F445068

General Info

Members Datasets Scaffolds Average Seq Length
443 191 440 323

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10082439|Ga0105245_100824392
Length 345
Sequence VTIPAAAGGCAEHFELVDHFHPSAEPPMNCRNLVLGLLYAAVATGAAFAQAPIWPTKPVKIVIAYPPGGSTDIAGRLLAERLTRTLGQQVVVENRGGAGGTIGALSVVRAEPDGYTLLLAASPEVSIAPITMKAMAYDPVKLVGVVPFFLVANPDFPPNTLAELIAWARANPGKANYSSYGNNTSNHLVGELFKATAGIETVHIPYKGSGPSITDLMGGRVQYTFDTPAATLGHVRAGKLKAIAVATPQRIANAPTVPTMAEAGLPGFVGGTWFGLLAPAKTPKPIIDKIHADVVAALNSPELRKAFEDKDIIPGGNSADEFGRFIQTEVAKWRDLAAKVGIVPE

Samples

Sample ID Description Type Environment
1 2738541307 Variovorax sp. GV008 Isolate Unclassified
2 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
3 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
165 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
188 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
189 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
190 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
191 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.22
Nodule 0
Rhizoplane 3.39
Rhizosphere 87.81
Stem 0
Stem Tuber 0
Unclassified 1.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1009116 3300002774 Bacteria 1909
2 JGI25159J45721_1005587 3300002987 Bacteria 3926
3 JGI25151J46595_10007512 3300003187 Bacteria 5331
4 Ga0055526_1000892 3300003771 Bacteria 22183
5 Ga0055537_1000339 3300003773 Bacteria 31974
6 Ga0055524_1000299 3300003775 Bacteria 47507
7 Ga0055534_1002830 3300003784 Bacteria 5788
8 Ga0055528_1001750 3300003790 Bacteria 12527
9 Ga0055530_10000935 3300003791 Bacteria 23909
10 Ga0055540_1000673 3300003792 Bacteria 23733
11 Ga0055531_10002023 3300003794 Bacteria 14036
12 Ga0065712_10130280 3300005290 Bacteria 1558
13 Ga0070676_10037794 3300005328 Bacteria 2785
14 Ga0070676_10134132 3300005328 Bacteria 1569
15 Ga0070683_100311262 3300005329 Bacteria 1499
16 Ga0070690_100004576 3300005330 Bacteria 7687
17 Ga0070690_100253187 3300005330 Bacteria 1246
18 Ga0070670_100001412 3300005331 Bacteria 19300
19 Ga0070670_100008082 3300005331 Bacteria 8946
20 Ga0070670_100010515 3300005331 Bacteria 7900
21 Ga0070670_100375517 3300005331 Bacteria 1252
22 Ga0070677_10022735 3300005333 Bacteria 2313
23 Ga0070677_10091126 3300005333 Bacteria 1326
24 Ga0068869_100000344 3300005334 Bacteria 24865
25 Ga0068869_100000671 3300005334 Bacteria 19373
26 Ga0068869_100162110 3300005334 Bacteria 1741
27 Ga0070666_10011012 3300005335 Bacteria 5668
28 Ga0070666_10119598 3300005335 Bacteria 1826
29 Ga0070682_100095291 3300005337 Bacteria 1954
30 Ga0068868_100000700 3300005338 Bacteria 22507
31 Ga0068868_100048823 3300005338 Bacteria 3321
32 Ga0068868_100129257 3300005338 Bacteria 2066
33 Ga0070689_100454799 3300005340 Bacteria 1090
34 Ga0070661_100157736 3300005344 Bacteria 1717
35 Ga0070668_100000854 3300005347 Bacteria 21147
36 Ga0070668_100002565 3300005347 Bacteria 13357
37 Ga0070668_100011458 3300005347 Bacteria 6602
38 Ga0070668_100032876 3300005347 Bacteria 3947
39 Ga0070669_100062860 3300005353 Bacteria 2731
40 Ga0070669_100084933 3300005353 Bacteria 2363
41 Ga0070669_100367834 3300005353 Bacteria 1170
42 Ga0070669_100461731 3300005353 Bacteria 1048
43 Ga0070675_100010541 3300005354 Bacteria 7221
44 Ga0070675_100030200 3300005354 Bacteria 4374
45 Ga0070675_100032518 3300005354 Bacteria 4223
46 Ga0070675_100116617 3300005354 Bacteria 2265
47 Ga0070671_100002070 3300005355 Bacteria 15471
48 Ga0070671_100003604 3300005355 Bacteria 12112
49 Ga0070671_100060520 3300005355 Bacteria 3153
50 Ga0070671_100154499 3300005355 Bacteria 1938
51 Ga0070671_100223845 3300005355 Bacteria 1596
52 Ga0070674_100002602 3300005356 Bacteria 9987
53 Ga0070674_100015546 3300005356 Bacteria 4753
54 Ga0070674_100056208 3300005356 Bacteria 2728
55 Ga0070674_100093704 3300005356 Bacteria 2173
56 Ga0070674_100316806 3300005356 Bacteria 1249
57 Ga0070673_100006901 3300005364 Bacteria 7426
58 Ga0070673_100008546 3300005364 Bacteria 6812
59 Ga0070673_100009326 3300005364 Bacteria 6586
60 Ga0070673_100025046 3300005364 Bacteria 4385
61 Ga0070688_100055732 3300005365 Bacteria 2480
62 Ga0070688_100139210 3300005365 Bacteria 1646
63 Ga0070688_100205176 3300005365 Bacteria 1381
64 Ga0070667_100002668 3300005367 Bacteria 15447
65 Ga0070667_100009725 3300005367 Bacteria 7971
66 Ga0070667_100021099 3300005367 Bacteria 5411
67 Ga0070667_100038499 3300005367 Bacteria 4009
68 Ga0070667_100044495 3300005367 Bacteria 3729
69 Ga0070667_100073464 3300005367 Bacteria 2916
70 Ga0070667_100076725 3300005367 Bacteria 2853
71 Ga0070667_100109964 3300005367 Bacteria 2389
72 Ga0070667_100200081 3300005367 Bacteria 1772
73 Ga0070709_10018069 3300005434 Bacteria 4054
74 Ga0070701_10117616 3300005438 Bacteria 1493
75 Ga0070705_100087860 3300005440 Bacteria 1928
76 Ga0070705_100124754 3300005440 Bacteria 1669
77 Ga0070700_100031085 3300005441 Bacteria 3196
78 Ga0070663_100003768 3300005455 Bacteria 8803
79 Ga0070663_100006830 3300005455 Bacteria 6902
80 Ga0070663_100376512 3300005455 Bacteria 1155
81 Ga0070678_100031700 3300005456 Bacteria 3651
82 Ga0070678_100043992 3300005456 Bacteria 3185
83 Ga0070678_100160637 3300005456 Bacteria 1820
84 Ga0070678_100188686 3300005456 Bacteria 1693
85 Ga0070662_100058217 3300005457 Bacteria 2811
86 Ga0068867_100001610 3300005459 Bacteria 15686
87 Ga0068867_100004344 3300005459 Bacteria 9977
88 Ga0068867_100072655 3300005459 Bacteria 2575
89 Ga0068867_100101271 3300005459 Bacteria 2200
90 Ga0068867_100118389 3300005459 Bacteria 2043
91 Ga0070706_100595874 3300005467 Bacteria 1027
92 Ga0070684_100054541 3300005535 Bacteria 3483
93 Ga0070672_100003292 3300005543 Bacteria 10458
94 Ga0070672_100022600 3300005543 Bacteria 4623
95 Ga0070672_100032076 3300005543 Bacteria 3962
96 Ga0070672_100033555 3300005543 Bacteria 3888
97 Ga0070672_100039569 3300005543 Bacteria 3612
98 Ga0070672_100115965 3300005543 Bacteria 2188
99 Ga0070672_100143243 3300005543 Bacteria 1973
100 Ga0070695_100180769 3300005545 Bacteria 1494
101 Ga0070665_100012333 3300005548 Bacteria 8613
102 Ga0070665_100034936 3300005548 Bacteria 5057
103 Ga0070665_100061136 3300005548 Bacteria 3776
104 Ga0070665_100064619 3300005548 Bacteria 3670
105 Ga0070665_100117495 3300005548 Bacteria 2662
106 Ga0068855_100065243 3300005563 Bacteria 4245
107 Ga0068855_100067520 3300005563 Bacteria 4165
108 Ga0068855_100125863 3300005563 Bacteria 2930
109 Ga0070664_100190637 3300005564 Bacteria 1826
110 Ga0068857_100003933 3300005577 Bacteria 12506
111 Ga0068854_100073342 3300005578 Bacteria 2508
112 Ga0068856_100023607 3300005614 Bacteria 5980
113 Ga0068852_100004079 3300005616 Bacteria 10275
114 Ga0068852_100138926 3300005616 Bacteria 2246
115 Ga0068859_100001054 3300005617 Bacteria 28258
116 Ga0068859_100002546 3300005617 Bacteria 18510
117 Ga0068864_100000944 3300005618 Bacteria 24300
118 Ga0068864_100002435 3300005618 Bacteria 15390
119 Ga0068864_100002924 3300005618 Bacteria 14129
120 Ga0068864_100036066 3300005618 Bacteria 4214
121 Ga0068864_100094774 3300005618 Bacteria 2639
122 Ga0068864_100186793 3300005618 Bacteria 1897
123 Ga0068864_100284559 3300005618 Bacteria 1544
124 Ga0068861_100002077 3300005719 Bacteria 12987
125 Ga0068861_100017696 3300005719 Bacteria 5065
126 Ga0068861_100090494 3300005719 Bacteria 2414
127 Ga0068851_10000288 3300005834 Bacteria 23147
128 Ga0068851_10006549 3300005834 Bacteria 5321
129 Ga0068870_10200523 3300005840 Bacteria 1210
130 Ga0068863_100001070 3300005841 Bacteria 27358
131 Ga0068863_100026772 3300005841 Bacteria 5499
132 Ga0068863_100069767 3300005841 Bacteria 3323
133 Ga0068863_100072383 3300005841 Bacteria 3261
134 Ga0068863_100114202 3300005841 Bacteria 2573
135 Ga0068863_100288587 3300005841 Bacteria 1590
136 Ga0068858_100000492 3300005842 Bacteria 41287
137 Ga0068858_100017247 3300005842 Bacteria 6773
138 Ga0068858_100030528 3300005842 Bacteria 5005
139 Ga0068858_100052349 3300005842 Bacteria 3777
140 Ga0068858_100065961 3300005842 Bacteria 3350
141 Ga0068860_100000703 3300005843 Bacteria 38386
142 Ga0068860_100010827 3300005843 Bacteria 9002
143 Ga0068860_100188569 3300005843 Bacteria 1995
144 Ga0068860_100241249 3300005843 Bacteria 1758
145 Ga0068860_100298985 3300005843 Bacteria 1576
146 Ga0068860_100340271 3300005843 Bacteria 1475
147 Ga0068862_100023689 3300005844 Bacteria 5146
148 Ga0068862_100046586 3300005844 Bacteria 3699
149 Ga0068862_100115733 3300005844 Bacteria 2358
150 Ga0068862_100147646 3300005844 Bacteria 2091
151 Ga0081455_10220145 3300005937 Bacteria 1407
152 Ga0081455_10220623 3300005937 Bacteria 1405
153 Ga0081538_10033029 3300005981 Bacteria 3453
154 Ga0081540_1002504 3300005983 Bacteria 14939
155 Ga0081540_1014085 3300005983 Bacteria 5151
156 Ga0075364_10000857 3300006051 Bacteria 16024
157 Ga0097621_100025333 3300006237 Bacteria 4640
158 Ga0097621_100129387 3300006237 Bacteria 2147
159 Ga0097621_100149499 3300006237 Bacteria 2002
160 Ga0097621_100280363 3300006237 Bacteria 1467
161 Ga0068871_100003300 3300006358 Bacteria 11071
162 Ga0068871_100017285 3300006358 Bacteria 5454
163 Ga0068871_100287198 3300006358 Bacteria 1440
164 Ga0075431_100052944 3300006847 Bacteria 4185
165 Ga0075431_100236281 3300006847 Bacteria 1860
166 Ga0075431_100420535 3300006847 Bacteria 1336
167 Ga0075429_100045618 3300006880 Bacteria 3813
168 Ga0075429_100140734 3300006880 Bacteria 2112
169 Ga0068865_100178765 3300006881 Bacteria 1632
170 Ga0097620_100001054 3300006931 Bacteria 28258
171 Ga0097620_100002546 3300006931 Bacteria 18510
172 Ga0105240_10257092 3300009093 Bacteria 2017
173 Ga0111539_10049377 3300009094 Bacteria 5018
174 Ga0105245_10082439 3300009098 Bacteria 2942
175 Ga0105245_10155037 3300009098 Bacteria 2169
176 Ga0105247_10011407 3300009101 Bacteria 5360
177 Ga0105248_10001649 3300009177 Bacteria 24825
178 Ga0105248_10012692 3300009177 Bacteria 9298
179 Ga0105248_10032204 3300009177 Bacteria 5860
180 Ga0105248_10049194 3300009177 Bacteria 4728
181 Ga0105248_10092408 3300009177 Bacteria 3408
182 Ga0105248_10122110 3300009177 Bacteria 2938
183 Ga0105248_10234386 3300009177 Bacteria 2066
184 Ga0105248_10325459 3300009177 Bacteria 1731
185 Ga0157370_10264191 3300013104 Bacteria 1590
186 Ga0157369_10045205 3300013105 Bacteria 4791
187 Ga0157378_10005225 3300013297 Bacteria 11399
188 Ga0157378_10076849 3300013297 Bacteria 3009
189 Ga0157378_10132035 3300013297 Bacteria 2313
190 Ga0163162_10129174 3300013306 Bacteria 2635
191 Ga0163162_10163713 3300013306 Bacteria 2347
192 Ga0163162_10376859 3300013306 Bacteria 1552
193 Ga0163162_10388664 3300013306 Bacteria 1528
194 Ga0157375_10019474 3300013308 Bacteria 6173
195 Ga0157375_10041420 3300013308 Bacteria 4447
196 Ga0157375_10121429 3300013308 Bacteria 2722
197 Ga0157375_10181717 3300013308 Bacteria 2255
198 Ga0157375_10184437 3300013308 Bacteria 2239
199 Ga0157375_10494751 3300013308 Bacteria 1387
200 Ga0163163_10001402 3300014325 Bacteria 20329
201 Ga0163163_10007360 3300014325 Bacteria 9711
202 Ga0163163_10018636 3300014325 Bacteria 6502
203 Ga0163163_10028713 3300014325 Bacteria 5346
204 Ga0163163_10061042 3300014325 Bacteria 3735
205 Ga0163163_10159065 3300014325 Bacteria 2304
206 Ga0163163_10220490 3300014325 Bacteria 1945
207 Ga0157380_10035094 3300014326 Bacteria 3872
208 Ga0157380_10156497 3300014326 Bacteria 1976
209 Ga0157380_10259675 3300014326 Bacteria 1577
210 Ga0157379_10000172 3300014968 Bacteria 48686
211 Ga0157379_10006213 3300014968 Bacteria 10284
212 Ga0157379_10032193 3300014968 Bacteria 4673
213 Ga0157379_10052662 3300014968 Bacteria 3635
214 Ga0157376_10034981 3300014969 Bacteria 4060
215 Ga0157376_10072085 3300014969 Bacteria 2937
216 Ga0157376_10101758 3300014969 Bacteria 2512
217 Ga0157376_10393541 3300014969 Bacteria 1338
218 Ga0163161_10036754 3300017792 Bacteria 3508
219 Ga0163161_10152863 3300017792 Bacteria 1755
220 Ga0163161_10170957 3300017792 Bacteria 1662
221 Ga0207425_1003769 3300025245 Bacteria 4738
222 Ga0209565_1000016 3300025263 Bacteria 477707
223 Ga0209673_1001852 3300025273 Bacteria 17239
224 Ga0209130_1000917 3300025284 Bacteria 23715
225 Ga0209675_1000401 3300025291 Bacteria 35752
226 Ga0209676_1001372 3300025292 Bacteria 23806
227 Ga0209025_1032501 3300025294 Bacteria 2437
228 Ga0209564_1001584 3300025295 Bacteria 22235
229 Ga0209050_1001553 3300025298 Bacteria 23961
230 Ga0209256_1000001 3300025299 Bacteria 2166974
231 Ga0209256_1020125 3300025299 Bacteria 2096
232 Ga0207426_1002070 3300025302 Bacteria 13922
233 Ga0209051_1001160 3300025303 Bacteria 23961
234 Ga0209257_1001764 3300025304 Bacteria 23961
235 Ga0207697_10000719 3300025315 Bacteria 18847
236 Ga0207656_10034546 3300025321 Bacteria 2112
237 Ga0207682_10000928 3300025893 Bacteria 13592
238 Ga0207682_10049228 3300025893 Bacteria 1739
239 Ga0207682_10078513 3300025893 Bacteria 1410
240 Ga0207680_10068532 3300025903 Bacteria 2189
241 Ga0207680_10080149 3300025903 Bacteria 2050
242 Ga0207680_10095975 3300025903 Bacteria 1896
243 Ga0207699_10073140 3300025906 Bacteria 2102
244 Ga0207645_10007551 3300025907 Bacteria 7670
245 Ga0207645_10021366 3300025907 Bacteria 4221
246 Ga0207645_10029570 3300025907 Bacteria 3531
247 Ga0207645_10041011 3300025907 Bacteria 2964
248 Ga0207643_10012487 3300025908 Bacteria 4591
249 Ga0207643_10051714 3300025908 Bacteria 2332
250 Ga0207705_10167167 3300025909 Bacteria 1655
251 Ga0207693_10242822 3300025915 Bacteria 1414
252 Ga0207681_10005517 3300025923 Bacteria 7771
253 Ga0207681_10018352 3300025923 Bacteria 4408
254 Ga0207681_10065377 3300025923 Bacteria 2514
255 Ga0207681_10197348 3300025923 Bacteria 1543
256 Ga0207650_10001989 3300025925 Bacteria 14337
257 Ga0207650_10003073 3300025925 Bacteria 11497
258 Ga0207650_10031178 3300025925 Bacteria 3847
259 Ga0207650_10049385 3300025925 Bacteria 3106
260 Ga0207650_10066956 3300025925 Bacteria 2694
261 Ga0207659_10008265 3300025926 Bacteria 6451
262 Ga0207659_10026022 3300025926 Unclassified 3942
263 Ga0207659_10059195 3300025926 Bacteria 2753
264 Ga0207659_10114736 3300025926 Bacteria 2054
265 Ga0207659_10270761 3300025926 Bacteria 1385
266 Ga0207687_10116261 3300025927 Bacteria 1993
267 Ga0207687_10264308 3300025927 Bacteria 1373
268 Ga0207644_10000874 3300025931 Bacteria 19009
269 Ga0207644_10018336 3300025931 Bacteria 4733
270 Ga0207644_10178887 3300025931 Bacteria 1661
271 Ga0207709_10302165 3300025935 Bacteria 1190
272 Ga0207670_10066873 3300025936 Bacteria 2471
273 Ga0207669_10026599 3300025937 Bacteria 3150
274 Ga0207669_10049461 3300025937 Bacteria 2506
275 Ga0207669_10061705 3300025937 Bacteria 2305
276 Ga0207704_10217886 3300025938 Bacteria 1410
277 Ga0207691_10000441 3300025940 Bacteria 41237
278 Ga0207691_10007484 3300025940 Bacteria 10510
279 Ga0207691_10023453 3300025940 Bacteria 5809
280 Ga0207691_10048338 3300025940 Bacteria 3901
281 Ga0207691_10054335 3300025940 Bacteria 3654
282 Ga0207691_10060943 3300025940 Bacteria 3428
283 Ga0207691_10198498 3300025940 Bacteria 1747
284 Ga0207711_10044933 3300025941 Bacteria 3773
285 Ga0207711_10071407 3300025941 Bacteria 3012
286 Ga0207711_10108290 3300025941 Bacteria 2468
287 Ga0207711_10117499 3300025941 Bacteria 2372
288 Ga0207711_10123988 3300025941 Bacteria 2309
289 Ga0207711_10412455 3300025941 Bacteria 1256
290 Ga0207689_10000037 3300025942 Bacteria 94807
291 Ga0207689_10000075 3300025942 Bacteria 80691
292 Ga0207689_10001350 3300025942 Bacteria 23557
293 Ga0207689_10014422 3300025942 Bacteria 6722
294 Ga0207689_10071515 3300025942 Bacteria 2849
295 Ga0207679_10520041 3300025945 Bacteria 1064
296 Ga0207667_10046873 3300025949 Bacteria 4577
297 Ga0207667_10172143 3300025949 Bacteria 2225
298 Ga0207651_10001707 3300025960 Bacteria 10140
299 Ga0207651_10005008 3300025960 Bacteria 6755
300 Ga0207651_10046715 3300025960 Bacteria 2914
301 Ga0207651_10055612 3300025960 Bacteria 2719
302 Ga0207651_10383330 3300025960 Bacteria 1192
303 Ga0207668_10000941 3300025972 Bacteria 17535
304 Ga0207668_10011019 3300025972 Bacteria 5482
305 Ga0207668_10013081 3300025972 Bacteria 5100
306 Ga0207668_10021919 3300025972 Bacteria 4080
307 Ga0207668_10027904 3300025972 Bacteria 3684
308 Ga0207668_10157915 3300025972 Bacteria 1763
309 Ga0207640_10130617 3300025981 Bacteria 1815
310 Ga0207640_10289970 3300025981 Bacteria 1290
311 Ga0207658_10005528 3300025986 Bacteria 8663
312 Ga0207658_10007293 3300025986 Bacteria 7541
313 Ga0207658_10030627 3300025986 Bacteria 3812
314 Ga0207658_10044695 3300025986 Bacteria 3226
315 Ga0207658_10073219 3300025986 Bacteria 2600
316 Ga0207658_10140496 3300025986 Bacteria 1953
317 Ga0207677_10027225 3300026023 Bacteria 3597
318 Ga0207677_10097018 3300026023 Bacteria 2158
319 Ga0207677_10131762 3300026023 Bacteria 1899
320 Ga0207677_10242021 3300026023 Bacteria 1460
321 Ga0207703_10000579 3300026035 Bacteria 37369
322 Ga0207703_10002696 3300026035 Bacteria 15229
323 Ga0207703_10019864 3300026035 Bacteria 5251
324 Ga0207639_10003990 3300026041 Bacteria 9964
325 Ga0207678_10001127 3300026067 Bacteria 24482
326 Ga0207678_10021823 3300026067 Bacteria 5616
327 Ga0207678_10246929 3300026067 Bacteria 1528
328 Ga0207708_10004370 3300026075 Bacteria 10413
329 Ga0207708_10026709 3300026075 Bacteria 4370
330 Ga0207641_10005687 3300026088 Bacteria 10613
331 Ga0207641_10007447 3300026088 Bacteria 9105
332 Ga0207641_10016322 3300026088 Bacteria 6080
333 Ga0207641_10055793 3300026088 Bacteria 3355
334 Ga0207641_10117602 3300026088 Bacteria 2367
335 Ga0207641_10131310 3300026088 Bacteria 2249
336 Ga0207641_10192144 3300026088 Bacteria 1877
337 Ga0207648_10001093 3300026089 Bacteria 30397
338 Ga0207648_10001429 3300026089 Bacteria 26298
339 Ga0207648_10006052 3300026089 Bacteria 12065
340 Ga0207648_10025107 3300026089 Bacteria 5313
341 Ga0207676_10002716 3300026095 Bacteria 12597
342 Ga0207676_10008226 3300026095 Bacteria 7422
343 Ga0207676_10015341 3300026095 Bacteria 5522
344 Ga0207676_10036585 3300026095 Bacteria 3736
345 Ga0207676_10146554 3300026095 Bacteria 2028
346 Ga0207676_10243278 3300026095 Bacteria 1615
347 Ga0207674_10003847 3300026116 Bacteria 18296
348 Ga0207674_10031362 3300026116 Bacteria 5585
349 Ga0207675_100008295 3300026118 Bacteria 9786
350 Ga0207675_100023316 3300026118 Bacteria 5756
351 Ga0207675_100029252 3300026118 Bacteria 5133
352 Ga0207675_100058809 3300026118 Bacteria 3587
353 Ga0207683_10000222 3300026121 Bacteria 49960
354 Ga0207683_10008283 3300026121 Bacteria 8892
355 Ga0207683_10021988 3300026121 Bacteria 5472
356 Ga0207683_10141401 3300026121 Bacteria 2169
357 Ga0207683_10154991 3300026121 Bacteria 2069
358 Ga0207698_10001711 3300026142 Bacteria 12789
359 Ga0207698_10060856 3300026142 Bacteria 2938
360 Ga0207698_10408684 3300026142 Bacteria 1299
361 Ga0268266_10019704 3300028379 Bacteria 5748
362 Ga0268266_10057350 3300028379 Bacteria 3351
363 Ga0268266_10084059 3300028379 Bacteria 2779
364 Ga0268266_10100742 3300028379 Bacteria 2545
365 Ga0268266_10350407 3300028379 Bacteria 1387
366 Ga0268265_10002068 3300028380 Bacteria 15673
367 Ga0268265_10042640 3300028380 Bacteria 3368
368 Ga0268265_10072921 3300028380 Bacteria 2679
369 Ga0268265_10126132 3300028380 Bacteria 2118
370 Ga0268264_10000443 3300028381 Bacteria 56934
371 Ga0268264_10000734 3300028381 Bacteria 37485
372 Ga0268264_10018846 3300028381 Bacteria 5643
373 Ga0268264_10157593 3300028381 Bacteria 2042
374 Ga0265337_1000314 3300028556 Bacteria 25836
375 Ga0265325_10000514 3300031241 Bacteria 28015
376 Ga0265325_10128173 3300031241 Bacteria 1217
377 Ga0307513_10169465 3300031456 Bacteria 2063
378 Ga0307408_100005363 3300031548 Bacteria 8591
379 Ga0265314_10038089 3300031711 Bacteria 3477
380 Ga0307405_10013132 3300031731 Bacteria 4410
381 Ga0307413_10175053 3300031824 Bacteria 1523
382 Ga0307410_10005872 3300031852 Bacteria 6555
383 Ga0307406_10187717 3300031901 Bacteria 1510
384 Ga0307407_10024028 3300031903 Bacteria 3188
385 Ga0307409_100052916 3300031995 Bacteria 3116
386 Ga0307416_100014484 3300032002 Bacteria 5409
387 Ga0307414_10047738 3300032004 Bacteria 2949
388 Ga0307414_10335970 3300032004 Bacteria 1291
389 Ga0307411_10002644 3300032005 Bacteria 8025
390 Ga0307415_100003412 3300032126 Bacteria 8083
391 Ga0373925_0120228 3300037068 Bacteria 2039
392 Ga0395899_0003556 3300037312 Bacteria 12338
393 Ga0395899_0006853 3300037312 Bacteria 8826
394 Ga0395900_0011091 3300037418 Bacteria 9211
395 Ga0395900_0018117 3300037418 Bacteria 7186
396 Ga0395898_0016831 3300037466 Bacteria 7468
397 Ga0395905_0009284 3300037471 Bacteria 9620
398 Ga0395905_0066245 3300037471 Bacteria 3382
399 Ga0395901_0017969 3300038443 Bacteria 7217
400 Ga0395901_0027408 3300038443 Bacteria 5854
401 Ga0495627_010509 3300046453 Bacteria 3361
402 Ga0495637_0001026 3300046520 Bacteria 17537
403 Ga0495643_0010218 3300046522 Bacteria 5784
404 Ga0495656_0030643 3300046615 Bacteria 2176
405 Ga0495625_0063317 3300046660 Bacteria 2612
406 Ga0496100_0069314 3300048903 Bacteria 2348
407 Ga0496102_0009776 3300048905 Bacteria 8250
408 Ga0496102_0144561 3300048905 Bacteria 2231
409 Ga0496102_0248741 3300048905 Bacteria 1676
410 Ga0496105_0024286 3300048908 Bacteria 4926
411 Ga0496108_0022172 3300048911 Bacteria 5221
412 Ga0496108_0076673 3300048911 Bacteria 2826
413 Ga0496108_0123091 3300048911 Bacteria 2225
414 Ga0496109_0018296 3300048912 Bacteria 6154
415 Ga0496109_0090665 3300048912 Bacteria 2827
416 Ga0496109_0494456 3300048912 Bacteria 1154
417 Ga0496110_0046652 3300048913 Bacteria 3791
418 Ga0496110_0096216 3300048913 Bacteria 2653
419 Ga0496113_0213968 3300048916 Bacteria 1535
420 Ga0496114_0052657 3300048917 Bacteria 3391
421 Ga0496122_0026206 3300048925 Bacteria 5035
422 Ga0496123_0008443 3300048926 Bacteria 9460
423 Ga0496125_0000706 3300048928 Bacteria 55374
424 Ga0496125_0013742 3300048928 Bacteria 7937
425 Ga0496126_0039291 3300048929 Bacteria 4392
426 Ga0501072_0255961 3300049588 Bacteria 1394
427 nmdc:mga00v17_84040_c1 3300050491 Bacteria 1992
428 nmdc:mga09592_201829_c1 3300050508 Bacteria 1722
429 nmdc:mga09592_282389_c1 3300050508 Bacteria 1440
430 nmdc:mga0qj67_132558_c1 3300050509 Bacteria 2018
431 nmdc:mga0qj67_198968_c1 3300050509 Bacteria 1628
432 nmdc:mga0qj67_249500_c1 3300050509 Bacteria 1440
433 nmdc:mga06r32_139689_c1 3300050510 Bacteria 2398
434 nmdc:mga06r32_161332_c1 3300050510 Bacteria 2224
435 nmdc:mga0rr50_91594_c1 3300050513 Bacteria 2368
436 Ga0500610_0000112 3300053079 Bacteria 24798
437 Ga0500593_001251 3300053117 Bacteria 9179
438 Ga0500607_000040 3300053121 Bacteria 85325
439 Ga0500625_030300 3300053729 Bacteria 2569
440 Ga0500645_000100 3300053730 Bacteria 68299

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025893 Ga0207682_10078513 Ga0207682_100785132 246
2 3300048928 Ga0496125_0000706 Ga0496125_0000706_51001_51948 262
3 3300005367 Ga0070667_100200081 Ga0070667_1002000813 269
4 3300031548 Ga0307408_100005363 Ga0307408_1000053632 269
5 3300031731 Ga0307405_10013132 Ga0307405_100131322 269
6 3300031824 Ga0307413_10175053 Ga0307413_101750532 269
7 3300031852 Ga0307410_10005872 Ga0307410_100058722 269
8 3300031901 Ga0307406_10187717 Ga0307406_101877172 269
9 3300031903 Ga0307407_10024028 Ga0307407_100240282 269
10 3300031995 Ga0307409_100052916 Ga0307409_1000529162 269
11 3300032002 Ga0307416_100014484 Ga0307416_1000144843 269
12 3300032004 Ga0307414_10047738 Ga0307414_100477383 269
13 3300032005 Ga0307411_10002644 Ga0307411_100026443 269
14 3300032126 Ga0307415_100003412 Ga0307415_1000034125 269
15 3300003784 Ga0055534_1002830 Ga0055534_10028303 273
16 3300006847 Ga0075431_100052944 Ga0075431_1000529442 276
17 3300005331 Ga0070670_100010515 Ga0070670_1000105153 277
18 3300005618 Ga0068864_100002435 Ga0068864_1000024355 277
19 3300005841 Ga0068863_100072383 Ga0068863_1000723833 277
20 3300014325 Ga0163163_10028713 Ga0163163_100287134 277
21 3300025925 Ga0207650_10003073 Ga0207650_100030739 277
22 3300026095 Ga0207676_10002716 Ga0207676_100027163 277
23 3300005434 Ga0070709_10018069 Ga0070709_100180692 278
24 3300025906 Ga0207699_10073140 Ga0207699_100731401 278
25 3300025893 Ga0207682_10049228 Ga0207682_100492282 279
26 3300014326 Ga0157380_10259675 Ga0157380_102596752 280
27 3300025299 Ga0209256_1020125 Ga0209256_10201252 280
28 3300031241 Ga0265325_10000514 Ga0265325_1000051424 280
29 3300031241 Ga0265325_10128173 Ga0265325_101281731 280
30 3300031456 Ga0307513_10169465 Ga0307513_101694653 280
31 3300053117 Ga0500593_001251 Ga0500593_001251_7459_8433 280
32 3300005290 Ga0065712_10130280 Ga0065712_101302802 281
33 3300005330 Ga0070690_100004576 Ga0070690_1000045762 281
34 3300005355 Ga0070671_100154499 Ga0070671_1001544993 281
35 3300005365 Ga0070688_100139210 Ga0070688_1001392102 281
36 3300005440 Ga0070705_100124754 Ga0070705_1001247542 281
37 3300005455 Ga0070663_100003768 Ga0070663_1000037681 281
38 3300005459 Ga0068867_100118389 Ga0068867_1001183892 281
39 3300005535 Ga0070684_100054541 Ga0070684_1000545412 281
40 3300005548 Ga0070665_100061136 Ga0070665_1000611362 281
41 3300005578 Ga0068854_100073342 Ga0068854_1000733422 281
42 3300005834 Ga0068851_10006549 Ga0068851_100065493 281
43 3300005840 Ga0068870_10200523 Ga0068870_102005232 281
44 3300005841 Ga0068863_100288587 Ga0068863_1002885872 281
45 3300005842 Ga0068858_100065961 Ga0068858_1000659612 281
46 3300005843 Ga0068860_100298985 Ga0068860_1002989853 281
47 3300005983 Ga0081540_1014085 Ga0081540_10140853 281
48 3300006358 Ga0068871_100287198 Ga0068871_1002871982 281
49 3300014325 Ga0163163_10061042 Ga0163163_100610424 281
50 3300014969 Ga0157376_10101758 Ga0157376_101017582 281
51 3300017792 Ga0163161_10036754 Ga0163161_100367542 281
52 3300025315 Ga0207697_10000719 Ga0207697_100007196 281
53 3300025321 Ga0207656_10034546 Ga0207656_100345463 281
54 3300025907 Ga0207645_10021366 Ga0207645_100213662 281
55 3300025925 Ga0207650_10066956 Ga0207650_100669562 281
56 3300025926 Ga0207659_10008265 Ga0207659_100082655 281
57 3300025941 Ga0207711_10108290 Ga0207711_101082903 281
58 3300025942 Ga0207689_10001350 Ga0207689_1000135014 281
59 3300026023 Ga0207677_10242021 Ga0207677_102420212 281
60 3300026067 Ga0207678_10001127 Ga0207678_100011276 281
61 3300026075 Ga0207708_10004370 Ga0207708_100043703 281
62 3300026088 Ga0207641_10131310 Ga0207641_101313101 281
63 3300026116 Ga0207674_10003847 Ga0207674_100038472 281
64 3300026121 Ga0207683_10008283 Ga0207683_100082832 281
65 3300026142 Ga0207698_10408684 Ga0207698_104086842 281
66 3300028379 Ga0268266_10350407 Ga0268266_103504073 281
67 3300037068 Ga0373925_0120228 Ga0373925_0120228_629_1597 281
68 3300048903 Ga0496100_0069314 Ga0496100_0069314_233_1201 281
69 3300048905 Ga0496102_0248741 Ga0496102_0248741_41_1009 281
70 3300048908 Ga0496105_0024286 Ga0496105_0024286_916_1884 281
71 3300048911 Ga0496108_0022172 Ga0496108_0022172_2652_3620 281
72 3300048912 Ga0496109_0090665 Ga0496109_0090665_1532_2500 281
73 3300048913 Ga0496110_0096216 Ga0496110_0096216_1112_2080 281
74 3300048917 Ga0496114_0052657 Ga0496114_0052657_1296_2264 281
75 3300053730 Ga0500645_000100 Ga0500645_000100_40738_41721 281
76 3300003794 Ga0055531_10002023 Ga0055531_1000202311 282
77 3300005328 Ga0070676_10134132 Ga0070676_101341322 282
78 3300005330 Ga0070690_100253187 Ga0070690_1002531871 282
79 3300005331 Ga0070670_100008082 Ga0070670_1000080827 282
80 3300005334 Ga0068869_100000671 Ga0068869_1000006717 282
81 3300005338 Ga0068868_100129257 Ga0068868_1001292572 282
82 3300005347 Ga0070668_100032876 Ga0070668_1000328762 282
83 3300005364 Ga0070673_100008546 Ga0070673_1000085462 282
84 3300005367 Ga0070667_100021099 Ga0070667_1000210992 282
85 3300005438 Ga0070701_10117616 Ga0070701_101176162 282
86 3300005455 Ga0070663_100376512 Ga0070663_1003765122 282
87 3300005459 Ga0068867_100072655 Ga0068867_1000726552 282
88 3300005467 Ga0070706_100595874 Ga0070706_1005958741 282
89 3300005545 Ga0070695_100180769 Ga0070695_1001807691 282
90 3300005563 Ga0068855_100067520 Ga0068855_1000675203 282
91 3300005577 Ga0068857_100003933 Ga0068857_1000039337 282
92 3300005617 Ga0068859_100001054 Ga0068859_1000010549 282
93 3300005618 Ga0068864_100000944 Ga0068864_10000094423 282
94 3300005719 Ga0068861_100017696 Ga0068861_1000176964 282
95 3300005841 Ga0068863_100001070 Ga0068863_10000107016 282
96 3300005842 Ga0068858_100017247 Ga0068858_1000172475 282
97 3300005843 Ga0068860_100010827 Ga0068860_1000108277 282
98 3300005844 Ga0068862_100023689 Ga0068862_1000236893 282
99 3300006847 Ga0075431_100236281 Ga0075431_1002362812 282
100 3300006880 Ga0075429_100045618 Ga0075429_1000456182 282
101 3300006880 Ga0075429_100140734 Ga0075429_1001407341 282
102 3300006931 Ga0097620_100001054 Ga0097620_1000010549 282
103 3300009098 Ga0105245_10082439 Ga0105245_100824392 282
104 3300009101 Ga0105247_10011407 Ga0105247_100114073 282
105 3300009177 Ga0105248_10012692 Ga0105248_100126927 282
106 3300013297 Ga0157378_10132035 Ga0157378_101320352 282
107 3300013306 Ga0163162_10163713 Ga0163162_101637132 282
108 3300014325 Ga0163163_10018636 Ga0163163_100186363 282
109 3300014968 Ga0157379_10006213 Ga0157379_100062138 282
110 3300025907 Ga0207645_10041011 Ga0207645_100410113 282
111 3300025925 Ga0207650_10049385 Ga0207650_100493853 282
112 3300025935 Ga0207709_10302165 Ga0207709_103021651 282
113 3300025941 Ga0207711_10117499 Ga0207711_101174992 282
114 3300025942 Ga0207689_10000037 Ga0207689_1000003727 282
115 3300025949 Ga0207667_10172143 Ga0207667_101721432 282
116 3300025960 Ga0207651_10055612 Ga0207651_100556123 282
117 3300025972 Ga0207668_10027904 Ga0207668_100279042 282
118 3300025986 Ga0207658_10140496 Ga0207658_101404962 282
119 3300026023 Ga0207677_10097018 Ga0207677_100970182 282
120 3300026035 Ga0207703_10002696 Ga0207703_100026968 282
121 3300026067 Ga0207678_10246929 Ga0207678_102469292 282
122 3300026088 Ga0207641_10007447 Ga0207641_100074472 282
123 3300026089 Ga0207648_10006052 Ga0207648_100060527 282
124 3300026095 Ga0207676_10008226 Ga0207676_100082266 282
125 3300026116 Ga0207674_10031362 Ga0207674_100313622 282
126 3300026118 Ga0207675_100023316 Ga0207675_1000233162 282
127 3300028380 Ga0268265_10072921 Ga0268265_100729212 282
128 3300028381 Ga0268264_10000443 Ga0268264_100004431 282
129 3300048905 Ga0496102_0009776 Ga0496102_0009776_502_1557 282
130 3300048911 Ga0496108_0123091 Ga0496108_0123091_1151_2206 282
131 3300048912 Ga0496109_0018296 Ga0496109_0018296_2476_3531 282
132 3300050508 nmdc:mga09592_201829_c1 nmdc:mga09592_201829_c1_399_1361 282
133 3300050508 nmdc:mga09592_282389_c1 nmdc:mga09592_282389_c1_229_1188 282
134 3300050509 nmdc:mga0qj67_198968_c1 nmdc:mga0qj67_198968_c1_394_1353 282
135 3300050510 nmdc:mga06r32_161332_c1 nmdc:mga06r32_161332_c1_935_1894 282
136 iso_pu_bacteria 2945984333 2945984981 282
137 3300005347 Ga0070668_100002565 Ga0070668_1000025657 283
138 3300005543 Ga0070672_100143243 Ga0070672_1001432432 283
139 3300005618 Ga0068864_100036066 Ga0068864_1000360663 283
140 3300005618 Ga0068864_100094774 Ga0068864_1000947742 283
141 3300005843 Ga0068860_100188569 Ga0068860_1001885692 283
142 3300005937 Ga0081455_10220145 Ga0081455_102201451 283
143 3300005981 Ga0081538_10033029 Ga0081538_100330291 283
144 3300006051 Ga0075364_10000857 Ga0075364_100008577 283
145 3300006847 Ga0075431_100420535 Ga0075431_1004205352 283
146 3300009177 Ga0105248_10122110 Ga0105248_101221102 283
147 3300013308 Ga0157375_10121429 Ga0157375_101214293 283
148 3300013308 Ga0157375_10184437 Ga0157375_101844372 283
149 3300025927 Ga0207687_10264308 Ga0207687_102643082 283
150 3300025940 Ga0207691_10198498 Ga0207691_101984981 283
151 3300025942 Ga0207689_10014422 Ga0207689_100144226 283
152 3300025972 Ga0207668_10011019 Ga0207668_100110192 283
153 3300025986 Ga0207658_10044695 Ga0207658_100446951 283
154 3300026088 Ga0207641_10117602 Ga0207641_101176022 283
155 3300026095 Ga0207676_10243278 Ga0207676_102432781 283
156 3300028381 Ga0268264_10157593 Ga0268264_101575933 283
157 3300049588 Ga0501072_0255961 Ga0501072_0255961_30_998 283
158 3300050491 nmdc:mga00v17_84040_c1 nmdc:mga00v17_84040_c1_867_1895 283
159 3300050509 nmdc:mga0qj67_132558_c1 nmdc:mga0qj67_132558_c1_23_1234 283
160 3300050509 nmdc:mga0qj67_249500_c1 nmdc:mga0qj67_249500_c1_149_1117 283
161 3300050510 nmdc:mga06r32_139689_c1 nmdc:mga06r32_139689_c1_244_1212 283
162 iso_pu_bacteria 2881101125 2881104075 283
163 3300005328 Ga0070676_10037794 Ga0070676_100377942 284
164 3300005333 Ga0070677_10022735 Ga0070677_100227352 284
165 3300005334 Ga0068869_100162110 Ga0068869_1001621101 284
166 3300005335 Ga0070666_10011012 Ga0070666_100110124 284
167 3300005335 Ga0070666_10119598 Ga0070666_101195982 284
168 3300005338 Ga0068868_100000700 Ga0068868_1000007008 284
169 3300005353 Ga0070669_100367834 Ga0070669_1003678342 284
170 3300005353 Ga0070669_100461731 Ga0070669_1004617311 284
171 3300005354 Ga0070675_100116617 Ga0070675_1001166171 284
172 3300005355 Ga0070671_100003604 Ga0070671_10000360413 284
173 3300005355 Ga0070671_100223845 Ga0070671_1002238452 284
174 3300005356 Ga0070674_100002602 Ga0070674_1000026023 284
175 3300005356 Ga0070674_100015546 Ga0070674_1000155463 284
176 3300005356 Ga0070674_100056208 Ga0070674_1000562082 284
177 3300005356 Ga0070674_100093704 Ga0070674_1000937042 284
178 3300005365 Ga0070688_100205176 Ga0070688_1002051761 284
179 3300005367 Ga0070667_100002668 Ga0070667_1000026683 284
180 3300005367 Ga0070667_100038499 Ga0070667_1000384992 284
181 3300005367 Ga0070667_100044495 Ga0070667_1000444953 284
182 3300005367 Ga0070667_100109964 Ga0070667_1001099642 284
183 3300005440 Ga0070705_100087860 Ga0070705_1000878601 284
184 3300005441 Ga0070700_100031085 Ga0070700_1000310852 284
185 3300005455 Ga0070663_100006830 Ga0070663_1000068305 284
186 3300005456 Ga0070678_100031700 Ga0070678_1000317003 284
187 3300005456 Ga0070678_100043992 Ga0070678_1000439922 284
188 3300005459 Ga0068867_100004344 Ga0068867_1000043446 284
189 3300005459 Ga0068867_100101271 Ga0068867_1001012711 284
190 3300005543 Ga0070672_100022600 Ga0070672_1000226002 284
191 3300005543 Ga0070672_100032076 Ga0070672_1000320762 284
192 3300005543 Ga0070672_100033555 Ga0070672_1000335553 284
193 3300005548 Ga0070665_100012333 Ga0070665_1000123337 284
194 3300005548 Ga0070665_100034936 Ga0070665_1000349362 284
195 3300005548 Ga0070665_100064619 Ga0070665_1000646193 284
196 3300005614 Ga0068856_100023607 Ga0068856_1000236073 284
197 3300005616 Ga0068852_100004079 Ga0068852_1000040798 284
198 3300005618 Ga0068864_100186793 Ga0068864_1001867932 284
199 3300005834 Ga0068851_10000288 Ga0068851_1000028817 284
200 3300005841 Ga0068863_100069767 Ga0068863_1000697673 284
201 3300005841 Ga0068863_100114202 Ga0068863_1001142022 284
202 3300005842 Ga0068858_100030528 Ga0068858_1000305285 284
203 3300005937 Ga0081455_10220623 Ga0081455_102206232 284
204 3300006237 Ga0097621_100025333 Ga0097621_1000253334 284
205 3300006237 Ga0097621_100129387 Ga0097621_1001293873 284
206 3300006237 Ga0097621_100149499 Ga0097621_1001494992 284
207 3300006358 Ga0068871_100003300 Ga0068871_1000033005 284
208 3300006358 Ga0068871_100017285 Ga0068871_1000172852 284
209 3300009177 Ga0105248_10032204 Ga0105248_100322043 284
210 3300009177 Ga0105248_10092408 Ga0105248_100924082 284
211 3300009177 Ga0105248_10325459 Ga0105248_103254592 284
212 3300013104 Ga0157370_10264191 Ga0157370_102641912 284
213 3300013297 Ga0157378_10076849 Ga0157378_100768493 284
214 3300013306 Ga0163162_10376859 Ga0163162_103768592 284
215 3300013308 Ga0157375_10019474 Ga0157375_100194743 284
216 3300013308 Ga0157375_10041420 Ga0157375_100414202 284
217 3300014325 Ga0163163_10159065 Ga0163163_101590652 284
218 3300014326 Ga0157380_10035094 Ga0157380_100350942 284
219 3300014968 Ga0157379_10052662 Ga0157379_100526622 284
220 3300014969 Ga0157376_10034981 Ga0157376_100349813 284
221 3300014969 Ga0157376_10072085 Ga0157376_100720853 284
222 3300014969 Ga0157376_10393541 Ga0157376_103935412 284
223 3300017792 Ga0163161_10152863 Ga0163161_101528632 284
224 3300017792 Ga0163161_10170957 Ga0163161_101709571 284
225 3300025893 Ga0207682_10000928 Ga0207682_1000092810 284
226 3300025903 Ga0207680_10068532 Ga0207680_100685322 284
227 3300025903 Ga0207680_10080149 Ga0207680_100801492 284
228 3300025907 Ga0207645_10007551 Ga0207645_100075515 284
229 3300025908 Ga0207643_10051714 Ga0207643_100517142 284
230 3300025915 Ga0207693_10242822 Ga0207693_102428222 284
231 3300025923 Ga0207681_10197348 Ga0207681_101973482 284
232 3300025926 Ga0207659_10270761 Ga0207659_102707612 284
233 3300025931 Ga0207644_10000874 Ga0207644_1000087416 284
234 3300025936 Ga0207670_10066873 Ga0207670_100668732 284
235 3300025937 Ga0207669_10026599 Ga0207669_100265993 284
236 3300025937 Ga0207669_10049461 Ga0207669_100494612 284
237 3300025937 Ga0207669_10061705 Ga0207669_100617052 284
238 3300025940 Ga0207691_10000441 Ga0207691_1000044123 284
239 3300025940 Ga0207691_10023453 Ga0207691_100234533 284
240 3300025940 Ga0207691_10060943 Ga0207691_100609434 284
241 3300025941 Ga0207711_10071407 Ga0207711_100714072 284
242 3300025941 Ga0207711_10123988 Ga0207711_101239881 284
243 3300025942 Ga0207689_10071515 Ga0207689_100715152 284
244 3300025960 Ga0207651_10001707 Ga0207651_100017077 284
245 3300025960 Ga0207651_10383330 Ga0207651_103833302 284
246 3300025972 Ga0207668_10157915 Ga0207668_101579153 284
247 3300025981 Ga0207640_10130617 Ga0207640_101306172 284
248 3300025986 Ga0207658_10007293 Ga0207658_100072937 284
249 3300025986 Ga0207658_10030627 Ga0207658_100306272 284
250 3300026023 Ga0207677_10027225 Ga0207677_100272253 284
251 3300026041 Ga0207639_10003990 Ga0207639_1000399010 284
252 3300026067 Ga0207678_10021823 Ga0207678_100218234 284
253 3300026075 Ga0207708_10026709 Ga0207708_100267092 284
254 3300026088 Ga0207641_10016322 Ga0207641_100163223 284
255 3300026088 Ga0207641_10055793 Ga0207641_100557931 284
256 3300026089 Ga0207648_10001093 Ga0207648_1000109328 284
257 3300026089 Ga0207648_10025107 Ga0207648_100251075 284
258 3300026095 Ga0207676_10036585 Ga0207676_100365853 284
259 3300026118 Ga0207675_100029252 Ga0207675_1000292524 284
260 3300026121 Ga0207683_10000222 Ga0207683_1000022229 284
261 3300026121 Ga0207683_10021988 Ga0207683_100219884 284
262 3300026121 Ga0207683_10141401 Ga0207683_101414012 284
263 3300026142 Ga0207698_10001711 Ga0207698_100017115 284
264 3300028379 Ga0268266_10019704 Ga0268266_100197042 284
265 3300028379 Ga0268266_10057350 Ga0268266_100573503 284
266 3300028379 Ga0268266_10100742 Ga0268266_101007422 284
267 3300028381 Ga0268264_10018846 Ga0268264_100188462 284
268 3300028556 Ga0265337_1000314 Ga0265337_10003146 284
269 3300031711 Ga0265314_10038089 Ga0265314_100380893 284
270 3300050513 nmdc:mga0rr50_91594_c1 nmdc:mga0rr50_91594_c1_981_1931 284
271 3300005331 Ga0070670_100375517 Ga0070670_1003755171 285
272 3300005340 Ga0070689_100454799 Ga0070689_1004547991 285
273 3300005354 Ga0070675_100010541 Ga0070675_1000105414 285
274 3300005354 Ga0070675_100032518 Ga0070675_1000325183 285
275 3300005355 Ga0070671_100002070 Ga0070671_10000207012 285
276 3300005355 Ga0070671_100060520 Ga0070671_1000605203 285
277 3300005356 Ga0070674_100316806 Ga0070674_1003168061 285
278 3300005364 Ga0070673_100006901 Ga0070673_1000069012 285
279 3300005364 Ga0070673_100025046 Ga0070673_1000250461 285
280 3300005456 Ga0070678_100160637 Ga0070678_1001606372 285
281 3300005457 Ga0070662_100058217 Ga0070662_1000582173 285
282 3300005543 Ga0070672_100003292 Ga0070672_1000032929 285
283 3300005543 Ga0070672_100115965 Ga0070672_1001159652 285
284 3300005616 Ga0068852_100138926 Ga0068852_1001389261 285
285 3300005618 Ga0068864_100284559 Ga0068864_1002845592 285
286 3300005719 Ga0068861_100090494 Ga0068861_1000904942 285
287 3300005843 Ga0068860_100241249 Ga0068860_1002412492 285
288 3300005843 Ga0068860_100340271 Ga0068860_1003402712 285
289 3300005844 Ga0068862_100046586 Ga0068862_1000465863 285
290 3300005844 Ga0068862_100147646 Ga0068862_1001476462 285
291 3300006237 Ga0097621_100280363 Ga0097621_1002803632 285
292 3300009177 Ga0105248_10049194 Ga0105248_100491943 285
293 3300013297 Ga0157378_10005225 Ga0157378_100052256 285
294 3300013306 Ga0163162_10388664 Ga0163162_103886642 285
295 3300013308 Ga0157375_10181717 Ga0157375_101817173 285
296 3300014325 Ga0163163_10007360 Ga0163163_1000736010 285
297 3300014325 Ga0163163_10220490 Ga0163163_102204903 285
298 3300025923 Ga0207681_10018352 Ga0207681_100183523 285
299 3300025925 Ga0207650_10031178 Ga0207650_100311782 285
300 3300025926 Ga0207659_10026022 Ga0207659_100260222 285
301 3300025926 Ga0207659_10059195 Ga0207659_100591952 285
302 3300025931 Ga0207644_10018336 Ga0207644_100183362 285
303 3300025931 Ga0207644_10178887 Ga0207644_101788872 285
304 3300025940 Ga0207691_10007484 Ga0207691_100074849 285
305 3300025940 Ga0207691_10054335 Ga0207691_100543352 285
306 3300025941 Ga0207711_10044933 Ga0207711_100449333 285
307 3300025960 Ga0207651_10005008 Ga0207651_100050082 285
308 3300025960 Ga0207651_10046715 Ga0207651_100467153 285
309 3300025972 Ga0207668_10021919 Ga0207668_100219193 285
310 3300026088 Ga0207641_10192144 Ga0207641_101921442 285
311 3300026095 Ga0207676_10146554 Ga0207676_101465542 285
312 3300026118 Ga0207675_100058809 Ga0207675_1000588092 285
313 3300026121 Ga0207683_10154991 Ga0207683_101549913 285
314 3300026142 Ga0207698_10060856 Ga0207698_100608563 285
315 3300028380 Ga0268265_10042640 Ga0268265_100426403 285
316 3300028380 Ga0268265_10126132 Ga0268265_101261322 285
317 3300046453 Ga0495627_010509 Ga0495627_010509_374_1378 285
318 3300046520 Ga0495637_0001026 Ga0495637_0001026_4719_5726 285
319 3300046522 Ga0495643_0010218 Ga0495643_0010218_2117_3103 285
320 3300046660 Ga0495625_0063317 Ga0495625_0063317_467_1474 285
321 3300048925 Ga0496122_0026206 Ga0496122_0026206_468_1472 285
322 3300048926 Ga0496123_0008443 Ga0496123_0008443_5393_6397 285
323 3300048928 Ga0496125_0013742 Ga0496125_0013742_5756_6727 285
324 3300048929 Ga0496126_0039291 Ga0496126_0039291_353_1324 285
325 3300053079 Ga0500610_0000112 Ga0500610_0000112_8972_9979 285
326 3300053121 Ga0500607_000040 Ga0500607_000040_33197_34204 285
327 3300053729 Ga0500625_030300 Ga0500625_030300_118_1122 285
328 iso_pu_bacteria 2738541307 2738881195 285
329 3300005337 Ga0070682_100095291 Ga0070682_1000952911 286
330 3300005367 Ga0070667_100076725 Ga0070667_1000767252 286
331 3300005842 Ga0068858_100052349 Ga0068858_1000523494 286
332 3300005983 Ga0081540_1002504 Ga0081540_100250416 286
333 3300009093 Ga0105240_10257092 Ga0105240_102570922 286
334 3300009177 Ga0105248_10234386 Ga0105248_102343862 286
335 3300013308 Ga0157375_10494751 Ga0157375_104947512 286
336 3300014968 Ga0157379_10032193 Ga0157379_100321932 286
337 3300025941 Ga0207711_10412455 Ga0207711_104124552 286
338 3300026035 Ga0207703_10019864 Ga0207703_100198644 286
339 3300005331 Ga0070670_100001412 Ga0070670_1000014127 287
340 3300005334 Ga0068869_100000344 Ga0068869_1000003448 287
341 3300005338 Ga0068868_100048823 Ga0068868_1000488232 287
342 3300005347 Ga0070668_100000854 Ga0070668_10000085413 287
343 3300005353 Ga0070669_100084933 Ga0070669_1000849331 287
344 3300005364 Ga0070673_100009326 Ga0070673_10000932611 287
345 3300005365 Ga0070688_100055732 Ga0070688_1000557322 287
346 3300005367 Ga0070667_100009725 Ga0070667_1000097258 287
347 3300005459 Ga0068867_100001610 Ga0068867_10000161012 287
348 3300005543 Ga0070672_100039569 Ga0070672_1000395692 287
349 3300005563 Ga0068855_100125863 Ga0068855_1001258632 287
350 3300005617 Ga0068859_100002546 Ga0068859_10000254615 287
351 3300005618 Ga0068864_100002924 Ga0068864_10000292414 287
352 3300005719 Ga0068861_100002077 Ga0068861_1000020779 287
353 3300005841 Ga0068863_100026772 Ga0068863_1000267725 287
354 3300005842 Ga0068858_100000492 Ga0068858_10000049211 287
355 3300005843 Ga0068860_100000703 Ga0068860_1000007035 287
356 3300005844 Ga0068862_100115733 Ga0068862_1001157332 287
357 3300006881 Ga0068865_100178765 Ga0068865_1001787651 287
358 3300006931 Ga0097620_100002546 Ga0097620_10000254615 287
359 3300009098 Ga0105245_10155037 Ga0105245_101550372 287
360 3300009177 Ga0105248_10001649 Ga0105248_1000164915 287
361 3300013105 Ga0157369_10045205 Ga0157369_100452052 287
362 3300013306 Ga0163162_10129174 Ga0163162_101291742 287
363 3300014325 Ga0163163_10001402 Ga0163163_1000140213 287
364 3300014968 Ga0157379_10000172 Ga0157379_1000017231 287
365 3300025907 Ga0207645_10029570 Ga0207645_100295705 287
366 3300025908 Ga0207643_10012487 Ga0207643_100124873 287
367 3300025909 Ga0207705_10167167 Ga0207705_101671672 287
368 3300025923 Ga0207681_10005517 Ga0207681_1000551712 287
369 3300025925 Ga0207650_10001989 Ga0207650_100019892 287
370 3300025927 Ga0207687_10116261 Ga0207687_101162612 287
371 3300025938 Ga0207704_10217886 Ga0207704_102178861 287
372 3300025940 Ga0207691_10048338 Ga0207691_100483385 287
373 3300025942 Ga0207689_10000075 Ga0207689_100000758 287
374 3300025949 Ga0207667_10046873 Ga0207667_100468734 287
375 3300025972 Ga0207668_10000941 Ga0207668_1000094111 287
376 3300025981 Ga0207640_10289970 Ga0207640_102899701 287
377 3300025986 Ga0207658_10005528 Ga0207658_100055283 287
378 3300026023 Ga0207677_10131762 Ga0207677_101317622 287
379 3300026035 Ga0207703_10000579 Ga0207703_1000057936 287
380 3300026088 Ga0207641_10005687 Ga0207641_100056873 287
381 3300026089 Ga0207648_10001429 Ga0207648_100014298 287
382 3300026095 Ga0207676_10015341 Ga0207676_100153416 287
383 3300026118 Ga0207675_100008295 Ga0207675_1000082953 287
384 3300028380 Ga0268265_10002068 Ga0268265_1000206815 287
385 3300028381 Ga0268264_10000734 Ga0268264_100007343 287
386 3300037312 Ga0395899_0006853 Ga0395899_0006853_3106_4074 287
387 3300037418 Ga0395900_0018117 Ga0395900_0018117_1878_2846 287
388 3300037471 Ga0395905_0066245 Ga0395905_0066245_1116_2084 287
389 3300038443 Ga0395901_0027408 Ga0395901_0027408_866_1834 287
390 3300046615 Ga0495656_0030643 Ga0495656_0030643_1014_1985 287
391 3300048905 Ga0496102_0144561 Ga0496102_0144561_304_1296 287
392 3300048911 Ga0496108_0076673 Ga0496108_0076673_349_1341 287
393 3300048912 Ga0496109_0494456 Ga0496109_0494456_17_1009 287
394 3300048913 Ga0496110_0046652 Ga0496110_0046652_310_1302 287
395 3300048916 Ga0496113_0213968 Ga0496113_0213968_275_1267 287
396 3300005329 Ga0070683_100311262 Ga0070683_1003112622 288
397 3300005333 Ga0070677_10091126 Ga0070677_100911262 288
398 3300005344 Ga0070661_100157736 Ga0070661_1001577362 288
399 3300005347 Ga0070668_100011458 Ga0070668_1000114587 288
400 3300005353 Ga0070669_100062860 Ga0070669_1000628602 288
401 3300005354 Ga0070675_100030200 Ga0070675_1000302004 288
402 3300005367 Ga0070667_100073464 Ga0070667_1000734643 288
403 3300005456 Ga0070678_100188686 Ga0070678_1001886862 288
404 3300005548 Ga0070665_100117495 Ga0070665_1001174952 288
405 3300005563 Ga0068855_100065243 Ga0068855_1000652434 288
406 3300005564 Ga0070664_100190637 Ga0070664_1001906372 288
407 3300009094 Ga0111539_10049377 Ga0111539_100493775 288
408 3300014326 Ga0157380_10156497 Ga0157380_101564972 288
409 3300025903 Ga0207680_10095975 Ga0207680_100959752 288
410 3300025923 Ga0207681_10065377 Ga0207681_100653773 288
411 3300025926 Ga0207659_10114736 Ga0207659_101147362 288
412 3300025945 Ga0207679_10520041 Ga0207679_105200411 288
413 3300025972 Ga0207668_10013081 Ga0207668_100130815 288
414 3300025986 Ga0207658_10073219 Ga0207658_100732191 288
415 3300028379 Ga0268266_10084059 Ga0268266_100840593 288
416 3300037312 Ga0395899_0003556 Ga0395899_0003556_1598_2572 288
417 3300037418 Ga0395900_0011091 Ga0395900_0011091_2866_3840 288
418 3300037466 Ga0395898_0016831 Ga0395898_0016831_4808_5782 288
419 3300037471 Ga0395905_0009284 Ga0395905_0009284_1471_2445 288
420 3300038443 Ga0395901_0017969 Ga0395901_0017969_4773_5747 288
421 3300002774 JGI25150J39212_1009116 JGI25150J39212_10091162 289
422 3300002987 JGI25159J45721_1005587 JGI25159J45721_10055873 289
423 3300003187 JGI25151J46595_10007512 JGI25151J46595_100075122 289
424 3300003771 Ga0055526_1000892 Ga0055526_100089210 289
425 3300003773 Ga0055537_1000339 Ga0055537_100033910 289
426 3300003775 Ga0055524_1000299 Ga0055524_100029910 289
427 3300003790 Ga0055528_1001750 Ga0055528_10017503 289
428 3300003791 Ga0055530_10000935 Ga0055530_1000093512 289
429 3300003792 Ga0055540_1000673 Ga0055540_100067310 289
430 3300025245 Ga0207425_1003769 Ga0207425_10037692 289
431 3300025263 Ga0209565_1000016 Ga0209565_1000016285 289
432 3300025273 Ga0209673_1001852 Ga0209673_100185210 289
433 3300025284 Ga0209130_1000917 Ga0209130_100091713 289
434 3300025291 Ga0209675_1000401 Ga0209675_100040123 289
435 3300025292 Ga0209676_1001372 Ga0209676_100137210 289
436 3300025294 Ga0209025_1032501 Ga0209025_10325012 289
437 3300025295 Ga0209564_1001584 Ga0209564_100158410 289
438 3300025298 Ga0209050_1001553 Ga0209050_100155310 289
439 3300025299 Ga0209256_1000001 Ga0209256_10000012011 289
440 3300025302 Ga0207426_1002070 Ga0207426_10020704 289
441 3300025303 Ga0209051_1001160 Ga0209051_100116010 289
442 3300025304 Ga0209257_1001764 Ga0209257_100176410 289
443 3300032004 Ga0307414_10335970 Ga0307414_103359702 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

74

342

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vpn-assembly1.cif.gz_A high-resolution structure of the periplasmic ectoine-binding protein from teaabc trap-transporter of halomonas elongata 0.8441 22 58
3oo9-assembly2.cif.gz_B crystal structures and biochemical characterization of the bacterial solute receptor acbh reveal an unprecedented exclusive substrate preference for b-d-galactopyranose 0.8014 17 60
3ooa-assembly2.cif.gz_B crystal structures and biochemical characterization of the bacterial solute receptor acbh reveal an unprecedented exclusive substrate preference for b-d-galactopyranose 0.799 17 60
4ovs-assembly2.cif.gz_B crystal structure of a trap periplasmic solute binding protein from sulfurospirillum deleyianum dsm 6946 (sdel_0447), target efi-510309, with bound succinate 0.7983 20 59
3oo7-assembly1.cif.gz_A crystal structures and biochemical characterization of the bacterial solute receptor acbh reveal an unprecedented exclusive substrate preference for b-d-galactopyranose 0.7975 22 60
ID Description Score Start End Superfamily
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9407 18 104 3.40.190.150
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9193 118 208 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.913 120 214 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.885 113 213 3.40.190.10
4x9tA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.8842 18 98 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A2P7P000-F1-model_v4 deleted 0.967 23 98
AF-A0A5N7ZSB6-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9522 136 289
AF-A0A259CY24-F1-model_v4 ABC transporter substrate-binding protein 0.9518 116 289
AF-A0A356HGU1-F1-model_v4 deleted 0.9516 142 289
AF-A0A536YLB2-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.949 154 289

Feature Viewer

pLDDT pTM Quality
86.68 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map