F445192

General Info

Members Datasets Scaffolds Average Seq Length
443 199 886 334

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2896429255|2896431190
Length 347
Sequence QIGRGKLPPGELMQAAIYGLAGFEMTADEVAFFRDAKPAGYILFRRNCETRDQMRRLTDSLRELEGDDNVAILIDQEGGRVARMRPPEWPAFPSGETFDRLYQLAPSSAIEAARVNARALGLMLDEVGVTVDCLPMLDVRQPGATDIVGDRAMGSNPMQVSALGRAVLDGLASAGVVGVIKHIPGHGRALVDSHHELPVVNEGEDDLAQDLEPFERLRDAVMGMTSHLLYTQWDPERPASQSPIIIHDIIRQRIGFDGFLMSDDIGMEALYGDHGQRAAACVAAGCDVALHCDGKMENMLLVANAVPALSDEGSARLARAMATRFAPADDINFAEAITKRDTLLALA

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
147 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
192 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
194 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
195 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
196 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
197 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
198 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
199 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0.68
Isolates 1.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.58
Nodule 0
Rhizoplane 2.48
Rhizosphere 93.68
Stem 0
Stem Tuber 0.23
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10038983 3300001989 Bacteria 1594
2 JGI24744J21845_10005883 3300002077 Bacteria 2543
3 Ga0055536_1018834 3300003781 Bacteria 2195
4 Ga0070658_10000040 3300005327 Bacteria 136073
5 Ga0070658_10270181 3300005327 Bacteria 1446
6 Ga0070676_10025024 3300005328 Bacteria 3370
7 Ga0070676_10149156 3300005328 Bacteria 1495
8 Ga0070676_10221532 3300005328 Bacteria 1250
9 Ga0070683_100009328 3300005329 Bacteria 8386
10 Ga0070690_100017269 3300005330 Bacteria 4336
11 Ga0070670_100004265 3300005331 Bacteria 11961
12 Ga0070670_100097848 3300005331 Bacteria 2524
13 Ga0070670_100171663 3300005331 Bacteria 1881
14 Ga0070666_10032841 3300005335 Bacteria 3430
15 Ga0070680_100000081 3300005336 Bacteria 52556
16 Ga0068868_100011717 3300005338 Bacteria 6389
17 Ga0068868_100036326 3300005338 Bacteria 3813
18 Ga0068868_100064023 3300005338 Bacteria 2918
19 Ga0070660_100002939 3300005339 Bacteria 11722
20 Ga0070660_100006378 3300005339 Bacteria 8176
21 Ga0070660_100011191 3300005339 Bacteria 6367
22 Ga0070687_100086237 3300005343 Bacteria 1725
23 Ga0070661_100000263 3300005344 Bacteria 43084
24 Ga0070661_100031813 3300005344 Bacteria 3816
25 Ga0070661_100066495 3300005344 Bacteria 2648
26 Ga0070668_100058442 3300005347 Bacteria 2983
27 Ga0070668_100324755 3300005347 Bacteria 1296
28 Ga0070669_100003050 3300005353 Bacteria 12050
29 Ga0070669_100013019 3300005353 Bacteria 5908
30 Ga0070669_100024623 3300005353 Bacteria 4317
31 Ga0070669_100132788 3300005353 Bacteria 1912
32 Ga0070675_100002191 3300005354 Bacteria 14471
33 Ga0070675_100156927 3300005354 Bacteria 1954
34 Ga0070671_100061939 3300005355 Bacteria 3115
35 Ga0070671_100138347 3300005355 Bacteria 2054
36 Ga0070671_100144158 3300005355 Bacteria 2010
37 Ga0070674_100010637 3300005356 Bacteria 5573
38 Ga0070674_100065175 3300005356 Bacteria 2556
39 Ga0070674_100102391 3300005356 Bacteria 2088
40 Ga0070674_100107712 3300005356 Bacteria 2041
41 Ga0070673_100089281 3300005364 Bacteria 2516
42 Ga0070659_100002158 3300005366 Bacteria 14023
43 Ga0070659_100015516 3300005366 Bacteria 5707
44 Ga0070659_100326245 3300005366 Bacteria 1284
45 Ga0070667_100004095 3300005367 Bacteria 12337
46 Ga0070667_100087740 3300005367 Bacteria 2670
47 Ga0070714_100042814 3300005435 Bacteria 3827
48 Ga0070678_100086693 3300005456 Bacteria 2389
49 Ga0070678_100129640 3300005456 Bacteria 2002
50 Ga0070662_100054996 3300005457 Bacteria 2886
51 Ga0070662_100057801 3300005457 Bacteria 2820
52 Ga0070662_100070198 3300005457 Bacteria 2581
53 Ga0070681_10049686 3300005458 Bacteria 4188
54 Ga0068867_100040670 3300005459 Bacteria 3395
55 Ga0068867_100238560 3300005459 Bacteria 1473
56 Ga0070679_100000031 3300005530 Bacteria 107526
57 Ga0070684_100007300 3300005535 Bacteria 8592
58 Ga0068853_100068021 3300005539 Bacteria 3096
59 Ga0068853_100129356 3300005539 Bacteria 2259
60 Ga0068853_100173587 3300005539 Bacteria 1951
61 Ga0070672_100085004 3300005543 Bacteria 2542
62 Ga0070672_100085284 3300005543 Bacteria 2538
63 Ga0070696_100255673 3300005546 Bacteria 1326
64 Ga0070665_100021747 3300005548 Bacteria 6449
65 Ga0070665_100040082 3300005548 Bacteria 4708
66 Ga0070664_100024270 3300005564 Bacteria 5014
67 Ga0070664_100039590 3300005564 Bacteria 3972
68 Ga0068854_100094050 3300005578 Bacteria 2235
69 Ga0068852_100017325 3300005616 Bacteria 5649
70 Ga0068852_100070168 3300005616 Bacteria 3073
71 Ga0068852_100077081 3300005616 Bacteria 2945
72 Ga0068859_100023024 3300005617 Bacteria 6247
73 Ga0068859_100319784 3300005617 Bacteria 1646
74 Ga0068864_100031886 3300005618 Bacteria 4473
75 Ga0068864_100037666 3300005618 Bacteria 4129
76 Ga0068864_100053940 3300005618 Bacteria 3469
77 Ga0068864_100316418 3300005618 Bacteria 1465
78 Ga0068864_100505533 3300005618 Bacteria 1163
79 Ga0068861_100054368 3300005719 Bacteria 3050
80 Ga0068851_10070799 3300005834 Bacteria 1804
81 Ga0068870_10157984 3300005840 Bacteria 1342
82 Ga0068863_100112792 3300005841 Bacteria 2589
83 Ga0068858_100045258 3300005842 Bacteria 4077
84 Ga0068858_100062511 3300005842 Bacteria 3443
85 Ga0068860_100113590 3300005843 Bacteria 2590
86 Ga0068862_100179063 3300005844 Bacteria 1902
87 Ga0081539_10040978 3300005985 Bacteria 2713
88 Ga0075431_100008702 3300006847 Bacteria 10169
89 Ga0068865_100002706 3300006881 Bacteria 10514
90 Ga0097620_100023024 3300006931 Bacteria 6247
91 Ga0097620_100319742 3300006931 Bacteria 1646
92 Ga0111539_10047867 3300009094 Bacteria 5109
93 Ga0111539_10490069 3300009094 Bacteria 1432
94 Ga0105245_10093806 3300009098 Bacteria 2766
95 Ga0105245_10226966 3300009098 Bacteria 1804
96 Ga0105245_10313448 3300009098 Bacteria 1543
97 Ga0105243_10040963 3300009148 Bacteria 3621
98 Ga0105242_10572272 3300009176 Bacteria 1086
99 Ga0105248_10343496 3300009177 Bacteria 1680
100 Ga0105238_10289105 3300009551 Bacteria 1621
101 Ga0105249_10158708 3300009553 Bacteria 2184
102 Ga0105246_10213175 3300011119 Bacteria 1509
103 Ga0157370_10340102 3300013104 Bacteria 1383
104 Ga0157369_10054517 3300013105 Bacteria 4317
105 Ga0157369_10191081 3300013105 Bacteria 2152
106 Ga0157374_10093325 3300013296 Bacteria 2874
107 Ga0157374_10516958 3300013296 Bacteria 1199
108 Ga0157378_10015380 3300013297 Bacteria 6701
109 Ga0163162_10131583 3300013306 Bacteria 2610
110 Ga0157372_10197829 3300013307 Bacteria 2328
111 Ga0157375_10034266 3300013308 Bacteria 4836
112 Ga0157375_10183387 3300013308 Bacteria 2245
113 Ga0163163_10045869 3300014325 Bacteria 4291
114 Ga0163163_10305654 3300014325 Bacteria 1643
115 Ga0157380_10001468 3300014326 Bacteria 15436
116 Ga0157380_10002105 3300014326 Bacteria 13348
117 Ga0157380_10015053 3300014326 Bacteria 5675
118 Ga0157379_10043381 3300014968 Bacteria 4015
119 Ga0157376_10005211 3300014969 Bacteria 9071
120 Ga0206354_11538386 3300020081 Bacteria 2148
121 Ga0206353_10836210 3300020082 Bacteria 9806
122 Ga0206353_11032406 3300020082 Bacteria 1292
123 Ga0213873_10000039 3300021358 Bacteria 32971
124 Ga0213876_10000455 3300021384 Bacteria 32971
125 Ga0213875_10002606 3300021388 Bacteria 10707
126 Ga0209676_1029940 3300025292 Bacteria 1673
127 Ga0209257_1007643 3300025304 Bacteria 6474
128 Ga0207697_10019160 3300025315 Bacteria 2803
129 Ga0207656_10082296 3300025321 Bacteria 1448
130 Ga0207682_10005329 3300025893 Bacteria 5251
131 Ga0207688_10083054 3300025901 Bacteria 1831
132 Ga0207688_10149524 3300025901 Bacteria 1379
133 Ga0207680_10000962 3300025903 Bacteria 13592
134 Ga0207680_10013216 3300025903 Bacteria 4233
135 Ga0207680_10107088 3300025903 Bacteria 1806
136 Ga0207647_10046111 3300025904 Bacteria 2717
137 Ga0207645_10044675 3300025907 Bacteria 2835
138 Ga0207643_10067648 3300025908 Bacteria 2051
139 Ga0207705_10000002 3300025909 Bacteria 2046852
140 Ga0207705_10011251 3300025909 Bacteria 6486
141 Ga0207705_10066815 3300025909 Bacteria 2601
142 Ga0207705_10067719 3300025909 Bacteria 2584
143 Ga0207707_10253294 3300025912 Bacteria 1529
144 Ga0207660_10000342 3300025917 Bacteria 30128
145 Ga0207662_10105271 3300025918 Bacteria 1753
146 Ga0207657_10002098 3300025919 Bacteria 21566
147 Ga0207657_10007043 3300025919 Bacteria 11565
148 Ga0207657_10013042 3300025919 Bacteria 8167
149 Ga0207657_10025201 3300025919 Bacteria 5489
150 Ga0207657_10028000 3300025919 Bacteria 5150
151 Ga0207657_10075479 3300025919 Bacteria 2845
152 Ga0207649_10000323 3300025920 Bacteria 36350
153 Ga0207649_10069289 3300025920 Bacteria 2246
154 Ga0207649_10085685 3300025920 Bacteria 2051
155 Ga0207652_10000003 3300025921 Bacteria 502441
156 Ga0207681_10042851 3300025923 Bacteria 3026
157 Ga0207650_10031068 3300025925 Bacteria 3854
158 Ga0207650_10042166 3300025925 Bacteria 3347
159 Ga0207650_10136767 3300025925 Bacteria 1923
160 Ga0207650_10148609 3300025925 Bacteria 1847
161 Ga0207659_10040194 3300025926 Bacteria 3268
162 Ga0207659_10040277 3300025926 Bacteria 3266
163 Ga0207659_10051765 3300025926 Bacteria 2922
164 Ga0207687_10108181 3300025927 Bacteria 2058
165 Ga0207687_10138564 3300025927 Bacteria 1843
166 Ga0207687_10241459 3300025927 Bacteria 1432
167 Ga0207664_10028887 3300025929 Bacteria 4219
168 Ga0207644_10107923 3300025931 Bacteria 2101
169 Ga0207644_10196111 3300025931 Bacteria 1590
170 Ga0207690_10002917 3300025932 Bacteria 10303
171 Ga0207690_10004636 3300025932 Bacteria 8128
172 Ga0207690_10040840 3300025932 Bacteria 3036
173 Ga0207706_10000837 3300025933 Bacteria 31802
174 Ga0207706_10013529 3300025933 Bacteria 7416
175 Ga0207706_10014742 3300025933 Bacteria 7078
176 Ga0207706_10028411 3300025933 Bacteria 4995
177 Ga0207706_10090124 3300025933 Bacteria 2696
178 Ga0207706_10143546 3300025933 Bacteria 2100
179 Ga0207709_10049144 3300025935 Bacteria 2573
180 Ga0207669_10089165 3300025937 Bacteria 2002
181 Ga0207691_10005409 3300025940 Bacteria 12321
182 Ga0207691_10017231 3300025940 Bacteria 6854
183 Ga0207691_10035988 3300025940 Bacteria 4589
184 Ga0207711_10005386 3300025941 Bacteria 10826
185 Ga0207689_10006231 3300025942 Bacteria 10565
186 Ga0207661_10034241 3300025944 Bacteria 3948
187 Ga0207679_10100314 3300025945 Bacteria 2262
188 Ga0207679_10209828 3300025945 Bacteria 1632
189 Ga0207679_10311774 3300025945 Bacteria 1360
190 Ga0207651_10009716 3300025960 Bacteria 5288
191 Ga0207651_10020653 3300025960 Bacteria 3981
192 Ga0207712_10121145 3300025961 Bacteria 1979
193 Ga0207668_10001028 3300025972 Bacteria 16664
194 Ga0207668_10081319 3300025972 Bacteria 2350
195 Ga0207668_10098111 3300025972 Bacteria 2170
196 Ga0207668_10121566 3300025972 Bacteria 1978
197 Ga0207640_10181578 3300025981 Bacteria 1578
198 Ga0207658_10056264 3300025986 Bacteria 2918
199 Ga0207658_10082792 3300025986 Bacteria 2465
200 Ga0207677_10001998 3300026023 Bacteria 10764
201 Ga0207677_10014578 3300026023 Bacteria 4596
202 Ga0207703_10144733 3300026035 Bacteria 2066
203 Ga0207703_10267633 3300026035 Bacteria 1547
204 Ga0207639_10036524 3300026041 Bacteria 3641
205 Ga0207639_10188970 3300026041 Bacteria 1758
206 Ga0207639_10258816 3300026041 Bacteria 1521
207 Ga0207678_10004144 3300026067 Bacteria 13030
208 Ga0207678_10010676 3300026067 Bacteria 8067
209 Ga0207678_10088184 3300026067 Bacteria 2652
210 Ga0207678_10126776 3300026067 Bacteria 2177
211 Ga0207678_10239940 3300026067 Bacteria 1552
212 Ga0207641_10109105 3300026088 Bacteria 2451
213 Ga0207648_10009361 3300026089 Bacteria 9386
214 Ga0207648_10011784 3300026089 Bacteria 8217
215 Ga0207648_10055066 3300026089 Bacteria 3472
216 Ga0207676_10034327 3300026095 Bacteria 3840
217 Ga0207676_10066706 3300026095 Bacteria 2872
218 Ga0207674_10024437 3300026116 Bacteria 6458
219 Ga0207674_10098174 3300026116 Bacteria 2913
220 Ga0207674_10141810 3300026116 Bacteria 2362
221 Ga0207675_100011589 3300026118 Bacteria 8245
222 Ga0207675_100162035 3300026118 Bacteria 2134
223 Ga0207683_10005277 3300026121 Bacteria 11090
224 Ga0207683_10037719 3300026121 Bacteria 4209
225 Ga0207683_10065008 3300026121 Bacteria 3215
226 Ga0207683_10341445 3300026121 Bacteria 1373
227 Ga0207683_10367744 3300026121 Bacteria 1321
228 Ga0207698_10015822 3300026142 Bacteria 5067
229 Ga0207698_10445917 3300026142 Bacteria 1248
230 Ga0209971_1030221 3300027682 Bacteria 1297
231 Ga0209974_10002470 3300027876 Bacteria 6692
232 Ga0209974_10014464 3300027876 Bacteria 2626
233 Ga0209974_10028274 3300027876 Bacteria 1856
234 Ga0268266_10007358 3300028379 Bacteria 9945
235 Ga0268266_10169452 3300028379 Bacteria 1981
236 Ga0268265_10085113 3300028380 Bacteria 2508
237 Ga0268265_10276534 3300028380 Bacteria 1500
238 Ga0316177_1111890 3300030731 Bacteria 2234
239 Ga0307408_100008664 3300031548 Bacteria 6718
240 Ga0307408_100011392 3300031548 Bacteria 5876
241 Ga0307408_100014285 3300031548 Bacteria 5275
242 Ga0307408_100029820 3300031548 Bacteria 3783
243 Ga0307408_100061269 3300031548 Bacteria 2746
244 Ga0307408_100168065 3300031548 Bacteria 1749
245 Ga0307405_10015694 3300031731 Bacteria 4109
246 Ga0307405_10015930 3300031731 Bacteria 4085
247 Ga0307405_10046236 3300031731 Bacteria 2673
248 Ga0307405_10067693 3300031731 Bacteria 2282
249 Ga0307405_10165279 3300031731 Bacteria 1572
250 Ga0307405_10269939 3300031731 Bacteria 1275
251 Ga0307405_10375762 3300031731 Bacteria 1105
252 Ga0307413_10000908 3300031824 Bacteria 10480
253 Ga0307413_10002342 3300031824 Bacteria 7691
254 Ga0307413_10003272 3300031824 Bacteria 6791
255 Ga0307413_10048649 3300031824 Bacteria 2536
256 Ga0307413_10049769 3300031824 Bacteria 2513
257 Ga0307413_10052142 3300031824 Bacteria 2469
258 Ga0307413_10054333 3300031824 Bacteria 2429
259 Ga0307413_10058606 3300031824 Bacteria 2361
260 Ga0307413_10065253 3300031824 Bacteria 2266
261 Ga0307413_10123146 3300031824 Bacteria 1760
262 Ga0307413_10157291 3300031824 Bacteria 1592
263 Ga0307413_10171794 3300031824 Bacteria 1535
264 Ga0307413_10214839 3300031824 Bacteria 1400
265 Ga0307410_10001686 3300031852 Bacteria 10160
266 Ga0307410_10004997 3300031852 Bacteria 6957
267 Ga0307410_10006030 3300031852 Bacteria 6496
268 Ga0307410_10006358 3300031852 Bacteria 6370
269 Ga0307410_10011831 3300031852 Bacteria 5012
270 Ga0307410_10017127 3300031852 Bacteria 4341
271 Ga0307410_10024791 3300031852 Bacteria 3753
272 Ga0307410_10026935 3300031852 Bacteria 3626
273 Ga0307410_10033574 3300031852 Bacteria 3314
274 Ga0307410_10055992 3300031852 Bacteria 2679
275 Ga0307410_10126841 3300031852 Bacteria 1869
276 Ga0307406_10006291 3300031901 Bacteria 6544
277 Ga0307406_10019319 3300031901 Bacteria 3997
278 Ga0307406_10024146 3300031901 Bacteria 3627
279 Ga0307406_10039880 3300031901 Bacteria 2916
280 Ga0307406_10068569 3300031901 Bacteria 2316
281 Ga0307406_10090571 3300031901 Bacteria 2058
282 Ga0307406_10150250 3300031901 Bacteria 1660
283 Ga0307406_10299643 3300031901 Bacteria 1235
284 Ga0307406_10301887 3300031901 Bacteria 1231
285 Ga0307407_10003218 3300031903 Bacteria 6632
286 Ga0307407_10009127 3300031903 Bacteria 4601
287 Ga0307407_10014378 3300031903 Bacteria 3874
288 Ga0307407_10040515 3300031903 Bacteria 2598
289 Ga0307407_10072931 3300031903 Bacteria 2049
290 Ga0307407_10242856 3300031903 Bacteria 1229
291 Ga0307412_10009604 3300031911 Bacteria 5556
292 Ga0307412_10015291 3300031911 Bacteria 4545
293 Ga0307412_10034739 3300031911 Bacteria 3215
294 Ga0307412_10035446 3300031911 Bacteria 3188
295 Ga0307412_10043226 3300031911 Bacteria 2933
296 Ga0307412_10069911 3300031911 Bacteria 2391
297 Ga0307409_100002023 3300031995 Bacteria 10410
298 Ga0307409_100016422 3300031995 Bacteria 4897
299 Ga0307409_100018940 3300031995 Bacteria 4646
300 Ga0307409_100084765 3300031995 Bacteria 2574
301 Ga0307409_100089006 3300031995 Bacteria 2522
302 Ga0307409_100091091 3300031995 Bacteria 2498
303 Ga0307409_100122472 3300031995 Bacteria 2205
304 Ga0307409_100145963 3300031995 Bacteria 2046
305 Ga0307409_100222341 3300031995 Bacteria 1705
306 Ga0307409_100226734 3300031995 Bacteria 1690
307 Ga0307409_100310688 3300031995 Bacteria 1471
308 Ga0307409_100330563 3300031995 Bacteria 1430
309 Ga0307409_100629296 3300031995 Bacteria 1064
310 Ga0307416_100005183 3300032002 Bacteria 7966
311 Ga0307416_100009830 3300032002 Bacteria 6288
312 Ga0307416_100020692 3300032002 Bacteria 4702
313 Ga0307416_100028987 3300032002 Bacteria 4127
314 Ga0307416_100090157 3300032002 Bacteria 2628
315 Ga0307416_100309383 3300032002 Bacteria 1575
316 Ga0307416_100312787 3300032002 Bacteria 1568
317 Ga0307416_100333790 3300032002 Bacteria 1525
318 Ga0307416_100475526 3300032002 Bacteria 1308
319 Ga0307416_100534382 3300032002 Bacteria 1243
320 Ga0307414_10000442 3300032004 Bacteria 21979
321 Ga0307414_10001091 3300032004 Bacteria 13857
322 Ga0307414_10005621 3300032004 Bacteria 6916
323 Ga0307414_10012437 3300032004 Bacteria 5031
324 Ga0307414_10012808 3300032004 Bacteria 4975
325 Ga0307414_10030433 3300032004 Bacteria 3526
326 Ga0307414_10037692 3300032004 Bacteria 3240
327 Ga0307414_10045405 3300032004 Bacteria 3008
328 Ga0307414_10059259 3300032004 Bacteria 2702
329 Ga0307414_10063291 3300032004 Bacteria 2628
330 Ga0307414_10090408 3300032004 Bacteria 2272
331 Ga0307414_10103287 3300032004 Bacteria 2150
332 Ga0307414_10114921 3300032004 Bacteria 2057
333 Ga0307414_10117866 3300032004 Bacteria 2035
334 Ga0307414_10144970 3300032004 Bacteria 1864
335 Ga0307414_10218683 3300032004 Bacteria 1562
336 Ga0307414_10338782 3300032004 Bacteria 1286
337 Ga0307411_10000431 3300032005 Bacteria 14289
338 Ga0307411_10001268 3300032005 Bacteria 10104
339 Ga0307411_10001563 3300032005 Bacteria 9479
340 Ga0307411_10011607 3300032005 Bacteria 4765
341 Ga0307411_10020983 3300032005 Bacteria 3811
342 Ga0307411_10021974 3300032005 Bacteria 3746
343 Ga0307411_10023032 3300032005 Bacteria 3680
344 Ga0307411_10029986 3300032005 Bacteria 3329
345 Ga0307411_10051035 3300032005 Bacteria 2697
346 Ga0307411_10104400 3300032005 Bacteria 2012
347 Ga0307411_10111191 3300032005 Bacteria 1961
348 Ga0307411_10151384 3300032005 Bacteria 1724
349 Ga0307411_10196131 3300032005 Bacteria 1546
350 Ga0307411_10202582 3300032005 Bacteria 1525
351 Ga0307411_10232097 3300032005 Bacteria 1439
352 Ga0307415_100021276 3300032126 Bacteria 3983
353 Ga0307415_100022002 3300032126 Bacteria 3929
354 Ga0307415_100029290 3300032126 Bacteria 3516
355 Ga0307415_100031890 3300032126 Bacteria 3401
356 Ga0307415_100046860 3300032126 Bacteria 2906
357 Ga0307415_100099776 3300032126 Bacteria 2126
358 Ga0307415_100103649 3300032126 Bacteria 2093
359 Ga0395900_0001642 3300037418 Bacteria 26249
360 Ga0395900_0026272 3300037418 Bacteria 5963
361 Ga0395900_0027634 3300037418 Bacteria 5811
362 Ga0395900_0031705 3300037418 Bacteria 5432
363 Ga0395900_0215191 3300037418 Bacteria 1939
364 Ga0395900_0288508 3300037418 Bacteria 1630
365 Ga0395898_0025459 3300037466 Bacteria 5961
366 Ga0395898_0037912 3300037466 Bacteria 4778
367 Ga0395898_0140050 3300037466 Bacteria 2316
368 Ga0395898_0145903 3300037466 Bacteria 2265
369 Ga0395905_0001305 3300037471 Bacteria 30608
370 Ga0395905_0018156 3300037471 Bacteria 6675
371 Ga0395905_0047272 3300037471 Bacteria 4034
372 Ga0395905_0091201 3300037471 Bacteria 2857
373 Ga0395905_0692499 3300037471 Bacteria 921
374 Ga0436364_0500114 3300037853 Bacteria 1867
375 Ga0436364_1406360 3300037853 Bacteria 26034
376 Ga0395901_0032667 3300038443 Bacteria 5368
377 Ga0395901_0095530 3300038443 Bacteria 3115
378 Ga0395901_0097827 3300038443 Bacteria 3077
379 Ga0395901_0131701 3300038443 Bacteria 2628
380 Ga0436365_0238180 3300039437 Bacteria 15635
381 Ga0436365_1685576 3300039437 Bacteria 49468
382 Ga0436362_0182183 3300039453 Bacteria 12082
383 Ga0439445_0000304 3300042004 Bacteria 9554
384 Ga0439432_040100 3300042006 Bacteria 1486
385 Ga0466969_0036039 3300044656 Bacteria 2501
386 Ga0466966_0006017 3300044684 Bacteria 8008
387 Ga0466966_0146693 3300044684 Bacteria 1440
388 Ga0466961_0012985 3300044693 Bacteria 5328
389 Ga0466963_0012419 3300044694 Bacteria 5214
390 Ga0466963_0085167 3300044694 Bacteria 2145
391 Ga0466963_0167325 3300044694 Bacteria 1532
392 Ga0466964_0068684 3300044706 Bacteria 1493
393 Ga0466971_0024645 3300044719 Bacteria 2684
394 Ga0466970_0011954 3300044765 Bacteria 4431
395 Ga0466957_0097876 3300044842 Bacteria 1845
396 Ga0466959_0011663 3300045049 Bacteria 6320
397 Ga0466959_0019787 3300045049 Bacteria 4953
398 Ga0466958_0002413 3300045836 Bacteria 9361
399 Ga0466967_0095450 3300045976 Bacteria 2710
400 Ga0466967_0170541 3300045976 Bacteria 2047
401 Ga0495663_0005994 3300046525 Bacteria 3364
402 Ga0495663_0019232 3300046525 Bacteria 1953
403 Ga0495654_0058118 3300046530 Bacteria 1867
404 Ga0495598_0032651 3300046537 Bacteria 1472
405 Ga0495621_0000457 3300046539 Bacteria 10002
406 Ga0495633_0079751 3300046558 Bacteria 1524
407 Ga0495668_0000001 3300046616 Bacteria 1013420
408 Ga0495669_0043008 3300046684 Bacteria 2010
409 Ga0496100_0037569 3300048903 Bacteria 3062
410 Ga0496102_0051860 3300048905 Bacteria 3737
411 Ga0496102_0147232 3300048905 Bacteria 2211
412 Ga0496105_0060702 3300048908 Bacteria 3120
413 Ga0496107_0000263 3300048910 Bacteria 27781
414 Ga0496108_0001688 3300048911 Bacteria 17510
415 Ga0496109_0105796 3300048912 Bacteria 2613
416 Ga0496110_0242321 3300048913 Bacteria 1640
417 Ga0496111_0025156 3300048914 Bacteria 4198
418 Ga0496113_0040760 3300048916 Bacteria 3423
419 Ga0496114_0000033 3300048917 Bacteria 166897
420 Ga0501032_0063152 3300049569 Bacteria 2479
421 Ga0501033_0011198 3300049570 Bacteria 6870
422 Ga0501036_0042053 3300049572 Bacteria 3868
423 Ga0501037_0088027 3300049573 Bacteria 2247
424 Ga0501038_0031513 3300049574 Bacteria 4685
425 Ga0501039_0017451 3300049575 Bacteria 5506
426 Ga0501046_0016964 3300049580 Bacteria 6091
427 Ga0501047_0034379 3300049581 Bacteria 4893
428 Ga0501209_032128 3300049656 Bacteria 1338
429 Ga0501035_0042238 3300049822 Bacteria 4113
430 Ga0501044_0056725 3300049823 Bacteria 4021
431 nmdc:mga06r32_3622_c1 3300050510 Bacteria 13786
432 nmdc:mga08y16_217262_c1 3300050511 Bacteria 1979
433 Ga0500592_001181 3300053116 Bacteria 4252
434 Ga0500568_0001107 3300053139 Bacteria 18110
435 Ga0500604_0043555 3300053151 Bacteria 1364
436 Ga0500627_0000005 3300053158 Bacteria 167950
437 Ga0466962_0002625 3300061719 Bacteria 8546
438 2896431190 2896429255 Bacteria 2557483
439 2643821718 2643221560 Bacteria 4801179
440 2643835862 2643221563 Bacteria 4726935
441 2644056787 2643221608 Bacteria 4724829
442 2852681367 2852680915 Bacteria 4100189
443 2885427506 2885427238 Bacteria 2291351
444 JGI24739J22299_10038983
445 JGI24744J21845_10005883
446 Ga0055536_1018834
447 Ga0070658_10000040
448 Ga0070658_10270181
449 Ga0070676_10025024
450 Ga0070676_10149156
451 Ga0070676_10221532
452 Ga0070683_100009328
453 Ga0070690_100017269
454 Ga0070670_100004265
455 Ga0070670_100097848
456 Ga0070670_100171663
457 Ga0070666_10032841
458 Ga0070680_100000081
459 Ga0068868_100011717
460 Ga0068868_100036326
461 Ga0068868_100064023
462 Ga0070660_100002939
463 Ga0070660_100006378
464 Ga0070660_100011191
465 Ga0070687_100086237
466 Ga0070661_100000263
467 Ga0070661_100031813
468 Ga0070661_100066495
469 Ga0070668_100058442
470 Ga0070668_100324755
471 Ga0070669_100003050
472 Ga0070669_100013019
473 Ga0070669_100024623
474 Ga0070669_100132788
475 Ga0070675_100002191
476 Ga0070675_100156927
477 Ga0070671_100061939
478 Ga0070671_100138347
479 Ga0070671_100144158
480 Ga0070674_100010637
481 Ga0070674_100065175
482 Ga0070674_100102391
483 Ga0070674_100107712
484 Ga0070673_100089281
485 Ga0070659_100002158
486 Ga0070659_100015516
487 Ga0070659_100326245
488 Ga0070667_100004095
489 Ga0070667_100087740
490 Ga0070714_100042814
491 Ga0070678_100086693
492 Ga0070678_100129640
493 Ga0070662_100054996
494 Ga0070662_100057801
495 Ga0070662_100070198
496 Ga0070681_10049686
497 Ga0068867_100040670
498 Ga0068867_100238560
499 Ga0070679_100000031
500 Ga0070684_100007300
501 Ga0068853_100068021
502 Ga0068853_100129356
503 Ga0068853_100173587
504 Ga0070672_100085004
505 Ga0070672_100085284
506 Ga0070696_100255673
507 Ga0070665_100021747
508 Ga0070665_100040082
509 Ga0070664_100024270
510 Ga0070664_100039590
511 Ga0068854_100094050
512 Ga0068852_100017325
513 Ga0068852_100070168
514 Ga0068852_100077081
515 Ga0068859_100023024
516 Ga0068859_100319784
517 Ga0068864_100031886
518 Ga0068864_100037666
519 Ga0068864_100053940
520 Ga0068864_100316418
521 Ga0068864_100505533
522 Ga0068861_100054368
523 Ga0068851_10070799
524 Ga0068870_10157984
525 Ga0068863_100112792
526 Ga0068858_100045258
527 Ga0068858_100062511
528 Ga0068860_100113590
529 Ga0068862_100179063
530 Ga0081539_10040978
531 Ga0075431_100008702
532 Ga0068865_100002706
533 Ga0097620_100023024
534 Ga0097620_100319742
535 Ga0111539_10047867
536 Ga0111539_10490069
537 Ga0105245_10093806
538 Ga0105245_10226966
539 Ga0105245_10313448
540 Ga0105243_10040963
541 Ga0105242_10572272
542 Ga0105248_10343496
543 Ga0105238_10289105
544 Ga0105249_10158708
545 Ga0105246_10213175
546 Ga0157370_10340102
547 Ga0157369_10054517
548 Ga0157369_10191081
549 Ga0157374_10093325
550 Ga0157374_10516958
551 Ga0157378_10015380
552 Ga0163162_10131583
553 Ga0157372_10197829
554 Ga0157375_10034266
555 Ga0157375_10183387
556 Ga0163163_10045869
557 Ga0163163_10305654
558 Ga0157380_10001468
559 Ga0157380_10002105
560 Ga0157380_10015053
561 Ga0157379_10043381
562 Ga0157376_10005211
563 Ga0206354_11538386
564 Ga0206353_10836210
565 Ga0206353_11032406
566 Ga0213873_10000039
567 Ga0213876_10000455
568 Ga0213875_10002606
569 Ga0209676_1029940
570 Ga0209257_1007643
571 Ga0207697_10019160
572 Ga0207656_10082296
573 Ga0207682_10005329
574 Ga0207688_10083054
575 Ga0207688_10149524
576 Ga0207680_10000962
577 Ga0207680_10013216
578 Ga0207680_10107088
579 Ga0207647_10046111
580 Ga0207645_10044675
581 Ga0207643_10067648
582 Ga0207705_10000002
583 Ga0207705_10011251
584 Ga0207705_10066815
585 Ga0207705_10067719
586 Ga0207707_10253294
587 Ga0207660_10000342
588 Ga0207662_10105271
589 Ga0207657_10002098
590 Ga0207657_10007043
591 Ga0207657_10013042
592 Ga0207657_10025201
593 Ga0207657_10028000
594 Ga0207657_10075479
595 Ga0207649_10000323
596 Ga0207649_10069289
597 Ga0207649_10085685
598 Ga0207652_10000003
599 Ga0207681_10042851
600 Ga0207650_10031068
601 Ga0207650_10042166
602 Ga0207650_10136767
603 Ga0207650_10148609
604 Ga0207659_10040194
605 Ga0207659_10040277
606 Ga0207659_10051765
607 Ga0207687_10108181
608 Ga0207687_10138564
609 Ga0207687_10241459
610 Ga0207664_10028887
611 Ga0207644_10107923
612 Ga0207644_10196111
613 Ga0207690_10002917
614 Ga0207690_10004636
615 Ga0207690_10040840
616 Ga0207706_10000837
617 Ga0207706_10013529
618 Ga0207706_10014742
619 Ga0207706_10028411
620 Ga0207706_10090124
621 Ga0207706_10143546
622 Ga0207709_10049144
623 Ga0207669_10089165
624 Ga0207691_10005409
625 Ga0207691_10017231
626 Ga0207691_10035988
627 Ga0207711_10005386
628 Ga0207689_10006231
629 Ga0207661_10034241
630 Ga0207679_10100314
631 Ga0207679_10209828
632 Ga0207679_10311774
633 Ga0207651_10009716
634 Ga0207651_10020653
635 Ga0207712_10121145
636 Ga0207668_10001028
637 Ga0207668_10081319
638 Ga0207668_10098111
639 Ga0207668_10121566
640 Ga0207640_10181578
641 Ga0207658_10056264
642 Ga0207658_10082792
643 Ga0207677_10001998
644 Ga0207677_10014578
645 Ga0207703_10144733
646 Ga0207703_10267633
647 Ga0207639_10036524
648 Ga0207639_10188970
649 Ga0207639_10258816
650 Ga0207678_10004144
651 Ga0207678_10010676
652 Ga0207678_10088184
653 Ga0207678_10126776
654 Ga0207678_10239940
655 Ga0207641_10109105
656 Ga0207648_10009361
657 Ga0207648_10011784
658 Ga0207648_10055066
659 Ga0207676_10034327
660 Ga0207676_10066706
661 Ga0207674_10024437
662 Ga0207674_10098174
663 Ga0207674_10141810
664 Ga0207675_100011589
665 Ga0207675_100162035
666 Ga0207683_10005277
667 Ga0207683_10037719
668 Ga0207683_10065008
669 Ga0207683_10341445
670 Ga0207683_10367744
671 Ga0207698_10015822
672 Ga0207698_10445917
673 Ga0209971_1030221
674 Ga0209974_10002470
675 Ga0209974_10014464
676 Ga0209974_10028274
677 Ga0268266_10007358
678 Ga0268266_10169452
679 Ga0268265_10085113
680 Ga0268265_10276534
681 Ga0316177_1111890
682 Ga0307408_100008664
683 Ga0307408_100011392
684 Ga0307408_100014285
685 Ga0307408_100029820
686 Ga0307408_100061269
687 Ga0307408_100168065
688 Ga0307405_10015694
689 Ga0307405_10015930
690 Ga0307405_10046236
691 Ga0307405_10067693
692 Ga0307405_10165279
693 Ga0307405_10269939
694 Ga0307405_10375762
695 Ga0307413_10000908
696 Ga0307413_10002342
697 Ga0307413_10003272
698 Ga0307413_10048649
699 Ga0307413_10049769
700 Ga0307413_10052142
701 Ga0307413_10054333
702 Ga0307413_10058606
703 Ga0307413_10065253
704 Ga0307413_10123146
705 Ga0307413_10157291
706 Ga0307413_10171794
707 Ga0307413_10214839
708 Ga0307410_10001686
709 Ga0307410_10004997
710 Ga0307410_10006030
711 Ga0307410_10006358
712 Ga0307410_10011831
713 Ga0307410_10017127
714 Ga0307410_10024791
715 Ga0307410_10026935
716 Ga0307410_10033574
717 Ga0307410_10055992
718 Ga0307410_10126841
719 Ga0307406_10006291
720 Ga0307406_10019319
721 Ga0307406_10024146
722 Ga0307406_10039880
723 Ga0307406_10068569
724 Ga0307406_10090571
725 Ga0307406_10150250
726 Ga0307406_10299643
727 Ga0307406_10301887
728 Ga0307407_10003218
729 Ga0307407_10009127
730 Ga0307407_10014378
731 Ga0307407_10040515
732 Ga0307407_10072931
733 Ga0307407_10242856
734 Ga0307412_10009604
735 Ga0307412_10015291
736 Ga0307412_10034739
737 Ga0307412_10035446
738 Ga0307412_10043226
739 Ga0307412_10069911
740 Ga0307409_100002023
741 Ga0307409_100016422
742 Ga0307409_100018940
743 Ga0307409_100084765
744 Ga0307409_100089006
745 Ga0307409_100091091
746 Ga0307409_100122472
747 Ga0307409_100145963
748 Ga0307409_100222341
749 Ga0307409_100226734
750 Ga0307409_100310688
751 Ga0307409_100330563
752 Ga0307409_100629296
753 Ga0307416_100005183
754 Ga0307416_100009830
755 Ga0307416_100020692
756 Ga0307416_100028987
757 Ga0307416_100090157
758 Ga0307416_100309383
759 Ga0307416_100312787
760 Ga0307416_100333790
761 Ga0307416_100475526
762 Ga0307416_100534382
763 Ga0307414_10000442
764 Ga0307414_10001091
765 Ga0307414_10005621
766 Ga0307414_10012437
767 Ga0307414_10012808
768 Ga0307414_10030433
769 Ga0307414_10037692
770 Ga0307414_10045405
771 Ga0307414_10059259
772 Ga0307414_10063291
773 Ga0307414_10090408
774 Ga0307414_10103287
775 Ga0307414_10114921
776 Ga0307414_10117866
777 Ga0307414_10144970
778 Ga0307414_10218683
779 Ga0307414_10338782
780 Ga0307411_10000431
781 Ga0307411_10001268
782 Ga0307411_10001563
783 Ga0307411_10011607
784 Ga0307411_10020983
785 Ga0307411_10021974
786 Ga0307411_10023032
787 Ga0307411_10029986
788 Ga0307411_10051035
789 Ga0307411_10104400
790 Ga0307411_10111191
791 Ga0307411_10151384
792 Ga0307411_10196131
793 Ga0307411_10202582
794 Ga0307411_10232097
795 Ga0307415_100021276
796 Ga0307415_100022002
797 Ga0307415_100029290
798 Ga0307415_100031890
799 Ga0307415_100046860
800 Ga0307415_100099776
801 Ga0307415_100103649
802 Ga0395900_0001642
803 Ga0395900_0026272
804 Ga0395900_0027634
805 Ga0395900_0031705
806 Ga0395900_0215191
807 Ga0395900_0288508
808 Ga0395898_0025459
809 Ga0395898_0037912
810 Ga0395898_0140050
811 Ga0395898_0145903
812 Ga0395905_0001305
813 Ga0395905_0018156
814 Ga0395905_0047272
815 Ga0395905_0091201
816 Ga0395905_0692499
817 Ga0436364_0500114
818 Ga0436364_1406360
819 Ga0395901_0032667
820 Ga0395901_0095530
821 Ga0395901_0097827
822 Ga0395901_0131701
823 Ga0436365_0238180
824 Ga0436365_1685576
825 Ga0436362_0182183
826 Ga0439445_0000304
827 Ga0439432_040100
828 Ga0466969_0036039
829 Ga0466966_0006017
830 Ga0466966_0146693
831 Ga0466961_0012985
832 Ga0466963_0012419
833 Ga0466963_0085167
834 Ga0466963_0167325
835 Ga0466964_0068684
836 Ga0466971_0024645
837 Ga0466970_0011954
838 Ga0466957_0097876
839 Ga0466959_0011663
840 Ga0466959_0019787
841 Ga0466958_0002413
842 Ga0466967_0095450
843 Ga0466967_0170541
844 Ga0495663_0005994
845 Ga0495663_0019232
846 Ga0495654_0058118
847 Ga0495598_0032651
848 Ga0495621_0000457
849 Ga0495633_0079751
850 Ga0495668_0000001
851 Ga0495669_0043008
852 Ga0496100_0037569
853 Ga0496102_0051860
854 Ga0496102_0147232
855 Ga0496105_0060702
856 Ga0496107_0000263
857 Ga0496108_0001688
858 Ga0496109_0105796
859 Ga0496110_0242321
860 Ga0496111_0025156
861 Ga0496113_0040760
862 Ga0496114_0000033
863 Ga0501032_0063152
864 Ga0501033_0011198
865 Ga0501036_0042053
866 Ga0501037_0088027
867 Ga0501038_0031513
868 Ga0501039_0017451
869 Ga0501046_0016964
870 Ga0501047_0034379
871 Ga0501209_032128
872 Ga0501035_0042238
873 Ga0501044_0056725
874 nmdc:mga06r32_3622_c1
875 nmdc:mga08y16_217262_c1
876 Ga0500592_001181
877 Ga0500568_0001107
878 Ga0500604_0043555
879 Ga0500627_0000005
880 Ga0466962_0002625
881 2896431190
882 2643821718
883 2643835862
884 2644056787
885 2852681367
886 2885427506

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00933

Glyco_hydro_3

Glycosyl hydrolase family 3 N terminal domain

10

324

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5utr-assembly2.cif.gz_B crystal structure of burkholderia cenocepacia family 3 glycoside hydrolase (nagz) bound to (3s,4r,5r,6s)-3-butyryl-4,5,6-trihydroxyazepane 0.9181 2 332
4gnv-assembly1.cif.gz_B crystal structure of beta-hexosaminidase 1 from burkholderia cenocepacia j2315 with bound n-acetyl-d-glucosamine 0.9089 2 332
4g6c-assembly1.cif.gz_B crystal structure of beta-hexosaminidase 1 from burkholderia cenocepacia j2315 0.9061 2 332
5utr-assembly2.cif.gz_B crystal structure of burkholderia cenocepacia family 3 glycoside hydrolase (nagz) bound to (3s,4r,5r,6s)-3-butyryl-4,5,6-trihydroxyazepane 0.905 2 332
4gnv-assembly1.cif.gz_B crystal structure of beta-hexosaminidase 1 from burkholderia cenocepacia j2315 with bound n-acetyl-d-glucosamine 0.896 2 332
ID Description Score Start End Superfamily
4gnvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.8765 2 333 3.20.20.300
4zm6B01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.8733 2 335 3.20.20.300
4zm6B01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.8683 2 335 3.20.20.300
4gnvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.8593 2 333 3.20.20.300
2oxnA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.8507 1 335 3.20.20.300
ID Description Score Start End GO Terms
AF-A0A2A2K5K7-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) 0.9822 1 335 GO:0004553
GO:0005975
GO:0009254
AF-A0A7W5MN27-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) 0.9822 1 335 GO:0005975
GO:0009254
GO:0016231
AF-A0A2N3D0U2-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) 0.98 1 222 GO:0004553
GO:0005975
GO:0009254
AF-A0A7W5MN27-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) 0.9793 1 335 GO:0005975
GO:0009254
GO:0016231
AF-A0A2N3E2S2-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) 0.9787 1 288 GO:0004553
GO:0005975
GO:0009254

Map