F445165

General Info

Members Datasets Scaffolds Average Seq Length
443 263 422 123

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0033099|Ga0501034_0033099_2115_2522
Length 135
Sequence MTDTSERKFTAEHEWLDIDPSAGSGQGTTITIGITDFAAEKLGDVVFVELPAVGSTVSAGRVVGEIESTKSVGELFAPVDGTVVEVNDEVVANPELVNEDPYGRGWMIKVEVADAAVLDSADLLDFDAYTALVGE

Samples

Sample ID Description Type Environment
1 2643221549 Agromyces sp. Root1464 Isolate Unclassified
2 2643221616 Leifsonia sp. Root227 Isolate Unclassified
3 2643221619 Agromyces sp. Root81 Isolate Unclassified
4 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
5 2808606372 Agromyces sp. 23-23 Isolate Unclassified
6 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
7 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
8 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
9 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
10 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
11 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
12 2919395869 Microbacterium resistens 2980 Isolate Unclassified
13 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
14 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
15 2928153084 Leifsonia sp. 563 Isolate Unclassified
16 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
17 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
18 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
19 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
24 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
25 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
26 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
27 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
28 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
163 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
164 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
165 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
166 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
169 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
170 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
171 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
244 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
245 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
246 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
247 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
248 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
249 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
250 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
251 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
252 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
253 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
254 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
255 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
256 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
259 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
262 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
263 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.45
Metatranscriptomes 1.81
Isolates 4.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.77
Nodule 0
Rhizoplane 9.03
Rhizosphere 64.79
Stem 0
Stem Tuber 0.23
Unclassified 12.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10040512 3300001979 Bacteria 1412
2 JGI24737J22298_10035052 3300001990 Bacteria 1554
3 JGI24735J21928_10000532 3300002067 Bacteria 13458
4 JGI25164J39214_1000715 3300002772 Bacteria 12633
5 JGI25165J46597_1000004 3300003214 Bacteria 667510
6 Ga0006562J51391_1021236 3300003578 Bacteria 11150
7 Ga0006562J51391_1021237 3300003578 Bacteria 4600
8 Ga0055539_1000005 3300003752 Bacteria 609598
9 Ga0055533_1000001 3300003756 Bacteria 1863437
10 Ga0055532_1006167 3300003758 Bacteria 1621
11 Ga0055525_1000448 3300003759 Bacteria 23663
12 Ga0055525_1002883 3300003759 Bacteria 1625
13 Ga0055527_1000001 3300003760 Bacteria 850044
14 Ga0055542_1022351 3300003762 Bacteria 900
15 Ga0055529_1000019 3300003763 Bacteria 332786
16 Ga0055529_1016728 3300003763 Bacteria 921
17 Ga0055541_1002712 3300003841 Bacteria 3461
18 Ga0065714_10266707 3300005288 Bacteria 746
19 Ga0070658_10100848 3300005327 Bacteria 2386
20 Ga0070658_11270332 3300005327 Bacteria 640
21 Ga0070676_10421475 3300005328 Bacteria 933
22 Ga0068869_100078814 3300005334 Bacteria 2454
23 Ga0070682_101886578 3300005337 Bacteria 523
24 Ga0068868_100016229 3300005338 Bacteria 5526
25 Ga0070660_100070203 3300005339 Bacteria 2733
26 Ga0070661_100202451 3300005344 Bacteria 1517
27 Ga0070668_100541951 3300005347 Bacteria 1012
28 Ga0070671_100289973 3300005355 Bacteria 1393
29 Ga0070667_100060637 3300005367 Bacteria 3201
30 Ga0070709_10063663 3300005434 Bacteria 2356
31 Ga0070710_10044935 3300005437 Bacteria 2453
32 Ga0070663_101572199 3300005455 Bacteria 586
33 Ga0070678_100106261 3300005456 Bacteria 2187
34 Ga0070685_10319254 3300005466 Bacteria 1052
35 Ga0070679_101619262 3300005530 Bacteria 595
36 Ga0068853_100074633 3300005539 Bacteria 2959
37 Ga0068853_100270130 3300005539 Bacteria 1566
38 Ga0070672_100919809 3300005543 Bacteria 773
39 Ga0070665_101035576 3300005548 Bacteria 833
40 Ga0070665_101553529 3300005548 Bacteria 670
41 Ga0068855_100073223 3300005563 Bacteria 3981
42 Ga0068855_100182537 3300005563 Bacteria 2371
43 Ga0068855_100186968 3300005563 Bacteria 2339
44 Ga0068857_100012086 3300005577 Bacteria 7507
45 Ga0068857_100193366 3300005577 Bacteria 1853
46 Ga0068854_100689426 3300005578 Bacteria 881
47 Ga0068856_100246078 3300005614 Bacteria 1803
48 Ga0068856_100265439 3300005614 Bacteria 1732
49 Ga0068856_100318779 3300005614 Bacteria 1572
50 Ga0068856_101625729 3300005614 Bacteria 659
51 Ga0068856_102234100 3300005614 Bacteria 556
52 Ga0068852_100010253 3300005616 Bacteria 6989
53 Ga0068852_100011554 3300005616 Bacteria 6655
54 Ga0068852_100790517 3300005616 Bacteria 963
55 Ga0068852_101618554 3300005616 Bacteria 670
56 Ga0068864_100439757 3300005618 Bacteria 1246
57 Ga0068851_10000009 3300005834 Bacteria 217844
58 Ga0068863_100635763 3300005841 Bacteria 1058
59 Ga0068858_100000839 3300005842 Bacteria 31914
60 Ga0075365_10046743 3300006038 Bacteria 2843
61 Ga0075365_10785932 3300006038 Bacteria 672
62 Ga0075364_10001010 3300006051 Bacteria 14910
63 Ga0075364_10039496 3300006051 Bacteria 3060
64 Ga0075369_10376458 3300006186 Bacteria 668
65 Ga0097621_101847885 3300006237 Bacteria 576
66 Ga0105244_10355396 3300009036 Bacteria 675
67 Ga0105240_10094273 3300009093 Bacteria 3652
68 Ga0105240_10202397 3300009093 Bacteria 2326
69 Ga0105240_10453750 3300009093 Bacteria 1434
70 Ga0105240_10658193 3300009093 Bacteria 1147
71 Ga0111539_10527527 3300009094 Bacteria 1376
72 Ga0105245_10051202 3300009098 Bacteria 3702
73 Ga0105245_10440717 3300009098 Bacteria 1309
74 Ga0105245_11811293 3300009098 Bacteria 663
75 Ga0105245_12437327 3300009098 Bacteria 577
76 Ga0105247_10048167 3300009101 Bacteria 2617
77 Ga0105243_10336378 3300009148 Bacteria 1381
78 Ga0105241_10001322 3300009174 Bacteria 18835
79 Ga0105241_10677412 3300009174 Bacteria 939
80 Ga0105241_11075561 3300009174 Bacteria 756
81 Ga0105248_10000533 3300009177 Bacteria 43245
82 Ga0105248_10159522 3300009177 Bacteria 2544
83 Ga0105237_10000898 3300009545 Bacteria 40152
84 Ga0105237_10097526 3300009545 Bacteria 2930
85 Ga0105237_10738558 3300009545 Bacteria 991
86 Ga0105238_10010729 3300009551 Bacteria 9201
87 Ga0105238_10291766 3300009551 Bacteria 1613
88 Ga0105249_10185366 3300009553 Bacteria 2028
89 Ga0105246_10088391 3300011119 Bacteria 2226
90 Ga0105246_10943449 3300011119 Bacteria 777
91 Ga0157371_10004593 3300013102 Bacteria 11988
92 Ga0157370_10483620 3300013104 Bacteria 1137
93 Ga0157370_11650293 3300013104 Bacteria 576
94 Ga0157369_10071225 3300013105 Bacteria 3732
95 Ga0157369_10241799 3300013105 Bacteria 1885
96 Ga0157369_11510659 3300013105 Bacteria 683
97 Ga0157369_12453825 3300013105 Bacteria 528
98 Ga0157374_10571927 3300013296 Bacteria 1139
99 Ga0163162_10429800 3300013306 Bacteria 1453
100 Ga0163162_10884051 3300013306 Bacteria 1007
101 Ga0163162_13137563 3300013306 Bacteria 530
102 Ga0157372_10353026 3300013307 Bacteria 1713
103 Ga0157375_10719830 3300013308 Bacteria 1151
104 Ga0163163_10149031 3300014325 Bacteria 2384
105 Ga0157380_10196816 3300014326 Bacteria 1784
106 Ga0157379_10002021 3300014968 Bacteria 16811
107 Ga0163161_10199355 3300017792 Bacteria 1542
108 Ga0197907_10877910 3300020069 Bacteria 2488
109 Ga0206350_10030166 3300020080 Bacteria 1148
110 Ga0206353_11026904 3300020082 Bacteria 4734
111 Ga0224712_10160219 3300022467 Bacteria 1003
112 Ga0209566_100105 3300025225 Bacteria 125766
113 Ga0209674_100001 3300025226 Bacteria 4013750
114 Ga0209672_100006 3300025228 Bacteria 1004497
115 Ga0209147_103179 3300025229 Bacteria 3368
116 Ga0209563_100001 3300025230 Bacteria 4013775
117 Ga0209563_100404 3300025230 Bacteria 15438
118 Ga0209563_120257 3300025230 Bacteria 750
119 Ga0207427_100010 3300025231 Bacteria 648610
120 Ga0209437_100550 3300025233 Bacteria 25143
121 Ga0209677_100001 3300025253 Bacteria 4013787
122 Ga0209677_101020 3300025253 Bacteria 13368
123 Ga0209148_1000015 3300025254 Bacteria 850103
124 Ga0209148_1002193 3300025254 Bacteria 7202
125 Ga0209233_1000001 3300025261 Bacteria 2992747
126 Ga0209455_1000013 3300025272 Bacteria 850103
127 Ga0209455_1000938 3300025272 Bacteria 14930
128 Ga0207656_10000001 3300025321 Bacteria 1323684
129 Ga0207656_10000003 3300025321 Bacteria 771644
130 Ga0207656_10000004 3300025321 Bacteria 632320
131 Ga0207692_10171072 3300025898 Bacteria 1259
132 Ga0207692_10264255 3300025898 Bacteria 1036
133 Ga0207688_10276059 3300025901 Bacteria 1023
134 Ga0207647_10141773 3300025904 Bacteria 1408
135 Ga0207647_10320944 3300025904 Bacteria 879
136 Ga0207643_10100200 3300025908 Bacteria 1698
137 Ga0207705_10161073 3300025909 Bacteria 1686
138 Ga0207705_11051340 3300025909 Bacteria 628
139 Ga0207654_10000003 3300025911 Bacteria 1030378
140 Ga0207695_10004194 3300025913 Bacteria 19808
141 Ga0207695_10067802 3300025913 Bacteria 3658
142 Ga0207695_10294006 3300025913 Bacteria 1516
143 Ga0207695_10400574 3300025913 Bacteria 1257
144 Ga0207671_10000001 3300025914 Bacteria 1318881
145 Ga0207671_10060217 3300025914 Bacteria 2816
146 Ga0207671_10445383 3300025914 Bacteria 1031
147 Ga0207657_10002482 3300025919 Bacteria 19943
148 Ga0207694_10000305 3300025924 Bacteria 46177
149 Ga0207694_10054758 3300025924 Bacteria 3096
150 Ga0207650_10500551 3300025925 Bacteria 1015
151 Ga0207659_10414807 3300025926 Bacteria 1128
152 Ga0207687_10768096 3300025927 Bacteria 821
153 Ga0207664_10534914 3300025929 Bacteria 1051
154 Ga0207644_10102476 3300025931 Bacteria 2153
155 Ga0207690_10000386 3300025932 Bacteria 29106
156 Ga0207709_10072605 3300025935 Bacteria 2189
157 Ga0207691_10582229 3300025940 Bacteria 948
158 Ga0207711_10000906 3300025941 Bacteria 28505
159 Ga0207711_10117580 3300025941 Bacteria 2371
160 Ga0207689_10199533 3300025942 Bacteria 1651
161 Ga0207667_10002288 3300025949 Bacteria 24073
162 Ga0207667_10011003 3300025949 Bacteria 10543
163 Ga0207667_10061471 3300025949 Bacteria 3929
164 Ga0207667_10399635 3300025949 Bacteria 1399
165 Ga0207712_10129247 3300025961 Bacteria 1922
166 Ga0207668_11736157 3300025972 Bacteria 563
167 Ga0207658_10083265 3300025986 Bacteria 2458
168 Ga0207677_10061631 3300026023 Bacteria 2599
169 Ga0207703_10000625 3300026035 Bacteria 35584
170 Ga0207639_10057114 3300026041 Bacteria 2995
171 Ga0207639_10548986 3300026041 Bacteria 1061
172 Ga0207639_10865347 3300026041 Bacteria 844
173 Ga0207678_10250870 3300026067 Bacteria 1515
174 Ga0207678_10392612 3300026067 Bacteria 1201
175 Ga0207702_10100661 3300026078 Bacteria 2550
176 Ga0207702_10544647 3300026078 Bacteria 1135
177 Ga0207676_10166232 3300026095 Bacteria 1917
178 Ga0207674_10007090 3300026116 Bacteria 13097
179 Ga0207674_10225070 3300026116 Bacteria 1824
180 Ga0207674_10578370 3300026116 Bacteria 1085
181 Ga0207683_10133880 3300026121 Bacteria 2230
182 Ga0207698_10008031 3300026142 Bacteria 6655
183 Ga0207698_10009582 3300026142 Bacteria 6185
184 Ga0268266_10428204 3300028379 Bacteria 1255
185 Ga0268266_12140025 3300028379 Bacteria 532
186 Ga0268264_11738435 3300028381 Bacteria 634
187 Ga0307515_10067151 3300028794 Bacteria 4952
188 Ga0307515_10074654 3300028794 Bacteria 4531
189 Ga0307515_10248813 3300028794 Bacteria 1534
190 Ga0265338_10069181 3300028800 Bacteria 3035
191 Ga0265332_10143132 3300031238 Bacteria 1001
192 Ga0265339_10021205 3300031249 Bacteria 3785
193 Ga0307509_10858461 3300031507 Bacteria 572
194 Ga0307408_100916667 3300031548 Bacteria 803
195 Ga0307408_101348693 3300031548 Bacteria 670
196 Ga0307514_10002865 3300031649 Bacteria 17241
197 Ga0307405_10677754 3300031731 Bacteria 851
198 Ga0307413_10110326 3300031824 Bacteria 1841
199 Ga0307410_10142339 3300031852 Bacteria 1776
200 Ga0307410_11590913 3300031852 Bacteria 577
201 Ga0307406_10236304 3300031901 Bacteria 1368
202 Ga0307406_11302768 3300031901 Bacteria 634
203 Ga0307412_11063994 3300031911 Bacteria 718
204 Ga0307409_100132495 3300031995 Bacteria 2133
205 Ga0307409_100468358 3300031995 Bacteria 1220
206 Ga0307416_100675790 3300032002 Bacteria 1120
207 Ga0307416_100763892 3300032002 Bacteria 1060
208 Ga0307416_100948384 3300032002 Bacteria 962
209 Ga0307414_10219560 3300032004 Bacteria 1560
210 Ga0307414_11419811 3300032004 Bacteria 645
211 Ga0307415_100146207 3300032126 Bacteria 1813
212 Ga0307415_100756577 3300032126 Bacteria 883
213 Ga0307415_102082125 3300032126 Bacteria 554
214 Ga0395899_0011794 3300037312 Bacteria 6688
215 Ga0395899_0381605 3300037312 Bacteria 936
216 Ga0395900_0006021 3300037418 Bacteria 12649
217 Ga0395898_0000015 3300037466 Bacteria 439819
218 Ga0439466_0250240 3300041411 Bacteria 537
219 Ga0439465_0052049 3300041413 Bacteria 1343
220 Ga0451791_0153954 3300041451 Bacteria 622
221 Ga0451791_0274962 3300041451 Bacteria 750
222 Ga0451791_0415820 3300041451 Bacteria 759
223 Ga0451791_1392788 3300041451 Bacteria 514
224 Ga0451791_1445672 3300041451 Bacteria 878
225 Ga0451791_1664969 3300041451 Bacteria 588
226 Ga0451793_0905247 3300041452 Bacteria 845
227 Ga0451793_1909176 3300041452 Bacteria 1060
228 Ga0451802_1054913 3300041460 Bacteria 578
229 Ga0451802_1377088 3300041460 Bacteria 627
230 Ga0451806_196865 3300041462 Bacteria 1343
231 Ga0451806_292452 3300041462 Bacteria 1145
232 Ga0451804_1083078 3300041463 Bacteria 723
233 Ga0451807_2657271 3300041486 Bacteria 773
234 Ga0451839_1188536 3300041496 Bacteria 654
235 Ga0451843_1534693 3300041509 Bacteria 632
236 Ga0451855_1825245 3300041511 Bacteria 530
237 Ga0450908_107830 3300042184 Bacteria 513
238 Ga0466972_0046782 3300044658 Bacteria 2094
239 Ga0466972_0050827 3300044658 Bacteria 2000
240 Ga0466972_0106687 3300044658 Bacteria 1324
241 Ga0466972_0279237 3300044658 Bacteria 780
242 Ga0466965_0045416 3300044683 Bacteria 2173
243 Ga0466965_0075867 3300044683 Bacteria 1696
244 Ga0466965_0312553 3300044683 Bacteria 854
245 Ga0466961_0070342 3300044693 Bacteria 2221
246 Ga0466971_0576030 3300044719 Bacteria 560
247 Ga0466968_0050511 3300044735 Bacteria 1775
248 Ga0466970_0478684 3300044765 Bacteria 715
249 Ga0466970_0804860 3300044765 Bacteria 550
250 Ga0466957_0011563 3300044842 Bacteria 5098
251 Ga0466957_0070403 3300044842 Bacteria 2161
252 Ga0466960_0070131 3300044901 Bacteria 1743
253 Ga0466960_0574915 3300044901 Bacteria 667
254 Ga0466959_0035554 3300045049 Bacteria 3683
255 Ga0466958_0034963 3300045836 Bacteria 3000
256 Ga0495638_0137910 3300046460 Bacteria 1426
257 Ga0495606_0094693 3300046507 Bacteria 1830
258 Ga0495625_0131026 3300046660 Bacteria 1698
259 Ga0495672_0009811 3300047320 Bacteria 6892
260 Ga0495673_0095992 3300047469 Bacteria 1205
261 Ga0496100_0050922 3300048903 Bacteria 2685
262 Ga0496100_0269126 3300048903 Bacteria 1266
263 Ga0496101_0014615 3300048904 Bacteria 5279
264 Ga0496101_0314584 3300048904 Bacteria 1228
265 Ga0496102_0033073 3300048905 Bacteria 4646
266 Ga0496102_0064186 3300048905 Bacteria 3364
267 Ga0496102_0233434 3300048905 Bacteria 1734
268 Ga0496103_0121635 3300048906 Bacteria 1663
269 Ga0496103_0405861 3300048906 Bacteria 875
270 Ga0496104_0088646 3300048907 Bacteria 2956
271 Ga0496104_0104968 3300048907 Bacteria 2707
272 Ga0496104_0212693 3300048907 Bacteria 1845
273 Ga0496105_0012241 3300048908 Bacteria 6792
274 Ga0496105_0016403 3300048908 Bacteria 5914
275 Ga0496107_1176176 3300048910 Bacteria 552
276 Ga0496108_0877127 3300048911 Bacteria 771
277 Ga0496109_0388749 3300048912 Bacteria 1318
278 Ga0496110_0647701 3300048913 Bacteria 956
279 Ga0496113_0162867 3300048916 Bacteria 1764
280 Ga0496114_0100567 3300048917 Bacteria 2467
281 Ga0496114_0228734 3300048917 Bacteria 1633
282 Ga0496114_1734956 3300048917 Bacteria 512
283 Ga0496115_0021594 3300048918 Bacteria 4974
284 Ga0496115_0034419 3300048918 Bacteria 4003
285 Ga0496115_0058536 3300048918 Bacteria 3101
286 Ga0496115_0150980 3300048918 Bacteria 1918
287 Ga0496117_0000120 3300048920 Bacteria 171697
288 Ga0496117_0001880 3300048920 Bacteria 28246
289 Ga0496117_0027383 3300048920 Bacteria 4443
290 Ga0496117_0062405 3300048920 Bacteria 2554
291 Ga0496117_0166814 3300048920 Bacteria 1283
292 Ga0496117_0552755 3300048920 Bacteria 548
293 Ga0496118_0015499 3300048921 Bacteria 7052
294 Ga0496118_0039288 3300048921 Bacteria 3778
295 Ga0496118_0093121 3300048921 Bacteria 2066
296 Ga0496119_0002415 3300048922 Bacteria 20506
297 Ga0496119_0008851 3300048922 Bacteria 8754
298 Ga0496119_0068606 3300048922 Bacteria 2087
299 Ga0496120_0004295 3300048923 Bacteria 12082
300 Ga0496120_0077017 3300048923 Bacteria 1816
301 Ga0496120_0134684 3300048923 Bacteria 1261
302 Ga0496120_0159144 3300048923 Bacteria 1128
303 Ga0496120_0300606 3300048923 Bacteria 735
304 Ga0496121_0000132 3300048924 Bacteria 167578
305 Ga0496121_0081464 3300048924 Bacteria 2562
306 Ga0496121_0195769 3300048924 Bacteria 1445
307 Ga0496121_0476331 3300048924 Bacteria 798
308 Ga0496122_0005732 3300048925 Bacteria 14641
309 Ga0496122_0024765 3300048925 Bacteria 5241
310 Ga0496122_0075280 3300048925 Bacteria 2383
311 Ga0496122_0126166 3300048925 Bacteria 1638
312 Ga0496122_0405329 3300048925 Bacteria 691
313 Ga0496123_0000500 3300048926 Bacteria 68065
314 Ga0496124_0050333 3300048927 Bacteria 3551
315 Ga0496125_0064529 3300048928 Bacteria 2909
316 Ga0496125_0254594 3300048928 Bacteria 1105
317 Ga0496125_0556785 3300048928 Bacteria 634
318 Ga0496126_0002482 3300048929 Bacteria 24819
319 Ga0496126_0049596 3300048929 Bacteria 3832
320 Ga0496126_0111153 3300048929 Bacteria 2386
321 Ga0496126_0111620 3300048929 Bacteria 2381
322 Ga0496126_0221903 3300048929 Bacteria 1587
323 Ga0501308_058947 3300049128 Bacteria 576
324 Ga0501315_057151 3300049531 Bacteria 624
325 Ga0501031_0019934 3300049568 Bacteria 4371
326 Ga0501031_0388753 3300049568 Bacteria 902
327 Ga0501032_0003977 3300049569 Bacteria 11209
328 Ga0501032_0120517 3300049569 Bacteria 1734
329 Ga0501032_0324607 3300049569 Bacteria 993
330 Ga0501032_0492332 3300049569 Bacteria 784
331 Ga0501032_0694484 3300049569 Bacteria 645
332 Ga0501033_0072046 3300049570 Bacteria 2538
333 Ga0501034_0002709 3300049571 Bacteria 20874
334 Ga0501034_0004461 3300049571 Bacteria 15560
335 Ga0501034_0033099 3300049571 Bacteria 5248
336 Ga0501034_0064738 3300049571 Bacteria 3669
337 Ga0501034_0242177 3300049571 Bacteria 1749
338 Ga0501034_0266288 3300049571 Bacteria 1656
339 Ga0501034_0409255 3300049571 Bacteria 1278
340 Ga0501034_1111703 3300049571 Bacteria 671
341 Ga0501036_0001002 3300049572 Bacteria 21360
342 Ga0501037_0001216 3300049573 Bacteria 19066
343 Ga0501037_0013644 3300049573 Bacteria 5986
344 Ga0501037_0050483 3300049573 Bacteria 3044
345 Ga0501038_0000560 3300049574 Bacteria 32917
346 Ga0501039_0004184 3300049575 Bacteria 10868
347 Ga0501042_0005340 3300049578 Bacteria 8259
348 Ga0501043_0003802 3300049579 Bacteria 12412
349 Ga0501043_0033214 3300049579 Bacteria 4058
350 Ga0501043_0052111 3300049579 Bacteria 3215
351 Ga0501046_0000916 3300049580 Bacteria 28889
352 Ga0501046_0067186 3300049580 Bacteria 2792
353 Ga0501046_0134094 3300049580 Bacteria 1877
354 Ga0501046_0231109 3300049580 Bacteria 1366
355 Ga0501047_0001949 3300049581 Bacteria 19833
356 Ga0501047_0037342 3300049581 Bacteria 4697
357 Ga0501048_1271426 3300049582 Bacteria 529
358 Ga0501067_0515545 3300049583 Bacteria 669
359 Ga0501068_0022727 3300049584 Bacteria 3670
360 Ga0501069_0055571 3300049585 Bacteria 2206
361 Ga0501070_0000414 3300049586 Bacteria 38868
362 Ga0501070_0003336 3300049586 Bacteria 13945
363 Ga0501070_0013991 3300049586 Bacteria 6756
364 Ga0501070_0122635 3300049586 Bacteria 2148
365 Ga0501070_0148519 3300049586 Bacteria 1934
366 Ga0501070_0417434 3300049586 Bacteria 1084
367 Ga0501071_0001239 3300049587 Bacteria 14455
368 Ga0501071_0437178 3300049587 Bacteria 1001
369 Ga0501072_0069490 3300049588 Bacteria 2781
370 Ga0501073_0000038 3300049589 Bacteria 86286
371 Ga0501073_0055157 3300049589 Bacteria 2781
372 Ga0501073_0101084 3300049589 Bacteria 2002
373 Ga0501074_0175333 3300049590 Bacteria 1530
374 Ga0501077_0067017 3300049593 Bacteria 2277
375 Ga0501217_197726 3300049661 Bacteria 625
376 Ga0501080_0000261 3300049742 Bacteria 39938
377 Ga0501080_0060790 3300049742 Bacteria 3517
378 Ga0501080_0219516 3300049742 Bacteria 1740
379 Ga0501080_0796294 3300049742 Bacteria 829
380 Ga0501080_1822751 3300049742 Bacteria 511
381 Ga0501083_0089265 3300049744 Bacteria 2037
382 Ga0501083_0273365 3300049744 Bacteria 1099
383 Ga0501266_054214 3300049763 Bacteria 627
384 Ga0501035_0004789 3300049822 Bacteria 12837
385 Ga0501035_0008721 3300049822 Bacteria 9441
386 Ga0501035_0428878 3300049822 Bacteria 1097
387 Ga0501044_0002815 3300049823 Bacteria 19825
388 Ga0501044_0034354 3300049823 Bacteria 5317
389 Ga0501044_0219680 3300049823 Bacteria 1851
390 Ga0501045_0007075 3300049824 Bacteria 7777
391 Ga0501045_1402405 3300049824 Bacteria 507
392 nmdc:mga00v17_33496_c1 3300050491 Bacteria 3044
393 nmdc:mga00v17_97582_c1 3300050491 Bacteria 1852
394 nmdc:mga0yw44_1131225_c1 3300050492 Bacteria 529
395 nmdc:mga0yw44_484035_c1 3300050492 Bacteria 839
396 nmdc:mga0yw44_778146_c1 3300050492 Bacteria 650
397 Ga0500635_0000039 3300053080 Bacteria 93004
398 Ga0500643_000092 3300053087 Bacteria 93617
399 Ga0500651_0000505 3300053093 Bacteria 20183
400 Ga0500650_0001108 3300053098 Bacteria 7784
401 Ga0500556_0000007 3300053104 Bacteria 331400
402 Ga0500556_0000173 3300053104 Bacteria 52855
403 Ga0500562_003633 3300053108 Bacteria 3876
404 Ga0500572_001120 3300053111 Bacteria 7823
405 Ga0500593_010372 3300053117 Bacteria 3906
406 Ga0500597_137248 3300053120 Bacteria 1055
407 Ga0500559_0000370 3300053136 Bacteria 33075
408 Ga0500559_0160384 3300053136 Bacteria 1057
409 Ga0500559_0249188 3300053136 Bacteria 837
410 Ga0500568_0000008 3300053139 Bacteria 281012
411 Ga0500568_0000009 3300053139 Bacteria 270298
412 Ga0500568_0015649 3300053139 Bacteria 3392
413 Ga0500577_0012336 3300053142 Bacteria 2579
414 Ga0500588_0220700 3300053146 Bacteria 707
415 Ga0500590_031252 3300053148 Bacteria 2760
416 Ga0500616_0000058 3300053153 Bacteria 266276
417 Ga0500616_0000151 3300053153 Bacteria 116796
418 Ga0500620_000180 3300053155 Bacteria 12911
419 Ga0500645_022225 3300053730 Bacteria 1953
420 Ga0501084_0331581 3300054114 Bacteria 1285
421 Ga0501084_0580587 3300054114 Bacteria 947
422 Ga0466962_0134432 3300061719 Bacteria 1196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_11811293 Ga0105245_118112932 108
2 3300048923 Ga0496120_0159144 Ga0496120_0159144_791_1117 108
3 3300049571 Ga0501034_1111703 Ga0501034_1111703_333_659 108
4 3300049578 Ga0501042_0005340 Ga0501042_0005340_2231_2602 114
5 3300049822 Ga0501035_0428878 Ga0501035_0428878_227_598 114
6 3300053111 Ga0500572_001120 Ga0500572_001120_1010_1375 117
7 3300053120 Ga0500597_137248 Ga0500597_137248_601_966 117
8 3300005434 Ga0070709_10063663 Ga0070709_100636632 118
9 3300048924 Ga0496121_0000132 Ga0496121_0000132_142647_143003 118
10 3300049568 Ga0501031_0388753 Ga0501031_0388753_280_636 118
11 3300049569 Ga0501032_0120517 Ga0501032_0120517_1133_1489 118
12 3300049570 Ga0501033_0072046 Ga0501033_0072046_1603_1959 118
13 3300049571 Ga0501034_0266288 Ga0501034_0266288_210_566 118
14 3300049573 Ga0501037_0013644 Ga0501037_0013644_2965_3321 118
15 3300049579 Ga0501043_0052111 Ga0501043_0052111_1849_2205 118
16 3300049581 Ga0501047_0037342 Ga0501047_0037342_3053_3409 118
17 3300049586 Ga0501070_0417434 Ga0501070_0417434_69_425 118
18 3300049742 Ga0501080_0796294 Ga0501080_0796294_273_629 118
19 3300049822 Ga0501035_0008721 Ga0501035_0008721_6384_6740 118
20 3300049823 Ga0501044_0034354 Ga0501044_0034354_2689_3045 118
21 iso_pu_bacteria 2964326757 2964328959 118
22 3300028794 Ga0307515_10074654 Ga0307515_100746543 119
23 3300028794 Ga0307515_10248813 Ga0307515_102488132 119
24 3300044719 Ga0466971_0576030 Ga0466971_0576030_184_543 119
25 3300048920 Ga0496117_0062405 Ga0496117_0062405_150_509 119
26 3300048922 Ga0496119_0002415 Ga0496119_0002415_402_761 119
27 3300048923 Ga0496120_0300606 Ga0496120_0300606_188_547 119
28 3300048924 Ga0496121_0476331 Ga0496121_0476331_168_527 119
29 3300049569 Ga0501032_0694484 Ga0501032_0694484_25_384 119
30 3300053104 Ga0500556_0000173 Ga0500556_0000173_42551_42910 119
31 3300053117 Ga0500593_010372 Ga0500593_010372_1445_1804 119
32 iso_pu_bacteria 2643221549 2643769704 119
33 iso_pu_bacteria 2643221616 2644096944 119
34 iso_pu_bacteria 2643221619 2644114358 119
35 iso_pu_bacteria 2721755702 2723641533 119
36 iso_pu_bacteria 2808606372 2808901484 119
37 iso_pu_bacteria 2844852863 2844855920 119
38 iso_pu_bacteria 2857733635 2857736562 119
39 iso_pu_bacteria 2862993130 2862995226 119
40 iso_pu_bacteria 2884763398 2884765860 119
41 iso_pu_bacteria 2919395869 2919396016 119
42 iso_pu_bacteria 2919443155 2919446818 119
43 iso_pu_bacteria 2935409751 2935410951 119
44 iso_pu_bacteria 2939657138 2939657192 119
45 iso_pu_bacteria 8056037122 8056039799 119
46 iso_pu_bacteria 8057345674 8057348296 119
47 3300005548 Ga0070665_101553529 Ga0070665_1015535291 120
48 3300006051 Ga0075364_10001010 Ga0075364_1000101018 120
49 3300006051 Ga0075364_10039496 Ga0075364_100394963 120
50 3300028379 Ga0268266_10428204 Ga0268266_104282042 120
51 3300028794 Ga0307515_10067151 Ga0307515_100671513 120
52 3300028800 Ga0265338_10069181 Ga0265338_100691813 120
53 3300031238 Ga0265332_10143132 Ga0265332_101431322 120
54 3300031249 Ga0265339_10021205 Ga0265339_100212053 120
55 3300031911 Ga0307412_11063994 Ga0307412_110639942 120
56 3300032002 Ga0307416_100675790 Ga0307416_1006757902 120
57 3300032004 Ga0307414_10219560 Ga0307414_102195602 120
58 3300032126 Ga0307415_102082125 Ga0307415_1020821252 120
59 3300041451 Ga0451791_0274962 Ga0451791_0274962_267_629 120
60 3300044683 Ga0466965_0045416 Ga0466965_0045416_283_645 120
61 3300044901 Ga0466960_0574915 Ga0466960_0574915_231_593 120
62 3300048920 Ga0496117_0552755 Ga0496117_0552755_49_411 120
63 3300048929 Ga0496126_0049596 Ga0496126_0049596_1472_1834 120
64 3300049569 Ga0501032_0492332 Ga0501032_0492332_39_401 120
65 3300049586 Ga0501070_0148519 Ga0501070_0148519_1399_1761 120
66 3300049589 Ga0501073_0000038 Ga0501073_0000038_6014_6376 120
67 3300049742 Ga0501080_0060790 Ga0501080_0060790_2817_3179 120
68 3300049742 Ga0501080_0219516 Ga0501080_0219516_391_753 120
69 3300050491 nmdc:mga00v17_33496_c1 nmdc:mga00v17_33496_c1_207_569 120
70 3300050491 nmdc:mga00v17_97582_c1 nmdc:mga00v17_97582_c1_1061_1423 120
71 3300050492 nmdc:mga0yw44_1131225_c1 nmdc:mga0yw44_1131225_c1_94_456 120
72 3300050492 nmdc:mga0yw44_778146_c1 nmdc:mga0yw44_778146_c1_72_434 120
73 3300053108 Ga0500562_003633 Ga0500562_003633_1780_2142 120
74 3300053136 Ga0500559_0000370 Ga0500559_0000370_22961_23323 120
75 iso_pu_bacteria 2844841374 2844842881 120
76 iso_pu_bacteria 2919055335 2919058854 120
77 iso_pu_bacteria 2919523602 2919524964 120
78 iso_pu_bacteria 2928153084 2928156838 120
79 iso_pu_bacteria 2966921586 2966921742 120
80 3300025898 Ga0207692_10264255 Ga0207692_102642552 121
81 3300041451 Ga0451791_1664969 Ga0451791_1664969_14_418 121
82 3300003762 Ga0055542_1022351 Ga0055542_10223511 122
83 3300005327 Ga0070658_10100848 Ga0070658_101008482 122
84 3300005337 Ga0070682_101886578 Ga0070682_1018865781 122
85 3300005338 Ga0068868_100016229 Ga0068868_1000162291 122
86 3300005339 Ga0070660_100070203 Ga0070660_1000702033 122
87 3300005344 Ga0070661_100202451 Ga0070661_1002024512 122
88 3300005355 Ga0070671_100289973 Ga0070671_1002899732 122
89 3300005367 Ga0070667_100060637 Ga0070667_1000606372 122
90 3300005455 Ga0070663_101572199 Ga0070663_1015721991 122
91 3300005466 Ga0070685_10319254 Ga0070685_103192542 122
92 3300005530 Ga0070679_101619262 Ga0070679_1016192621 122
93 3300005539 Ga0068853_100074633 Ga0068853_1000746332 122
94 3300005539 Ga0068853_100270130 Ga0068853_1002701302 122
95 3300005563 Ga0068855_100073223 Ga0068855_1000732232 122
96 3300005563 Ga0068855_100182537 Ga0068855_1001825373 122
97 3300005563 Ga0068855_100186968 Ga0068855_1001869683 122
98 3300005577 Ga0068857_100012086 Ga0068857_1000120863 122
99 3300005577 Ga0068857_100193366 Ga0068857_1001933662 122
100 3300005578 Ga0068854_100689426 Ga0068854_1006894262 122
101 3300005614 Ga0068856_100246078 Ga0068856_1002460782 122
102 3300005614 Ga0068856_100265439 Ga0068856_1002654392 122
103 3300005614 Ga0068856_100318779 Ga0068856_1003187792 122
104 3300005614 Ga0068856_101625729 Ga0068856_1016257291 122
105 3300005616 Ga0068852_100010253 Ga0068852_1000102534 122
106 3300005616 Ga0068852_100011554 Ga0068852_1000115545 122
107 3300005616 Ga0068852_100790517 Ga0068852_1007905172 122
108 3300005616 Ga0068852_101618554 Ga0068852_1016185542 122
109 3300005618 Ga0068864_100439757 Ga0068864_1004397572 122
110 3300005834 Ga0068851_10000009 Ga0068851_1000000947 122
111 3300005841 Ga0068863_100635763 Ga0068863_1006357631 122
112 3300005842 Ga0068858_100000839 Ga0068858_10000083933 122
113 3300006038 Ga0075365_10785932 Ga0075365_107859322 122
114 3300006237 Ga0097621_101847885 Ga0097621_1018478852 122
115 3300009093 Ga0105240_10094273 Ga0105240_100942733 122
116 3300009093 Ga0105240_10202397 Ga0105240_102023972 122
117 3300009093 Ga0105240_10453750 Ga0105240_104537502 122
118 3300009093 Ga0105240_10658193 Ga0105240_106581932 122
119 3300009098 Ga0105245_10051202 Ga0105245_100512022 122
120 3300009098 Ga0105245_10440717 Ga0105245_104407172 122
121 3300009101 Ga0105247_10048167 Ga0105247_100481672 122
122 3300009174 Ga0105241_10001322 Ga0105241_100013226 122
123 3300009174 Ga0105241_10677412 Ga0105241_106774122 122
124 3300009174 Ga0105241_11075561 Ga0105241_110755612 122
125 3300009177 Ga0105248_10000533 Ga0105248_1000053336 122
126 3300009177 Ga0105248_10159522 Ga0105248_101595223 122
127 3300009545 Ga0105237_10000898 Ga0105237_1000089837 122
128 3300009545 Ga0105237_10097526 Ga0105237_100975264 122
129 3300009545 Ga0105237_10738558 Ga0105237_107385582 122
130 3300009551 Ga0105238_10010729 Ga0105238_100107294 122
131 3300009551 Ga0105238_10291766 Ga0105238_102917662 122
132 3300011119 Ga0105246_10943449 Ga0105246_109434492 122
133 3300013104 Ga0157370_10483620 Ga0157370_104836202 122
134 3300013296 Ga0157374_10571927 Ga0157374_105719272 122
135 3300014325 Ga0163163_10149031 Ga0163163_101490313 122
136 3300014968 Ga0157379_10002021 Ga0157379_100020212 122
137 3300025254 Ga0209148_1002193 Ga0209148_10021938 122
138 3300025321 Ga0207656_10000001 Ga0207656_10000001482 122
139 3300025321 Ga0207656_10000003 Ga0207656_10000003588 122
140 3300025321 Ga0207656_10000004 Ga0207656_10000004445 122
141 3300025911 Ga0207654_10000003 Ga0207654_10000003765 122
142 3300025913 Ga0207695_10004194 Ga0207695_1000419420 122
143 3300025913 Ga0207695_10067802 Ga0207695_100678023 122
144 3300025913 Ga0207695_10294006 Ga0207695_102940062 122
145 3300025913 Ga0207695_10400574 Ga0207695_104005742 122
146 3300025914 Ga0207671_10000001 Ga0207671_10000001480 122
147 3300025914 Ga0207671_10060217 Ga0207671_100602174 122
148 3300025914 Ga0207671_10445383 Ga0207671_104453832 122
149 3300025919 Ga0207657_10002482 Ga0207657_100024824 122
150 3300025924 Ga0207694_10000305 Ga0207694_1000030544 122
151 3300025924 Ga0207694_10054758 Ga0207694_100547582 122
152 3300025927 Ga0207687_10768096 Ga0207687_107680962 122
153 3300025931 Ga0207644_10102476 Ga0207644_101024762 122
154 3300025932 Ga0207690_10000386 Ga0207690_1000038634 122
155 3300025941 Ga0207711_10000906 Ga0207711_1000090626 122
156 3300025941 Ga0207711_10117580 Ga0207711_101175802 122
157 3300025949 Ga0207667_10002288 Ga0207667_1000228812 122
158 3300025949 Ga0207667_10011003 Ga0207667_100110032 122
159 3300025949 Ga0207667_10061471 Ga0207667_100614712 122
160 3300025949 Ga0207667_10399635 Ga0207667_103996352 122
161 3300025986 Ga0207658_10083265 Ga0207658_100832652 122
162 3300026023 Ga0207677_10061631 Ga0207677_100616313 122
163 3300026035 Ga0207703_10000625 Ga0207703_100006256 122
164 3300026041 Ga0207639_10057114 Ga0207639_100571142 122
165 3300026041 Ga0207639_10548986 Ga0207639_105489862 122
166 3300026041 Ga0207639_10865347 Ga0207639_108653472 122
167 3300026078 Ga0207702_10100661 Ga0207702_101006613 122
168 3300026078 Ga0207702_10544647 Ga0207702_105446472 122
169 3300026095 Ga0207676_10166232 Ga0207676_101662322 122
170 3300026116 Ga0207674_10007090 Ga0207674_100070902 122
171 3300026116 Ga0207674_10225070 Ga0207674_102250702 122
172 3300026116 Ga0207674_10578370 Ga0207674_105783702 122
173 3300026142 Ga0207698_10008031 Ga0207698_100080312 122
174 3300026142 Ga0207698_10009582 Ga0207698_100095824 122
175 3300031507 Ga0307509_10858461 Ga0307509_108584612 122
176 3300041451 Ga0451791_1392788 Ga0451791_1392788_111_482 122
177 3300041460 Ga0451802_1054913 Ga0451802_1054913_10_378 122
178 3300041460 Ga0451802_1377088 Ga0451802_1377088_59_433 122
179 3300041463 Ga0451804_1083078 Ga0451804_1083078_51_422 122
180 3300041509 Ga0451843_1534693 Ga0451843_1534693_86_457 122
181 3300048920 Ga0496117_0166814 Ga0496117_0166814_56_427 122
182 3300048921 Ga0496118_0039288 Ga0496118_0039288_3361_3732 122
183 3300048922 Ga0496119_0008851 Ga0496119_0008851_1340_1711 122
184 3300048923 Ga0496120_0004295 Ga0496120_0004295_2618_2989 122
185 3300048923 Ga0496120_0134684 Ga0496120_0134684_62_433 122
186 3300048924 Ga0496121_0081464 Ga0496121_0081464_726_1097 122
187 3300048928 Ga0496125_0556785 Ga0496125_0556785_208_579 122
188 3300049569 Ga0501032_0324607 Ga0501032_0324607_97_465 122
189 3300049571 Ga0501034_0004461 Ga0501034_0004461_11012_11386 122
190 3300049571 Ga0501034_0064738 Ga0501034_0064738_669_1043 122
191 3300049571 Ga0501034_0242177 Ga0501034_0242177_541_915 122
192 3300049571 Ga0501034_0409255 Ga0501034_0409255_747_1115 122
193 3300049573 Ga0501037_0050483 Ga0501037_0050483_2426_2794 122
194 3300049579 Ga0501043_0033214 Ga0501043_0033214_861_1235 122
195 3300049580 Ga0501046_0134094 Ga0501046_0134094_432_806 122
196 3300049583 Ga0501067_0515545 Ga0501067_0515545_236_604 122
197 3300049585 Ga0501069_0055571 Ga0501069_0055571_1215_1589 122
198 3300049586 Ga0501070_0000414 Ga0501070_0000414_16583_16957 122
199 3300049587 Ga0501071_0437178 Ga0501071_0437178_184_558 122
200 3300049588 Ga0501072_0069490 Ga0501072_0069490_260_634 122
201 3300049589 Ga0501073_0055157 Ga0501073_0055157_897_1271 122
202 3300049593 Ga0501077_0067017 Ga0501077_0067017_585_959 122
203 3300049742 Ga0501080_0000261 Ga0501080_0000261_2293_2667 122
204 3300049744 Ga0501083_0089265 Ga0501083_0089265_1611_1985 122
205 3300049824 Ga0501045_1402405 Ga0501045_1402405_58_432 122
206 3300050492 nmdc:mga0yw44_484035_c1 nmdc:mga0yw44_484035_c1_374_748 122
207 3300053087 Ga0500643_000092 Ga0500643_000092_92414_92782 122
208 3300053093 Ga0500651_0000505 Ga0500651_0000505_6816_7187 122
209 3300053104 Ga0500556_0000007 Ga0500556_0000007_54358_54726 122
210 3300053136 Ga0500559_0160384 Ga0500559_0160384_325_696 122
211 3300053139 Ga0500568_0000008 Ga0500568_0000008_262038_262409 122
212 3300053139 Ga0500568_0000009 Ga0500568_0000009_237973_238341 122
213 3300053139 Ga0500568_0015649 Ga0500568_0015649_2383_2754 122
214 3300053146 Ga0500588_0220700 Ga0500588_0220700_81_452 122
215 3300053148 Ga0500590_031252 Ga0500590_031252_1920_2291 122
216 3300053153 Ga0500616_0000151 Ga0500616_0000151_62919_63290 122
217 3300053155 Ga0500620_000180 Ga0500620_000180_6418_6789 122
218 3300054114 Ga0501084_0331581 Ga0501084_0331581_551_925 122
219 3300002772 JGI25164J39214_1000715 JGI25164J39214_10007152 123
220 3300003214 JGI25165J46597_1000004 JGI25165J46597_1000004282 123
221 3300005288 Ga0065714_10266707 Ga0065714_102667071 123
222 3300005328 Ga0070676_10421475 Ga0070676_104214752 123
223 3300005334 Ga0068869_100078814 Ga0068869_1000788142 123
224 3300005347 Ga0070668_100541951 Ga0070668_1005419512 123
225 3300005437 Ga0070710_10044935 Ga0070710_100449353 123
226 3300005456 Ga0070678_100106261 Ga0070678_1001062613 123
227 3300005543 Ga0070672_100919809 Ga0070672_1009198092 123
228 3300005548 Ga0070665_101035576 Ga0070665_1010355762 123
229 3300006038 Ga0075365_10046743 Ga0075365_100467432 123
230 3300009036 Ga0105244_10355396 Ga0105244_103553961 123
231 3300009094 Ga0111539_10527527 Ga0111539_105275272 123
232 3300009148 Ga0105243_10336378 Ga0105243_103363781 123
233 3300009553 Ga0105249_10185366 Ga0105249_101853662 123
234 3300011119 Ga0105246_10088391 Ga0105246_100883912 123
235 3300013102 Ga0157371_10004593 Ga0157371_100045932 123
236 3300013104 Ga0157370_11650293 Ga0157370_116502932 123
237 3300013105 Ga0157369_12453825 Ga0157369_124538252 123
238 3300013306 Ga0163162_10884051 Ga0163162_108840512 123
239 3300013306 Ga0163162_13137563 Ga0163162_131375632 123
240 3300013308 Ga0157375_10719830 Ga0157375_107198302 123
241 3300014326 Ga0157380_10196816 Ga0157380_101968162 123
242 3300017792 Ga0163161_10199355 Ga0163161_101993552 123
243 3300025230 Ga0209563_120257 Ga0209563_1202572 123
244 3300025231 Ga0207427_100010 Ga0207427_100010299 123
245 3300025233 Ga0209437_100550 Ga0209437_10055015 123
246 3300025261 Ga0209233_1000001 Ga0209233_10000011650 123
247 3300025898 Ga0207692_10171072 Ga0207692_101710722 123
248 3300025901 Ga0207688_10276059 Ga0207688_102760592 123
249 3300025908 Ga0207643_10100200 Ga0207643_101002002 123
250 3300025909 Ga0207705_10161073 Ga0207705_101610732 123
251 3300025925 Ga0207650_10500551 Ga0207650_105005511 123
252 3300025926 Ga0207659_10414807 Ga0207659_104148072 123
253 3300025935 Ga0207709_10072605 Ga0207709_100726051 123
254 3300025940 Ga0207691_10582229 Ga0207691_105822292 123
255 3300025942 Ga0207689_10199533 Ga0207689_101995332 123
256 3300025961 Ga0207712_10129247 Ga0207712_101292472 123
257 3300025972 Ga0207668_11736157 Ga0207668_117361571 123
258 3300026067 Ga0207678_10392612 Ga0207678_103926122 123
259 3300026121 Ga0207683_10133880 Ga0207683_101338802 123
260 3300028379 Ga0268266_12140025 Ga0268266_121400251 123
261 3300031548 Ga0307408_100916667 Ga0307408_1009166672 123
262 3300031548 Ga0307408_101348693 Ga0307408_1013486932 123
263 3300031649 Ga0307514_10002865 Ga0307514_1000286514 123
264 3300031824 Ga0307413_10110326 Ga0307413_101103262 123
265 3300031852 Ga0307410_10142339 Ga0307410_101423392 123
266 3300031852 Ga0307410_11590913 Ga0307410_115909131 123
267 3300031901 Ga0307406_10236304 Ga0307406_102363042 123
268 3300031901 Ga0307406_11302768 Ga0307406_113027682 123
269 3300031995 Ga0307409_100132495 Ga0307409_1001324952 123
270 3300031995 Ga0307409_100468358 Ga0307409_1004683582 123
271 3300032002 Ga0307416_100763892 Ga0307416_1007638922 123
272 3300032002 Ga0307416_100948384 Ga0307416_1009483842 123
273 3300032004 Ga0307414_11419811 Ga0307414_114198112 123
274 3300032126 Ga0307415_100146207 Ga0307415_1001462072 123
275 3300032126 Ga0307415_100756577 Ga0307415_1007565772 123
276 3300041411 Ga0439466_0250240 Ga0439466_0250240_38_409 123
277 3300041413 Ga0439465_0052049 Ga0439465_0052049_772_1143 123
278 3300041451 Ga0451791_0153954 Ga0451791_0153954_55_426 123
279 3300041451 Ga0451791_0415820 Ga0451791_0415820_187_558 123
280 3300041451 Ga0451791_1445672 Ga0451791_1445672_235_606 123
281 3300041452 Ga0451793_0905247 Ga0451793_0905247_347_718 123
282 3300041452 Ga0451793_1909176 Ga0451793_1909176_424_795 123
283 3300041462 Ga0451806_196865 Ga0451806_196865_318_689 123
284 3300041462 Ga0451806_292452 Ga0451806_292452_602_973 123
285 3300041486 Ga0451807_2657271 Ga0451807_2657271_378_752 123
286 3300041496 Ga0451839_1188536 Ga0451839_1188536_35_418 123
287 3300042184 Ga0450908_107830 Ga0450908_107830_22_393 123
288 3300046460 Ga0495638_0137910 Ga0495638_0137910_865_1236 123
289 3300046660 Ga0495625_0131026 Ga0495625_0131026_771_1160 123
290 3300047320 Ga0495672_0009811 Ga0495672_0009811_2434_2805 123
291 3300047469 Ga0495673_0095992 Ga0495673_0095992_319_690 123
292 3300048903 Ga0496100_0269126 Ga0496100_0269126_309_680 123
293 3300048904 Ga0496101_0314584 Ga0496101_0314584_484_855 123
294 3300048905 Ga0496102_0064186 Ga0496102_0064186_1660_2031 123
295 3300048905 Ga0496102_0233434 Ga0496102_0233434_462_833 123
296 3300048906 Ga0496103_0121635 Ga0496103_0121635_258_629 123
297 3300048906 Ga0496103_0405861 Ga0496103_0405861_479_850 123
298 3300048907 Ga0496104_0088646 Ga0496104_0088646_696_1067 123
299 3300048907 Ga0496104_0212693 Ga0496104_0212693_1371_1742 123
300 3300048908 Ga0496105_0016403 Ga0496105_0016403_5493_5864 123
301 3300048910 Ga0496107_1176176 Ga0496107_1176176_11_382 123
302 3300048911 Ga0496108_0877127 Ga0496108_0877127_211_582 123
303 3300048912 Ga0496109_0388749 Ga0496109_0388749_317_688 123
304 3300048916 Ga0496113_0162867 Ga0496113_0162867_685_1056 123
305 3300048917 Ga0496114_0228734 Ga0496114_0228734_12_383 123
306 3300048917 Ga0496114_1734956 Ga0496114_1734956_48_419 123
307 3300048918 Ga0496115_0021594 Ga0496115_0021594_814_1185 123
308 3300048918 Ga0496115_0034419 Ga0496115_0034419_195_566 123
309 3300048918 Ga0496115_0058536 Ga0496115_0058536_893_1264 123
310 3300048920 Ga0496117_0000120 Ga0496117_0000120_158176_158547 123
311 3300048920 Ga0496117_0027383 Ga0496117_0027383_133_504 123
312 3300048921 Ga0496118_0015499 Ga0496118_0015499_2145_2516 123
313 3300048925 Ga0496122_0005732 Ga0496122_0005732_8451_8822 123
314 3300048925 Ga0496122_0024765 Ga0496122_0024765_848_1219 123
315 3300048925 Ga0496122_0405329 Ga0496122_0405329_152_535 123
316 3300048926 Ga0496123_0000500 Ga0496123_0000500_2901_3272 123
317 3300048927 Ga0496124_0050333 Ga0496124_0050333_475_858 123
318 3300048928 Ga0496125_0064529 Ga0496125_0064529_2122_2499 123
319 3300048928 Ga0496125_0254594 Ga0496125_0254594_678_1073 123
320 3300048929 Ga0496126_0002482 Ga0496126_0002482_16682_17053 123
321 3300048929 Ga0496126_0111620 Ga0496126_0111620_342_713 123
322 3300048929 Ga0496126_0221903 Ga0496126_0221903_188_559 123
323 3300049128 Ga0501308_058947 Ga0501308_058947_89_460 123
324 3300049531 Ga0501315_057151 Ga0501315_057151_31_402 123
325 3300049568 Ga0501031_0019934 Ga0501031_0019934_3985_4356 123
326 3300049569 Ga0501032_0003977 Ga0501032_0003977_9576_9947 123
327 3300049571 Ga0501034_0002709 Ga0501034_0002709_9803_10174 123
328 3300049571 Ga0501034_0033099 Ga0501034_0033099_2115_2522 123
329 3300049572 Ga0501036_0001002 Ga0501036_0001002_12128_12499 123
330 3300049573 Ga0501037_0001216 Ga0501037_0001216_6489_6860 123
331 3300049574 Ga0501038_0000560 Ga0501038_0000560_12156_12527 123
332 3300049575 Ga0501039_0004184 Ga0501039_0004184_2521_2892 123
333 3300049579 Ga0501043_0003802 Ga0501043_0003802_42_413 123
334 3300049580 Ga0501046_0000916 Ga0501046_0000916_28401_28772 123
335 3300049580 Ga0501046_0067186 Ga0501046_0067186_2302_2673 123
336 3300049580 Ga0501046_0231109 Ga0501046_0231109_854_1225 123
337 3300049581 Ga0501047_0001949 Ga0501047_0001949_5804_6175 123
338 3300049582 Ga0501048_1271426 Ga0501048_1271426_117_488 123
339 3300049584 Ga0501068_0022727 Ga0501068_0022727_1952_2323 123
340 3300049586 Ga0501070_0013991 Ga0501070_0013991_4089_4460 123
341 3300049586 Ga0501070_0122635 Ga0501070_0122635_100_471 123
342 3300049587 Ga0501071_0001239 Ga0501071_0001239_8426_8833 123
343 3300049589 Ga0501073_0101084 Ga0501073_0101084_580_987 123
344 3300049590 Ga0501074_0175333 Ga0501074_0175333_67_474 123
345 3300049661 Ga0501217_197726 Ga0501217_197726_116_487 123
346 3300049742 Ga0501080_1822751 Ga0501080_1822751_41_448 123
347 3300049744 Ga0501083_0273365 Ga0501083_0273365_251_658 123
348 3300049763 Ga0501266_054214 Ga0501266_054214_179_550 123
349 3300049822 Ga0501035_0004789 Ga0501035_0004789_63_434 123
350 3300049823 Ga0501044_0002815 Ga0501044_0002815_9780_10151 123
351 3300049823 Ga0501044_0219680 Ga0501044_0219680_1321_1692 123
352 3300049824 Ga0501045_0007075 Ga0501045_0007075_6254_6625 123
353 3300053080 Ga0500635_0000039 Ga0500635_0000039_14017_14388 123
354 3300053098 Ga0500650_0001108 Ga0500650_0001108_6437_6808 123
355 3300053136 Ga0500559_0249188 Ga0500559_0249188_147_518 123
356 3300053142 Ga0500577_0012336 Ga0500577_0012336_2077_2448 123
357 3300053153 Ga0500616_0000058 Ga0500616_0000058_198078_198449 123
358 3300053730 Ga0500645_022225 Ga0500645_022225_766_1137 123
359 3300054114 Ga0501084_0580587 Ga0501084_0580587_282_689 123
360 3300001979 JGI24740J21852_10040512 JGI24740J21852_100405122 124
361 3300001990 JGI24737J22298_10035052 JGI24737J22298_100350522 124
362 3300002067 JGI24735J21928_10000532 JGI24735J21928_100005322 124
363 3300003578 Ga0006562J51391_1021236 Ga0006562J51391_10212368 124
364 3300003578 Ga0006562J51391_1021237 Ga0006562J51391_10212372 124
365 3300003752 Ga0055539_1000005 Ga0055539_1000005147 124
366 3300003756 Ga0055533_1000001 Ga0055533_10000011216 124
367 3300003758 Ga0055532_1006167 Ga0055532_10061672 124
368 3300003759 Ga0055525_1000448 Ga0055525_10004486 124
369 3300003759 Ga0055525_1002883 Ga0055525_10028832 124
370 3300003760 Ga0055527_1000001 Ga0055527_1000001702 124
371 3300003763 Ga0055529_1000019 Ga0055529_1000019208 124
372 3300003763 Ga0055529_1016728 Ga0055529_10167282 124
373 3300003841 Ga0055541_1002712 Ga0055541_10027123 124
374 3300005327 Ga0070658_11270332 Ga0070658_112703322 124
375 3300005614 Ga0068856_102234100 Ga0068856_1022341001 124
376 3300006186 Ga0075369_10376458 Ga0075369_103764582 124
377 3300009098 Ga0105245_12437327 Ga0105245_124373272 124
378 3300013105 Ga0157369_10071225 Ga0157369_100712251 124
379 3300013105 Ga0157369_10241799 Ga0157369_102417992 124
380 3300013105 Ga0157369_11510659 Ga0157369_115106592 124
381 3300013306 Ga0163162_10429800 Ga0163162_104298002 124
382 3300013307 Ga0157372_10353026 Ga0157372_103530262 124
383 3300020069 Ga0197907_10877910 Ga0197907_108779103 124
384 3300020080 Ga0206350_10030166 Ga0206350_100301662 124
385 3300020082 Ga0206353_11026904 Ga0206353_110269042 124
386 3300022467 Ga0224712_10160219 Ga0224712_101602191 124
387 3300025225 Ga0209566_100105 Ga0209566_100105107 124
388 3300025226 Ga0209674_100001 Ga0209674_1000011216 124
389 3300025228 Ga0209672_100006 Ga0209672_100006273 124
390 3300025229 Ga0209147_103179 Ga0209147_1031792 124
391 3300025230 Ga0209563_100001 Ga0209563_1000011216 124
392 3300025230 Ga0209563_100404 Ga0209563_1004042 124
393 3300025253 Ga0209677_100001 Ga0209677_1000011216 124
394 3300025253 Ga0209677_101020 Ga0209677_10102014 124
395 3300025254 Ga0209148_1000015 Ga0209148_1000015117 124
396 3300025272 Ga0209455_1000013 Ga0209455_1000013117 124
397 3300025272 Ga0209455_1000938 Ga0209455_100093813 124
398 3300025904 Ga0207647_10141773 Ga0207647_101417732 124
399 3300025904 Ga0207647_10320944 Ga0207647_103209442 124
400 3300025909 Ga0207705_11051340 Ga0207705_110513402 124
401 3300025929 Ga0207664_10534914 Ga0207664_105349142 124
402 3300026067 Ga0207678_10250870 Ga0207678_102508702 124
403 3300028381 Ga0268264_11738435 Ga0268264_117384351 124
404 3300031731 Ga0307405_10677754 Ga0307405_106777542 124
405 3300037312 Ga0395899_0011794 Ga0395899_0011794_538_912 124
406 3300037312 Ga0395899_0381605 Ga0395899_0381605_510_884 124
407 3300037418 Ga0395900_0006021 Ga0395900_0006021_1681_2055 124
408 3300037466 Ga0395898_0000015 Ga0395898_0000015_266066_266440 124
409 3300041511 Ga0451855_1825245 Ga0451855_1825245_132_506 124
410 3300044658 Ga0466972_0046782 Ga0466972_0046782_946_1326 124
411 3300044658 Ga0466972_0050827 Ga0466972_0050827_507_881 124
412 3300044658 Ga0466972_0106687 Ga0466972_0106687_63_437 124
413 3300044658 Ga0466972_0279237 Ga0466972_0279237_356_730 124
414 3300044683 Ga0466965_0075867 Ga0466965_0075867_50_424 124
415 3300044683 Ga0466965_0312553 Ga0466965_0312553_105_479 124
416 3300044693 Ga0466961_0070342 Ga0466961_0070342_1813_2187 124
417 3300044735 Ga0466968_0050511 Ga0466968_0050511_1198_1572 124
418 3300044765 Ga0466970_0478684 Ga0466970_0478684_294_668 124
419 3300044765 Ga0466970_0804860 Ga0466970_0804860_49_423 124
420 3300044842 Ga0466957_0011563 Ga0466957_0011563_80_454 124
421 3300044842 Ga0466957_0070403 Ga0466957_0070403_16_390 124
422 3300044901 Ga0466960_0070131 Ga0466960_0070131_1043_1417 124
423 3300045049 Ga0466959_0035554 Ga0466959_0035554_2381_2755 124
424 3300045836 Ga0466958_0034963 Ga0466958_0034963_35_409 124
425 3300046507 Ga0495606_0094693 Ga0495606_0094693_325_699 124
426 3300048903 Ga0496100_0050922 Ga0496100_0050922_593_967 124
427 3300048904 Ga0496101_0014615 Ga0496101_0014615_602_976 124
428 3300048905 Ga0496102_0033073 Ga0496102_0033073_2268_2642 124
429 3300048907 Ga0496104_0104968 Ga0496104_0104968_714_1088 124
430 3300048908 Ga0496105_0012241 Ga0496105_0012241_4160_4534 124
431 3300048913 Ga0496110_0647701 Ga0496110_0647701_434_808 124
432 3300048917 Ga0496114_0100567 Ga0496114_0100567_1490_1864 124
433 3300048918 Ga0496115_0150980 Ga0496115_0150980_573_947 124
434 3300048920 Ga0496117_0001880 Ga0496117_0001880_10864_11238 124
435 3300048921 Ga0496118_0093121 Ga0496118_0093121_916_1290 124
436 3300048922 Ga0496119_0068606 Ga0496119_0068606_564_938 124
437 3300048923 Ga0496120_0077017 Ga0496120_0077017_423_797 124
438 3300048924 Ga0496121_0195769 Ga0496121_0195769_264_638 124
439 3300048925 Ga0496122_0075280 Ga0496122_0075280_1009_1383 124
440 3300048925 Ga0496122_0126166 Ga0496122_0126166_184_558 124
441 3300048929 Ga0496126_0111153 Ga0496126_0111153_1735_2109 124
442 3300049586 Ga0501070_0003336 Ga0501070_0003336_7323_7697 124
443 3300061719 Ga0466962_0134432 Ga0466962_0134432_682_1056 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

7

135

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9654 7 120
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9646 5 123
3mxu-assembly1.cif.gz_A crystal structure of glycine cleavage system protein h from bartonella henselae 0.9646 6 107
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9626 5 123
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9616 7 124
ID Description Score Start End Superfamily
af_Q4E4F5_6_138_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.982 5 121 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.971 7 121 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9654 7 120 2.40.50.100
3mxuA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9646 6 107 2.40.50.100
af_Q5AKX1_36_173_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9598 7 123 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A1B1BHB9-F1-model_v4 Glycine cleavage system H protein 0.9935 1 124 GO:0005829
GO:0005960
GO:0019464
AF-Q38E17-F1-model_v4 Glycine cleavage system H protein 0.9875 7 121 GO:0005739
GO:0005960
GO:0006546
GO:0010608
GO:0016740
GO:0019464
GO:0020023
AF-A0A2U1ZS75-F1-model_v4 Glycine cleavage system H protein 0.9867 5 123 GO:0005829
GO:0005960
GO:0019464
AF-A0A841W7Z0-F1-model_v4 Glycine cleavage system H protein 0.9864 5 123 GO:0005737
GO:0005960
GO:0016020
GO:0019464
AF-A0A3B8UCB1-F1-model_v4 Glycine cleavage system H protein 0.9862 9 106 GO:0005737
GO:0005960
GO:0019464

Feature Viewer

pLDDT pTM Quality
96.41 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map