708_10379124
768 Ga0207641_10106374
769 Ga0207648_10029400
770 Ga0207648_10063499
771 Ga0207648_11113684
772 Ga0207648_11383024
773 Ga0207676_10594886
774 Ga0207676_11210119
775 Ga0207676_11445990
776 Ga0207674_10080366
777 Ga0207674_10829986
778 Ga0207675_100211020
779 Ga0207683_10045919
780 Ga0207683_10099405
781 Ga0207683_10114694
782 Ga0207683_10501345
783 Ga0207683_10579065
784 Ga0207698_10004235
785 Ga0207698_10016864
786 Ga0207698_10035681
787 Ga0207698_10321674
788 Ga0207698_10777221
789 Ga0207698_11412179
790 Ga0207428_10004113
791 Ga0268266_10260068
792 Ga0268266_10508780
793 Ga0268266_11064207
794 Ga0268266_11583273
795 Ga0268264_10337672
796 Ga0265332_10126699
797 Ga0265340_10025191
798 Ga0265316_10245788
799 Ga0307408_101297281
800 Ga0265314_10171477
801 Ga0307405_10391758
802 Ga0307410_11182045
803 Ga0307412_10706569
804 Ga0307412_12008183
805 Ga0307409_100673348
806 Ga0307416_100078095
807 Ga0307416_100457024
808 Ga0307416_100653503
809 Ga0307416_100852291
810 Ga0307411_10505389
811 Ga0307415_100558875
812 Ga0373929_0004307
813 Ga0373939_0420537
814 Ga0373943_0085611
815 Ga0373942_0035099
816 Ga0373931_0463211
817 Ga0395900_0028775
818 Ga0395905_0007895
819 Ga0395905_0160407
820 Ga0395901_0008080
821 Ga0436365_1253835
822 Ga0436365_1324168
823 Ga0439439_0064060
824 Ga0451849_1393081
825 Ga0451853_3282905
826 Ga0451853_4086467
827 Ga0439441_098885
828 Ga0439446_0280964
829 Ga0439459_0144844
830 Ga0451577_0107391
831 Ga0453683_0582650
832 Ga0466966_0084561
833 Ga0466966_0359257
834 Ga0453684_1175038
835 Ga0466957_0091506
836 Ga0466959_0221974
837 Ga0451576_1616988
838 Ga0451576_1828224
839 Ga0466958_0022871
840 Ga0495592_0388792
841 Ga0495603_0642857
842 Ga0495664_0479288
843 Ga0495608_0006141
844 Ga0495652_0141807
845 Ga0495587_0024832
846 Ga0495645_0006435
847 Ga0495635_0070554
848 Ga0495599_0075317
849 Ga0495623_0080771
850 Ga0495613_0462113
851 Ga0495680_0275177
852 Ga0495675_0344579
853 Ga0496104_0177962
854 Ga0496105_0166595
855 Ga0496110_0166162
856 Ga0501036_1687782
857 Ga0501047_0043431
858 Ga0501047_0264131
859 Ga0501047_1061680
860 Ga0501067_0097059
861 Ga0501069_0000641
862 Ga0501070_0001828
863 Ga0501072_0305813
864 Ga0501073_0036375
865 Ga0501074_0001233
866 Ga0501079_0003918
867 Ga0501080_0056858
868 Ga0501080_0091876
869 Ga0501080_0094098
870 Ga0501083_0016154
871 Ga0501035_0219899
872 Ga0501035_0451223
873 Ga0501044_0014671
874 Ga0501044_1035174
875 nmdc:mga00v17_160138_c1
876 nmdc:mga00v17_20862_c1
877 nmdc:mga0k408_3673_c1
878 nmdc:mga07m45_365464_c1
879 nmdc:mga05p37_617817_c1
880 nmdc:mga0qj67_450828_c1
881 nmdc:mga08y16_3558_c1
882 nmdc:mga0n895_528195_c1
883 nmdc:mga0n895_532805_c1
884 nmdc:mga0a205_676337_c1
885 nmdc:mga0sz30_135589_c1
886 Ga0495601_0000996
887 Ga0500628_040766
888 Ga0501082_0063578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12279

DUF3619

Protein of unknown function (DUF3619)

2

122

0.86

Map