F445059

General Info

Members Datasets Scaffolds Average Seq Length
443 188 886 322

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10000555|Ga0075433_1000055518
Length 383
Sequence MTPFTPAKASLDIPTESLAGVQCLLARFARGTAMRVASAMIPTTIRTAVQSSYECDRYNRCSTRMTILIADDALRQRILDHTFPIWNEGLSREAYSRXXXXQLRTEWGRTHLQRIALVDDSGELLATAKRYRFDVRIDERVGWMCGIGAVFTPADRRGRGYASRLIERMLAEARREGALFASLFSEIGTAFYERLGFTTLPLDEVTVGVTRKGGAPAMLVRAGEDRDLVNVAAMHHVRSAGARVALRRSPALVQYAIAKKRLLAGLGPADGRQIEFFVAEEGASAVAYVLLHENANGWTLEEAGDRDPAGARLGAMLQALLAREPHRPAPLIRTWWPRPFTVPPQLELRDRIDARDVLMVCPLADVAMPITADDVFYWRSDYF

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
135 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
136 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
137 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.58
Rhizosphere 98.19
Stem 0
Stem Tuber 0
Unclassified 21.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10000555 3300006852 Bacteria 24602
2 MBSR1b_contig_8841003 2162886012 Unclassified 1166
3 JGI24746J21847_1008937 3300001977 Unclassified 1505
4 Ga0065704_10002104 3300005289 Bacteria 6235
5 Ga0065715_10014533 3300005293 Unclassified 4293
6 Ga0065707_10000779 3300005295 Bacteria 11400
7 Ga0065707_10013881 3300005295 Bacteria 1960
8 Ga0070658_10256179 3300005327 Bacteria 1485
9 Ga0070683_100088364 3300005329 Unclassified 2907
10 Ga0070690_100126866 3300005330 Bacteria 1719
11 Ga0070670_100012346 3300005331 Bacteria 7308
12 Ga0070670_100164619 3300005331 Unclassified 1922
13 Ga0070677_10066399 3300005333 Bacteria 1504
14 Ga0068869_100004693 3300005334 Bacteria 8529
15 Ga0068869_100024853 3300005334 Bacteria 4153
16 Ga0070666_10047893 3300005335 Unclassified 2870
17 Ga0070666_10115172 3300005335 Unclassified 1862
18 Ga0068868_100002029 3300005338 Bacteria 13921
19 Ga0070691_10022824 3300005341 Bacteria 2905
20 Ga0070687_100006068 3300005343 Bacteria 4929
21 Ga0070687_100008182 3300005343 Bacteria 4414
22 Ga0070687_100010866 3300005343 Bacteria 3959
23 Ga0070687_100165060 3300005343 Unclassified 1313
24 Ga0070661_100401995 3300005344 Bacteria 1083
25 Ga0070668_100200274 3300005347 Bacteria 1639
26 Ga0070669_100025328 3300005353 Bacteria 4260
27 Ga0070669_100031997 3300005353 Unclassified 3799
28 Ga0070669_100048234 3300005353 Bacteria 3108
29 Ga0070675_100000179 3300005354 Bacteria 39545
30 Ga0070675_100000385 3300005354 Bacteria 29879
31 Ga0070675_100006084 3300005354 Bacteria 9249
32 Ga0070675_100010003 3300005354 Bacteria 7395
33 Ga0070675_100036995 3300005354 Bacteria 3974
34 Ga0070675_100040445 3300005354 Bacteria 3806
35 Ga0070675_100092817 3300005354 Bacteria 2531
36 Ga0070671_100021991 3300005355 Bacteria 5209
37 Ga0070671_100061669 3300005355 Bacteria 3123
38 Ga0070674_100002445 3300005356 Bacteria 10280
39 Ga0070674_100005071 3300005356 Bacteria 7569
40 Ga0070674_100161080 3300005356 Unclassified 1702
41 Ga0070673_100021523 3300005364 Unclassified 4677
42 Ga0070673_100053029 3300005364 Bacteria 3184
43 Ga0070673_100076425 3300005364 Bacteria 2704
44 Ga0070673_100120449 3300005364 Unclassified 2188
45 Ga0070673_100134468 3300005364 Bacteria 2079
46 Ga0070673_100244625 3300005364 Bacteria 1561
47 Ga0070673_100307762 3300005364 Unclassified 1397
48 Ga0070688_100039703 3300005365 Bacteria 2882
49 Ga0070659_100114632 3300005366 Bacteria 2178
50 Ga0070659_100191214 3300005366 Bacteria 1682
51 Ga0070713_100022857 3300005436 Bacteria 4840
52 Ga0070701_10003444 3300005438 Bacteria 6264
53 Ga0070701_10038060 3300005438 Bacteria 2432
54 Ga0070705_100002741 3300005440 Bacteria 8788
55 Ga0070700_100019558 3300005441 Unclassified 3910
56 Ga0070700_100024984 3300005441 Bacteria 3514
57 Ga0070700_100042095 3300005441 Bacteria 2803
58 Ga0070694_100004314 3300005444 Bacteria 8545
59 Ga0070694_100006985 3300005444 Bacteria 6863
60 Ga0070694_100147739 3300005444 Unclassified 1714
61 Ga0070708_100035684 3300005445 Bacteria 4333
62 Ga0070663_100336862 3300005455 Bacteria 1217
63 Ga0070678_100004443 3300005456 Bacteria 7958
64 Ga0070678_100051340 3300005456 Bacteria 2989
65 Ga0070678_100193923 3300005456 Bacteria 1672
66 Ga0070662_100029392 3300005457 Bacteria 3835
67 Ga0070662_100048100 3300005457 Bacteria 3071
68 Ga0068867_100000594 3300005459 Bacteria 23939
69 Ga0068867_100001397 3300005459 Bacteria 16695
70 Ga0070707_100028450 3300005468 Bacteria 5320
71 Ga0070707_100148786 3300005468 Bacteria 2280
72 Ga0070698_100003720 3300005471 Bacteria 16754
73 Ga0070698_100056751 3300005471 Bacteria 3966
74 Ga0070698_100099792 3300005471 Bacteria 2876
75 Ga0070698_100288489 3300005471 Unclassified 1572
76 Ga0070699_100001411 3300005518 Bacteria 22076
77 Ga0070699_100003891 3300005518 Bacteria 13200
78 Ga0070699_100023998 3300005518 Bacteria 5256
79 Ga0070697_100076187 3300005536 Bacteria 2759
80 Ga0070697_100210740 3300005536 Bacteria 1654
81 Ga0070672_100024944 3300005543 Bacteria 4427
82 Ga0070672_100062251 3300005543 Bacteria 2944
83 Ga0070672_100099925 3300005543 Bacteria 2352
84 Ga0070672_100212029 3300005543 Bacteria 1622
85 Ga0070672_100233336 3300005543 Bacteria 1546
86 Ga0070686_100008779 3300005544 Bacteria 5662
87 Ga0070686_100055633 3300005544 Bacteria 2535
88 Ga0070686_100247408 3300005544 Unclassified 1301
89 Ga0070695_100002507 3300005545 Bacteria 10581
90 Ga0070695_100147617 3300005545 Unclassified 1638
91 Ga0070696_100002271 3300005546 Bacteria 12669
92 Ga0070696_100003087 3300005546 Bacteria 11076
93 Ga0070696_100006141 3300005546 Bacteria 8027
94 Ga0070696_100067258 3300005546 Bacteria 2514
95 Ga0070704_100004515 3300005549 Bacteria 8038
96 Ga0070704_100136503 3300005549 Bacteria 1909
97 Ga0070704_100301666 3300005549 Unclassified 1335
98 Ga0070704_100533577 3300005549 Bacteria 1023
99 Ga0068855_100248007 3300005563 Unclassified 1987
100 Ga0070664_100005188 3300005564 Bacteria 10447
101 Ga0070664_100023364 3300005564 Bacteria 5106
102 Ga0068857_100017351 3300005577 Bacteria 6306
103 Ga0068857_100113709 3300005577 Bacteria 2434
104 Ga0068854_100057869 3300005578 Bacteria 2797
105 Ga0068854_100110524 3300005578 Bacteria 2073
106 Ga0070702_100030793 3300005615 Bacteria 2929
107 Ga0070702_100081717 3300005615 Bacteria 1937
108 Ga0068859_100001202 3300005617 Bacteria 26419
109 Ga0068859_100005809 3300005617 Bacteria 12531
110 Ga0068859_100068116 3300005617 Bacteria 3594
111 Ga0068859_100163220 3300005617 Bacteria 2307
112 Ga0068859_100235903 3300005617 Unclassified 1918
113 Ga0068859_100431769 3300005617 Bacteria 1414
114 Ga0068864_100050135 3300005618 Bacteria 3592
115 Ga0068864_100105109 3300005618 Bacteria 2509
116 Ga0068864_100118802 3300005618 Bacteria 2361
117 Ga0068864_100157996 3300005618 Bacteria 2059
118 Ga0068866_10028676 3300005718 Bacteria 2655
119 Ga0068861_100017638 3300005719 Bacteria 5073
120 Ga0068861_100122209 3300005719 Bacteria 2102
121 Ga0068861_100276908 3300005719 Unclassified 1443
122 Ga0068851_10006118 3300005834 Bacteria 5491
123 Ga0068870_10016718 3300005840 Bacteria 3512
124 Ga0068870_10018196 3300005840 Unclassified 3389
125 Ga0068870_10023570 3300005840 Bacteria 3037
126 Ga0068863_100025032 3300005841 Bacteria 5692
127 Ga0068863_100048745 3300005841 Bacteria 4016
128 Ga0068858_100020312 3300005842 Bacteria 6212
129 Ga0068858_100117584 3300005842 Bacteria 2485
130 Ga0068860_100008479 3300005843 Bacteria 10242
131 Ga0068860_100011410 3300005843 Bacteria 8755
132 Ga0068860_100027542 3300005843 Bacteria 5472
133 Ga0068860_100112637 3300005843 Bacteria 2601
134 Ga0068862_100000554 3300005844 Bacteria 39072
135 Ga0068862_100047760 3300005844 Bacteria 3654
136 Ga0068871_100220053 3300006358 Bacteria 1645
137 Ga0075428_100003021 3300006844 Bacteria 18363
138 Ga0075428_100004391 3300006844 Bacteria 15569
139 Ga0075428_100004797 3300006844 Bacteria 14992
140 Ga0075428_100265149 3300006844 Bacteria 1849
141 Ga0075430_100000572 3300006846 Bacteria 27946
142 Ga0075430_100005451 3300006846 Bacteria 10748
143 Ga0075431_100000551 3300006847 Bacteria 31528
144 Ga0075431_100025073 3300006847 Bacteria 6115
145 Ga0075433_10010593 3300006852 Bacteria 7411
146 Ga0075433_10273461 3300006852 Unclassified 1497
147 Ga0075433_10297723 3300006852 Unclassified 1429
148 Ga0075434_100001213 3300006871 Bacteria 21404
149 Ga0075434_100011136 3300006871 Bacteria 8463
150 Ga0075434_100044943 3300006871 Bacteria 4381
151 Ga0075434_100070794 3300006871 Bacteria 3478
152 Ga0075434_100247578 3300006871 Unclassified 1802
153 Ga0075434_100531284 3300006871 Bacteria 1196
154 Ga0075429_100024270 3300006880 Bacteria 5261
155 Ga0075429_100037687 3300006880 Unclassified 4209
156 Ga0075429_100115735 3300006880 Unclassified 2344
157 Ga0075429_100148825 3300006880 Unclassified 2050
158 Ga0068865_100007639 3300006881 Bacteria 6658
159 Ga0097620_100001202 3300006931 Bacteria 26419
160 Ga0097620_100005810 3300006931 Bacteria 12531
161 Ga0097620_100068116 3300006931 Bacteria 3594
162 Ga0097620_100163216 3300006931 Bacteria 2307
163 Ga0097620_100235899 3300006931 Unclassified 1918
164 Ga0097620_100431742 3300006931 Bacteria 1414
165 Ga0075435_100002765 3300007076 Bacteria 11718
166 Ga0075435_100007149 3300007076 Bacteria 7935
167 Ga0075435_100045079 3300007076 Bacteria 3533
168 Ga0075435_100174121 3300007076 Bacteria 1816
169 Ga0075435_100296297 3300007076 Bacteria 1383
170 Ga0105240_10229701 3300009093 Bacteria 2157
171 Ga0111539_10000057 3300009094 Bacteria 114860
172 Ga0111539_10000442 3300009094 Bacteria 52293
173 Ga0111539_10000716 3300009094 Bacteria 43096
174 Ga0111539_10002452 3300009094 Bacteria 24652
175 Ga0111539_10026984 3300009094 Bacteria 7014
176 Ga0111539_10044795 3300009094 Bacteria 5298
177 Ga0111539_10069812 3300009094 Bacteria 4148
178 Ga0111539_10375623 3300009094 Bacteria 1655
179 Ga0111539_10542636 3300009094 Unclassified 1355
180 Ga0114129_10000428 3300009147 Bacteria 49983
181 Ga0114129_10003809 3300009147 Bacteria 21256
182 Ga0114129_10022531 3300009147 Bacteria 8937
183 Ga0114129_10046468 3300009147 Bacteria 6101
184 Ga0114129_10054833 3300009147 Bacteria 5588
185 Ga0114129_10092125 3300009147 Bacteria 4199
186 Ga0114129_10384155 3300009147 Bacteria 1854
187 Ga0114129_10522125 3300009147 Bacteria 1548
188 Ga0114129_10681595 3300009147 Unclassified 1323
189 Ga0105243_10565669 3300009148 Bacteria 1089
190 Ga0105241_10127348 3300009174 Unclassified 2058
191 Ga0105242_10003459 3300009176 Bacteria 12280
192 Ga0105248_10069117 3300009177 Unclassified 3965
193 Ga0105248_10260479 3300009177 Bacteria 1952
194 Ga0105248_10532695 3300009177 Bacteria 1325
195 Ga0105248_10597649 3300009177 Bacteria 1245
196 Ga0105249_10126671 3300009553 Unclassified 2433
197 Ga0105249_10273574 3300009553 Bacteria 1683
198 Ga0163162_10034122 3300013306 Bacteria 5062
199 Ga0157375_10037739 3300013308 Bacteria 4632
200 Ga0157375_10077240 3300013308 Bacteria 3359
201 Ga0157375_10155329 3300013308 Bacteria 2427
202 Ga0157375_10204091 3300013308 Unclassified 2133
203 Ga0157375_10268325 3300013308 Unclassified 1868
204 Ga0157375_10282054 3300013308 Bacteria 1824
205 Ga0157375_10300046 3300013308 Bacteria 1770
206 Ga0163163_10059109 3300014325 Bacteria 3791
207 Ga0163163_10088087 3300014325 Bacteria 3116
208 Ga0157380_10004321 3300014326 Bacteria 9852
209 Ga0157380_10014696 3300014326 Bacteria 5733
210 Ga0157380_10035266 3300014326 Unclassified 3863
211 Ga0157380_10048247 3300014326 Bacteria 3353
212 Ga0157380_10087554 3300014326 Bacteria 2561
213 Ga0157380_10129190 3300014326 Unclassified 2153
214 Ga0157380_10160733 3300014326 Unclassified 1952
215 Ga0157377_10016027 3300014745 Bacteria 3847
216 Ga0157377_10026770 3300014745 Bacteria 3090
217 Ga0157377_10119062 3300014745 Unclassified 1598
218 Ga0157379_10030803 3300014968 Bacteria 4777
219 Ga0157379_10146180 3300014968 Bacteria 2132
220 Ga0157379_10385655 3300014968 Bacteria 1286
221 Ga0157376_10137984 3300014969 Bacteria 2184
222 Ga0157376_10600303 3300014969 Unclassified 1095
223 Ga0163161_10322253 3300017792 Bacteria 1222
224 Ga0207656_10064428 3300025321 Bacteria 1615
225 Ga0207682_10016070 3300025893 Bacteria 2917
226 Ga0207682_10033665 3300025893 Unclassified 2064
227 Ga0207642_10017769 3300025899 Bacteria 2713
228 Ga0207688_10229700 3300025901 Bacteria 1120
229 Ga0207680_10150661 3300025903 Unclassified 1550
230 Ga0207645_10001086 3300025907 Bacteria 22411
231 Ga0207645_10004581 3300025907 Bacteria 10193
232 Ga0207645_10053886 3300025907 Bacteria 2569
233 Ga0207643_10013434 3300025908 Bacteria 4435
234 Ga0207643_10023324 3300025908 Unclassified 3411
235 Ga0207643_10070961 3300025908 Bacteria 2004
236 Ga0207643_10101488 3300025908 Unclassified 1687
237 Ga0207705_10219533 3300025909 Bacteria 1444
238 Ga0207695_10086515 3300025913 Bacteria 3161
239 Ga0207662_10000203 3300025918 Bacteria 27604
240 Ga0207662_10004389 3300025918 Bacteria 7409
241 Ga0207662_10192333 3300025918 Unclassified 1317
242 Ga0207649_10084139 3300025920 Unclassified 2067
243 Ga0207646_10126567 3300025922 Bacteria 2298
244 Ga0207646_10409944 3300025922 Bacteria 1224
245 Ga0207681_10023167 3300025923 Unclassified 3969
246 Ga0207681_10083555 3300025923 Unclassified 2260
247 Ga0207681_10107628 3300025923 Bacteria 2022
248 Ga0207681_10135142 3300025923 Bacteria 1829
249 Ga0207681_10145850 3300025923 Bacteria 1768
250 Ga0207681_10155555 3300025923 Bacteria 1718
251 Ga0207681_10238288 3300025923 Unclassified 1415
252 Ga0207650_10015383 3300025925 Bacteria 5327
253 Ga0207650_10229959 3300025925 Unclassified 1495
254 Ga0207650_10444767 3300025925 Bacteria 1078
255 Ga0207659_10000228 3300025926 Bacteria 34204
256 Ga0207659_10004480 3300025926 Bacteria 8452
257 Ga0207659_10016978 3300025926 Bacteria 4748
258 Ga0207659_10032413 3300025926 Bacteria 3586
259 Ga0207659_10033754 3300025926 Unclassified 3525
260 Ga0207659_10068423 3300025926 Bacteria 2582
261 Ga0207659_10100456 3300025926 Bacteria 2180
262 Ga0207659_10263107 3300025926 Bacteria 1404
263 Ga0207687_10146876 3300025927 Unclassified 1795
264 Ga0207644_10039370 3300025931 Bacteria 3336
265 Ga0207644_10068007 3300025931 Bacteria 2598
266 Ga0207690_10129186 3300025932 Bacteria 1847
267 Ga0207706_10003779 3300025933 Bacteria 14441
268 Ga0207706_10045894 3300025933 Bacteria 3870
269 Ga0207706_10092010 3300025933 Bacteria 2666
270 Ga0207669_10000432 3300025937 Bacteria 18312
271 Ga0207669_10004138 3300025937 Bacteria 6359
272 Ga0207704_10081427 3300025938 Bacteria 2094
273 Ga0207691_10008762 3300025940 Bacteria 9705
274 Ga0207691_10060158 3300025940 Bacteria 3452
275 Ga0207691_10074796 3300025940 Bacteria 3055
276 Ga0207711_10133942 3300025941 Bacteria 2224
277 Ga0207711_10229795 3300025941 Bacteria 1699
278 Ga0207711_10318494 3300025941 Bacteria 1437
279 Ga0207689_10001594 3300025942 Bacteria 21468
280 Ga0207689_10002683 3300025942 Bacteria 16455
281 Ga0207689_10076559 3300025942 Unclassified 2750
282 Ga0207661_10096085 3300025944 Unclassified 2479
283 Ga0207679_10019254 3300025945 Bacteria 4583
284 Ga0207679_10440011 3300025945 Bacteria 1154
285 Ga0207651_10005627 3300025960 Bacteria 6457
286 Ga0207651_10355388 3300025960 Bacteria 1235
287 Ga0207712_10103901 3300025961 Unclassified 2118
288 Ga0207668_10083419 3300025972 Unclassified 2325
289 Ga0207668_10200101 3300025972 Bacteria 1590
290 Ga0207640_10046776 3300025981 Bacteria 2787
291 Ga0207658_10080222 3300025986 Bacteria 2499
292 Ga0207703_10024969 3300026035 Bacteria 4701
293 Ga0207703_10073578 3300026035 Bacteria 2827
294 Ga0207708_10004413 3300026075 Bacteria 10368
295 Ga0207708_10020511 3300026075 Bacteria 4985
296 Ga0207708_10096566 3300026075 Unclassified 2283
297 Ga0207708_10148067 3300026075 Bacteria 1846
298 Ga0207708_10188029 3300026075 Bacteria 1642
299 Ga0207708_10210426 3300026075 Unclassified 1554
300 Ga0207641_10104087 3300026088 Bacteria 2505
301 Ga0207648_10000163 3300026089 Bacteria 68352
302 Ga0207648_10000600 3300026089 Bacteria 40518
303 Ga0207648_10037583 3300026089 Bacteria 4266
304 Ga0207648_10075304 3300026089 Bacteria 2942
305 Ga0207676_10057118 3300026095 Bacteria 3072
306 Ga0207676_10124521 3300026095 Bacteria 2180
307 Ga0207676_10224891 3300026095 Bacteria 1674
308 Ga0207676_10239799 3300026095 Bacteria 1626
309 Ga0207674_10091661 3300026116 Bacteria 3029
310 Ga0207674_10395709 3300026116 Unclassified 1335
311 Ga0207675_100006784 3300026118 Bacteria 10833
312 Ga0207675_100012666 3300026118 Bacteria 7879
313 Ga0207675_100013916 3300026118 Bacteria 7501
314 Ga0207675_100036898 3300026118 Bacteria 4559
315 Ga0207675_100131835 3300026118 Bacteria 2370
316 Ga0207675_100147640 3300026118 Bacteria 2237
317 Ga0207675_100151204 3300026118 Bacteria 2209
318 Ga0207675_100414192 3300026118 Unclassified 1330
319 Ga0207683_10071858 3300026121 Bacteria 3060
320 Ga0207683_10083626 3300026121 Bacteria 2836
321 Ga0207683_10122196 3300026121 Bacteria 2338
322 Ga0207683_10253522 3300026121 Unclassified 1606
323 Ga0209974_10011637 3300027876 Unclassified 2953
324 Ga0207428_10000520 3300027907 Bacteria 46036
325 Ga0207428_10001289 3300027907 Bacteria 26736
326 Ga0207428_10001366 3300027907 Bacteria 25889
327 Ga0207428_10008732 3300027907 Bacteria 9142
328 Ga0207428_10053534 3300027907 Bacteria 3217
329 Ga0207428_10160393 3300027907 Bacteria 1708
330 Ga0268265_10019075 3300028380 Bacteria 4762
331 Ga0268265_10074586 3300028380 Unclassified 2654
332 Ga0268265_10452669 3300028380 Bacteria 1199
333 Ga0268264_10065174 3300028381 Bacteria 3068
334 Ga0268264_10172074 3300028381 Bacteria 1959
335 Ga0268264_10194192 3300028381 Bacteria 1852
336 Ga0268264_10331598 3300028381 Bacteria 1442
337 Ga0307405_10002964 3300031731 Bacteria 7667
338 Ga0307412_10024732 3300031911 Bacteria 3710
339 Ga0307409_100008021 3300031995 Bacteria 6367
340 Ga0307409_100697789 3300031995 Bacteria 1014
341 Ga0307414_10219674 3300032004 Unclassified 1559
342 Ga0307411_10005070 3300032005 Bacteria 6413
343 Ga0307415_100008036 3300032126 Bacteria 5821
344 Ga0373950_0000460 3300034818 Bacteria 4991
345 Ga0373958_0001457 3300034819 Bacteria 3186
346 Ga0373958_0017841 3300034819 Bacteria 1281
347 Ga0373938_0003863 3300034957 Bacteria 2475
348 Ga0373928_0006798 3300035084 Unclassified 2203
349 Ga0373940_0001709 3300035088 Bacteria 4063
350 Ga0373951_0001829 3300035091 Bacteria 5518
351 Ga0373939_0003370 3300035114 Bacteria 3751
352 Ga0373941_0008296 3300035115 Unclassified 2574
353 Ga0373960_0003188 3300035121 Bacteria 3708
354 Ga0373942_0013145 3300035207 Unclassified 1986
355 Ga0373961_0001523 3300035241 Bacteria 6730
356 Ga0373962_0003877 3300035242 Unclassified 3600
357 Ga0373931_0008753 3300035691 Bacteria 4816
358 Ga0439453_0014953 3300041408 Unclassified 1337
359 Ga0451853_1179651 3300041512 Bacteria 1512
360 Ga0439433_0013096 3300041999 Unclassified 1821
361 Ga0439435_0034556 3300042436 Bacteria 1390
362 Ga0439435_0055373 3300042436 Bacteria 1144
363 Ga0450916_002418 3300042530 Unclassified 1980
364 Ga0451576_0017464 3300045051 Bacteria 7888
365 Ga0451576_0028322 3300045051 Bacteria 6002
366 Ga0451576_0033893 3300045051 Bacteria 5425
367 Ga0451576_0083459 3300045051 Bacteria 3324
368 Ga0451576_0084420 3300045051 Bacteria 3303
369 Ga0451576_0370661 3300045051 Bacteria 1500
370 Ga0451576_0462669 3300045051 Bacteria 1332
371 Ga0495603_0034110 3300046455 Bacteria 3062
372 Ga0495629_0002252 3300046459 Bacteria 14871
373 Ga0495580_0195542 3300046472 Bacteria 1394
374 Ga0495584_0199266 3300046491 Bacteria 1018
375 Ga0495594_0012130 3300046499 Bacteria 4487
376 Ga0495643_0006435 3300046522 Bacteria 7744
377 Ga0495598_0010671 3300046537 Unclassified 2206
378 Ga0495621_0001751 3300046539 Bacteria 5690
379 Ga0495621_0013956 3300046539 Unclassified 2535
380 Ga0495621_0035073 3300046539 Bacteria 1736
381 Ga0495621_0057468 3300046539 Bacteria 1405
382 Ga0495656_0011886 3300046615 Unclassified 3202
383 Ga0495659_0006671 3300046664 Bacteria 3647
384 Ga0495659_0044306 3300046664 Unclassified 1599
385 Ga0495659_0055452 3300046664 Unclassified 1452
386 Ga0495588_0023061 3300046674 Bacteria 3078
387 Ga0495623_0043593 3300046679 Unclassified 2854
388 Ga0495658_0007615 3300046683 Bacteria 5367
389 Ga0495669_0137313 3300046684 Unclassified 1153
390 Ga0495670_0025598 3300046691 Unclassified 2919
391 Ga0495685_049437 3300047447 Bacteria 1428
392 Ga0496104_0148029 3300048907 Bacteria 2255
393 Ga0496104_0341668 3300048907 Bacteria 1410
394 Ga0496106_0132982 3300048909 Bacteria 1952
395 Ga0496106_0171475 3300048909 Bacteria 1720
396 Ga0496108_0166850 3300048911 Bacteria 1904
397 Ga0496113_0081798 3300048916 Bacteria 2476
398 Ga0496114_0113412 3300048917 Bacteria 2324
399 Ga0501039_0272291 3300049575 Unclassified 1331
400 Ga0501040_0092306 3300049576 Unclassified 2105
401 Ga0501048_0242494 3300049582 Unclassified 1279
402 Ga0501068_0088766 3300049584 Bacteria 1905
403 Ga0501071_0179060 3300049587 Unclassified 1588
404 Ga0501074_0234652 3300049590 Bacteria 1305
405 Ga0501074_0394344 3300049590 Bacteria 982
406 Ga0501081_0016787 3300049743 Bacteria 4840
407 nmdc:mga05p37_16849_c1 3300050507 Bacteria 8809
408 nmdc:mga05p37_312251_c1 3300050507 Bacteria 1863
409 nmdc:mga05p37_4324_c1 3300050507 Bacteria 16595
410 nmdc:mga05p37_55453_c1 3300050507 Unclassified 4877
411 nmdc:mga09592_108065_c1 3300050508 Unclassified 2386
412 nmdc:mga09592_2762_c2 3300050508 Bacteria 11953
413 nmdc:mga09592_51315_c1 3300050508 Unclassified 3480
414 nmdc:mga09592_64612_c1 3300050508 Bacteria 3098
415 nmdc:mga09592_69501_c1 3300050508 Unclassified 2988
416 nmdc:mga0qj67_4492_c1 3300050509 Bacteria 10107
417 nmdc:mga06r32_109628_c1 3300050510 Bacteria 2715
418 nmdc:mga06r32_153957_c1 3300050510 Unclassified 2279
419 nmdc:mga06r32_23352_c1 3300050510 Bacteria 5721
420 nmdc:mga08y16_1036_c1 3300050511 Bacteria 12243
421 nmdc:mga08y16_117367_c1 3300050511 Unclassified 2770
422 nmdc:mga08y16_1831_c1 3300050511 Bacteria 21551
423 nmdc:mga08y16_3411_c1 3300050511 Bacteria 16480
424 nmdc:mga08y16_495406_c1 3300050511 Unclassified 1242
425 nmdc:mga08y16_5024_c1 3300050511 Bacteria 13831
426 nmdc:mga08y16_55090_c1 3300050511 Bacteria 4156
427 nmdc:mga08y16_8801_c1 3300050511 Bacteria 10596
428 nmdc:mga0n895_116477_c1 3300050512 Bacteria 2691
429 nmdc:mga0n895_139298_c1 3300050512 Bacteria 2454
430 nmdc:mga0n895_25092_c1 3300050512 Bacteria 5628
431 nmdc:mga0n895_37444_c1 3300050512 Bacteria 4693
432 nmdc:mga0n895_78576_c1 3300050512 Bacteria 3284
433 nmdc:mga0rr50_1933_c1 3300050513 Bacteria 11522
434 nmdc:mga0rr50_25334_c1 3300050513 Bacteria 4122
435 nmdc:mga0rr50_322456_c1 3300050513 Unclassified 1295
436 nmdc:mga0rr50_96415_c1 3300050513 Bacteria 2314
437 nmdc:mga0a205_121405_c1 3300050515 Bacteria 2512
438 nmdc:mga0a205_277455_c1 3300050515 Bacteria 1552
439 nmdc:mga0a205_33354_c1 3300050515 Bacteria 4937
440 nmdc:mga0a205_35723_c1 3300050515 Unclassified 4772
441 nmdc:mga0a205_44307_c1 3300050515 Bacteria 4288
442 nmdc:mga0a205_58166_c1 3300050515 Unclassified 3734
443 nmdc:mga0a205_7033_c1 3300050515 Bacteria 10166
444 Ga0075433_10000555
445 MBSR1b_contig_8841003
446 JGI24746J21847_1008937
447 Ga0065704_10002104
448 Ga0065715_10014533
449 Ga0065707_10000779
450 Ga0065707_10013881
451 Ga0070658_10256179
452 Ga0070683_100088364
453 Ga0070690_100126866
454 Ga0070670_100012346
455 Ga0070670_100164619
456 Ga0070677_10066399
457 Ga0068869_100004693
458 Ga0068869_100024853
459 Ga0070666_10047893
460 Ga0070666_10115172
461 Ga0068868_100002029
462 Ga0070691_10022824
463 Ga0070687_100006068
464 Ga0070687_100008182
465 Ga0070687_100010866
466 Ga0070687_100165060
467 Ga0070661_100401995
468 Ga0070668_100200274
469 Ga0070669_100025328
470 Ga0070669_100031997
471 Ga0070669_100048234
472 Ga0070675_100000179
473 Ga0070675_100000385
474 Ga0070675_100006084
475 Ga0070675_100010003
476 Ga0070675_100036995
477 Ga0070675_100040445
478 Ga0070675_100092817
479 Ga0070671_100021991
480 Ga0070671_100061669
481 Ga0070674_100002445
482 Ga0070674_100005071
483 Ga0070674_100161080
484 Ga0070673_100021523
485 Ga0070673_100053029
486 Ga0070673_100076425
487 Ga0070673_100120449
488 Ga0070673_100134468
489 Ga0070673_100244625
490 Ga0070673_100307762
491 Ga0070688_100039703
492 Ga0070659_100114632
493 Ga0070659_100191214
494 Ga0070713_100022857
495 Ga0070701_10003444
496 Ga0070701_10038060
497 Ga0070705_100002741
498 Ga0070700_100019558
499 Ga0070700_100024984
500 Ga0070700_100042095
501 Ga0070694_100004314
502 Ga0070694_100006985
503 Ga0070694_100147739
504 Ga0070708_100035684
505 Ga0070663_100336862
506 Ga0070678_100004443
507 Ga0070678_100051340
508 Ga0070678_100193923
509 Ga0070662_100029392
510 Ga0070662_100048100
511 Ga0068867_100000594
512 Ga0068867_100001397
513 Ga0070707_100028450
514 Ga0070707_100148786
515 Ga0070698_100003720
516 Ga0070698_100056751
517 Ga0070698_100099792
518 Ga0070698_100288489
519 Ga0070699_100001411
520 Ga0070699_100003891
521 Ga0070699_100023998
522 Ga0070697_100076187
523 Ga0070697_100210740
524 Ga0070672_100024944
525 Ga0070672_100062251
526 Ga0070672_100099925
527 Ga0070672_100212029
528 Ga0070672_100233336
529 Ga0070686_100008779
530 Ga0070686_100055633
531 Ga0070686_100247408
532 Ga0070695_100002507
533 Ga0070695_100147617
534 Ga0070696_100002271
535 Ga0070696_100003087
536 Ga0070696_100006141
537 Ga0070696_100067258
538 Ga0070704_100004515
539 Ga0070704_100136503
540 Ga0070704_100301666
541 Ga0070704_100533577
542 Ga0068855_100248007
543 Ga0070664_100005188
544 Ga0070664_100023364
545 Ga0068857_100017351
546 Ga0068857_100113709
547 Ga0068854_100057869
548 Ga0068854_100110524
549 Ga0070702_100030793
550 Ga0070702_100081717
551 Ga0068859_100001202
552 Ga0068859_100005809
553 Ga0068859_100068116
554 Ga0068859_100163220
555 Ga0068859_100235903
556 Ga0068859_100431769
557 Ga0068864_100050135
558 Ga0068864_100105109
559 Ga0068864_100118802
560 Ga0068864_100157996
561 Ga0068866_10028676
562 Ga0068861_100017638
563 Ga0068861_100122209
564 Ga0068861_100276908
565 Ga0068851_10006118
566 Ga0068870_10016718
567 Ga0068870_10018196
568 Ga0068870_10023570
569 Ga0068863_100025032
570 Ga0068863_100048745
571 Ga0068858_100020312
572 Ga0068858_100117584
573 Ga0068860_100008479
574 Ga0068860_100011410
575 Ga0068860_100027542
576 Ga0068860_100112637
577 Ga0068862_100000554
578 Ga0068862_100047760
579 Ga0068871_100220053
580 Ga0075428_100003021
581 Ga0075428_100004391
582 Ga0075428_100004797
583 Ga0075428_100265149
584 Ga0075430_100000572
585 Ga0075430_100005451
586 Ga0075431_100000551
587 Ga0075431_100025073
588 Ga0075433_10010593
589 Ga0075433_10273461
590 Ga0075433_10297723
591 Ga0075434_100001213
592 Ga0075434_100011136
593 Ga0075434_100044943
594 Ga0075434_100070794
595 Ga0075434_100247578
596 Ga0075434_100531284
597 Ga0075429_100024270
598 Ga0075429_100037687
599 Ga0075429_100115735
600 Ga0075429_100148825
601 Ga0068865_100007639
602 Ga0097620_100001202
603 Ga0097620_100005810
604 Ga0097620_100068116
605 Ga0097620_100163216
606 Ga0097620_100235899
607 Ga0097620_100431742
608 Ga0075435_100002765
609 Ga0075435_100007149
610 Ga0075435_100045079
611 Ga0075435_100174121
612 Ga0075435_100296297
613 Ga0105240_10229701
614 Ga0111539_10000057
615 Ga0111539_10000442
616 Ga0111539_10000716
617 Ga0111539_10002452
618 Ga0111539_10026984
619 Ga0111539_10044795
620 Ga0111539_10069812
621 Ga0111539_10375623
622 Ga0111539_10542636
623 Ga0114129_10000428
624 Ga0114129_10003809
625 Ga0114129_10022531
626 Ga0114129_10046468
627 Ga0114129_10054833
628 Ga0114129_10092125
629 Ga0114129_10384155
630 Ga0114129_10522125
631 Ga0114129_10681595
632 Ga0105243_10565669
633 Ga0105241_10127348
634 Ga0105242_10003459
635 Ga0105248_10069117
636 Ga0105248_10260479
637 Ga0105248_10532695
638 Ga0105248_10597649
639 Ga0105249_10126671
640 Ga0105249_10273574
641 Ga0163162_10034122
642 Ga0157375_10037739
643 Ga0157375_10077240
644 Ga0157375_10155329
645 Ga0157375_10204091
646 Ga0157375_10268325
647 Ga0157375_10282054
648 Ga0157375_10300046
649 Ga0163163_10059109
650 Ga0163163_10088087
651 Ga0157380_10004321
652 Ga0157380_10014696
653 Ga0157380_10035266
654 Ga0157380_10048247
655 Ga0157380_10087554
656 Ga0157380_10129190
657 Ga0157380_10160733
658 Ga0157377_10016027
659 Ga0157377_10026770
660 Ga0157377_10119062
661 Ga0157379_10030803
662 Ga0157379_10146180
663 Ga0157379_10385655
664 Ga0157376_10137984
665 Ga0157376_10600303
666 Ga0163161_10322253
667 Ga0207656_10064428
668 Ga0207682_10016070
669 Ga0207682_10033665
670 Ga0207642_10017769
671 Ga0207688_10229700
672 Ga0207680_10150661
673 Ga0207645_10001086
674 Ga0207645_10004581
675 Ga0207645_10053886
676 Ga0207643_10013434
677 Ga0207643_10023324
678 Ga0207643_10070961
679 Ga0207643_10101488
680 Ga0207705_10219533
681 Ga0207695_10086515
682 Ga0207662_10000203
683 Ga0207662_10004389
684 Ga0207662_10192333
685 Ga0207649_10084139
686 Ga0207646_10126567
687 Ga0207646_10409944
688 Ga0207681_10023167
689 Ga0207681_10083555
690 Ga0207681_10107628
691 Ga0207681_10135142
692 Ga0207681_10145850
693 Ga0207681_10155555
694 Ga0207681_10238288
695 Ga0207650_10015383
696 Ga0207650_10229959
697 Ga0207650_10444767
698 Ga0207659_10000228
699 Ga0207659_10004480
700 Ga0207659_10016978
701 Ga0207659_10032413
702 Ga0207659_10033754
703 Ga0207659_10068423
704 Ga0207659_10100456
705 Ga0207659_10263107
706 Ga0207687_10146876
707 Ga0207644_10039370
708 Ga0207644_10068007
709 Ga0207690_10129186
710 Ga0207706_10003779
711 Ga0207706_10045894
712 Ga0207706_10092010
713 Ga0207669_10000432
714 Ga0207669_10004138
715 Ga0207704_10081427
716 Ga0207691_10008762
717 Ga0207691_10060158
718 Ga0207691_10074796
719 Ga0207711_10133942
720 Ga0207711_10229795
721 Ga0207711_10318494
722 Ga0207689_10001594
723 Ga0207689_10002683
724 Ga0207689_10076559
725 Ga0207661_10096085
726 Ga0207679_10019254
727 Ga0207679_10440011
728 Ga0207651_10005627
729 Ga0207651_10355388
730 Ga0207712_10103901
731 Ga0207668_10083419
732 Ga0207668_10200101
733 Ga0207640_10046776
734 Ga0207658_10080222
735 Ga0207703_10024969
736 Ga0207703_10073578
737 Ga0207708_10004413
738 Ga0207708_10020511
739 Ga0207708_10096566
740 Ga0207708_10148067
741 Ga0207708_10188029
742 Ga0207708_10210426
743 Ga0207641_10104087
744 Ga0207648_10000163
745 Ga0207648_10000600
746 Ga0207648_10037583
747 Ga0207648_10075304
748 Ga0207676_10057118
749 Ga0207676_10124521
750 Ga0207676_10224891
751 Ga0207676_10239799
752 Ga0207674_10091661
753 Ga0207674_10395709
754 Ga0207675_100006784
755 Ga0207675_100012666
756 Ga0207675_100013916
757 Ga0207675_100036898
758 Ga0207675_100131835
759 Ga0207675_100147640
760 Ga0207675_100151204
761 Ga0207675_100414192
762 Ga0207683_10071858
763 Ga0207683_10083626
764 Ga0207683_10122196
765 Ga0207683_10253522
766 Ga0209974_10011637
767 Ga0207428_10000520
768 Ga0207428_10001289
769 Ga0207428_10001366
770 Ga0207428_10008732
771 Ga0207428_10053534
772 Ga0207428_10160393
773 Ga0268265_10019075
774 Ga0268265_10074586
775 Ga0268265_10452669
776 Ga0268264_10065174
777 Ga0268264_10172074
778 Ga0268264_10194192
779 Ga0268264_10331598
780 Ga0307405_10002964
781 Ga0307412_10024732
782 Ga0307409_100008021
783 Ga0307409_100697789
784 Ga0307414_10219674
785 Ga0307411_10005070
786 Ga0307415_100008036
787 Ga0373950_0000460
788 Ga0373958_0001457
789 Ga0373958_0017841
790 Ga0373938_0003863
791 Ga0373928_0006798
792 Ga0373940_0001709
793 Ga0373951_0001829
794 Ga0373939_0003370
795 Ga0373941_0008296
796 Ga0373960_0003188
797 Ga0373942_0013145
798 Ga0373961_0001523
799 Ga0373962_0003877
800 Ga0373931_0008753
801 Ga0439453_0014953
802 Ga0451853_1179651
803 Ga0439433_0013096
804 Ga0439435_0034556
805 Ga0439435_0055373
806 Ga0450916_002418
807 Ga0451576_0017464
808 Ga0451576_0028322
809 Ga0451576_0033893
810 Ga0451576_0083459
811 Ga0451576_0084420
812 Ga0451576_0370661
813 Ga0451576_0462669
814 Ga0495603_0034110
815 Ga0495629_0002252
816 Ga0495580_0195542
817 Ga0495584_0199266
818 Ga0495594_0012130
819 Ga0495643_0006435
820 Ga0495598_0010671
821 Ga0495621_0001751
822 Ga0495621_0013956
823 Ga0495621_0035073
824 Ga0495621_0057468
825 Ga0495656_0011886
826 Ga0495659_0006671
827 Ga0495659_0044306
828 Ga0495659_0055452
829 Ga0495588_0023061
830 Ga0495623_0043593
831 Ga0495658_0007615
832 Ga0495669_0137313
833 Ga0495670_0025598
834 Ga0495685_049437
835 Ga0496104_0148029
836 Ga0496104_0341668
837 Ga0496106_0132982
838 Ga0496106_0171475
839 Ga0496108_0166850
840 Ga0496113_0081798
841 Ga0496114_0113412
842 Ga0501039_0272291
843 Ga0501040_0092306
844 Ga0501048_0242494
845 Ga0501068_0088766
846 Ga0501071_0179060
847 Ga0501074_0234652
848 Ga0501074_0394344
849 Ga0501081_0016787
850 nmdc:mga05p37_16849_c1
851 nmdc:mga05p37_312251_c1
852 nmdc:mga05p37_4324_c1
853 nmdc:mga05p37_55453_c1
854 nmdc:mga09592_108065_c1
855 nmdc:mga09592_2762_c2
856 nmdc:mga09592_51315_c1
857 nmdc:mga09592_64612_c1
858 nmdc:mga09592_69501_c1
859 nmdc:mga0qj67_4492_c1
860 nmdc:mga06r32_109628_c1
861 nmdc:mga06r32_153957_c1
862 nmdc:mga06r32_23352_c1
863 nmdc:mga08y16_1036_c1
864 nmdc:mga08y16_117367_c1
865 nmdc:mga08y16_1831_c1
866 nmdc:mga08y16_3411_c1
867 nmdc:mga08y16_495406_c1
868 nmdc:mga08y16_5024_c1
869 nmdc:mga08y16_55090_c1
870 nmdc:mga08y16_8801_c1
871 nmdc:mga0n895_116477_c1
872 nmdc:mga0n895_139298_c1
873 nmdc:mga0n895_25092_c1
874 nmdc:mga0n895_37444_c1
875 nmdc:mga0n895_78576_c1
876 nmdc:mga0rr50_1933_c1
877 nmdc:mga0rr50_25334_c1
878 nmdc:mga0rr50_322456_c1
879 nmdc:mga0rr50_96415_c1
880 nmdc:mga0a205_121405_c1
881 nmdc:mga0a205_277455_c1
882 nmdc:mga0a205_33354_c1
883 nmdc:mga0a205_35723_c1
884 nmdc:mga0a205_44307_c1
885 nmdc:mga0a205_58166_c1
886 nmdc:mga0a205_7033_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13527

Acetyltransf_9

Acetyltransferase (GNAT) domain

74

200

0.85

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

75

197

0.74

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

113

199

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8179 48 139
7ypu-assembly4.cif.gz_H orfe-coa-glycylthricin complex 0.8172 47 139
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.8161 47 139
1z4e-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus halodurans c-125 0.8145 2 134
7byy-assembly1.cif.gz_B crystal structure of bacterial toxin 0.8097 48 135
ID Description Score Start End Superfamily
af_O13738_1_94_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8376 47 132 3.40.630.30
af_A0A0P0WGU7_189_301_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8375 47 136 3.40.630.30
af_I1MRQ6_38_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8362 47 131 3.40.630.30
af_I1KMR4_18_159_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8358 47 131 3.40.630.30
af_A4HVJ0_163_269_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8348 61 136 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2V8EIP6-F1-model_v4 N-acetyltransferase domain-containing protein 0.9481 2 323 GO:0016747
AF-A0A2V8EIP6-F1-model_v4 N-acetyltransferase domain-containing protein 0.9395 2 323 GO:0016747
AF-A0A3N5Z1R9-F1-model_v4 GNAT family N-acetyltransferase 0.9284 2 305 GO:0016740
AF-A0A3N5Z1R9-F1-model_v4 GNAT family N-acetyltransferase 0.9138 2 305 GO:0016740
AF-A0A7T2CT83-F1-model_v4 deleted 0.8872 49 137

Map