F445056

General Info

Members Datasets Scaffolds Average Seq Length
443 214 886 185

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100201659|Ga0070716_1002016591
Length 173
Sequence MNDKKHNPGVPIMDAEAIRRALRRIAHEIIEQNADLKSVVLAGIPLRGVEIARRLAEFIRDVAKIDIETGTIDVAMHRDDVGIRTELPVVHASKLPLPLEGRTVIIVDDVLFTGRTARAALDAISSFADRGHRELPIRADYVGKNLPTATREQIQVRLQNVDNEPDAVWLFKE

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
153 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
154 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
155 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.77
Rhizosphere 93.23
Stem 0
Stem Tuber 0
Unclassified 11.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_100201659 3300006173 Unclassified 1323
2 SwRhRL2b_contig_2126086 2162886007 Bacteria 1769
3 JGI24737J22298_10053533 3300001990 Unclassified 1222
4 JGI25406J46586_10000036 3300003203 Bacteria 61720
5 JGI25405J52794_10004849 3300003911 Bacteria 2410
6 JGI25405J52794_10004877 3300003911 Bacteria 2404
7 JGI25405J52794_10015640 3300003911 Bacteria 1492
8 Ga0065704_10018575 3300005289 Bacteria 2045
9 Ga0065704_10022605 3300005289 Bacteria 3499
10 Ga0065704_10462466 3300005289 Bacteria 694
11 Ga0065712_10012493 3300005290 Bacteria 3245
12 Ga0065712_10025273 3300005290 Bacteria 1328
13 Ga0065712_10166002 3300005290 Bacteria 1272
14 Ga0065712_10248464 3300005290 Unclassified 960
15 Ga0065715_10016749 3300005293 Bacteria 2054
16 Ga0065715_10089960 3300005293 Bacteria 8013
17 Ga0065715_10139274 3300005293 Bacteria 1879
18 Ga0065715_10149135 3300005293 Bacteria 1739
19 Ga0065715_10215202 3300005293 Bacteria 1296
20 Ga0065715_10328405 3300005293 Bacteria 988
21 Ga0065707_10317773 3300005295 Bacteria 972
22 Ga0070676_10836179 3300005328 Unclassified 682
23 Ga0070683_100037740 3300005329 Bacteria 4424
24 Ga0070683_100211239 3300005329 Bacteria 1843
25 Ga0070683_100244488 3300005329 Bacteria 1707
26 Ga0070690_100170819 3300005330 Bacteria 1496
27 Ga0070690_100813047 3300005330 Unclassified 726
28 Ga0070670_100129392 3300005331 Bacteria 2179
29 Ga0070670_100379920 3300005331 Bacteria 1244
30 Ga0070666_10040004 3300005335 Bacteria 3127
31 Ga0070680_100089872 3300005336 Bacteria 2542
32 Ga0070660_100140862 3300005339 Bacteria 1935
33 Ga0070660_100450211 3300005339 Bacteria 1068
34 Ga0070689_100019846 3300005340 Bacteria 4976
35 Ga0070661_100050137 3300005344 Bacteria 3055
36 Ga0070661_100050283 3300005344 Bacteria 3049
37 Ga0070668_100210498 3300005347 Bacteria 1599
38 Ga0070669_100373824 3300005353 Bacteria 1161
39 Ga0070669_100497781 3300005353 Bacteria 1010
40 Ga0070675_100038085 3300005354 Unclassified 3918
41 Ga0070675_100105451 3300005354 Bacteria 2378
42 Ga0070675_100277622 3300005354 Bacteria 1472
43 Ga0070675_100530035 3300005354 Bacteria 1063
44 Ga0070675_101162119 3300005354 Bacteria 710
45 Ga0070671_100010298 3300005355 Bacteria 7502
46 Ga0070671_101102540 3300005355 Bacteria 697
47 Ga0070674_100011159 3300005356 Bacteria 5457
48 Ga0070673_100081578 3300005364 Bacteria 2623
49 Ga0070673_100214943 3300005364 Bacteria 1662
50 Ga0070673_100243570 3300005364 Unclassified 1564
51 Ga0070673_100592900 3300005364 Unclassified 1010
52 Ga0070688_100025270 3300005365 Bacteria 3515
53 Ga0070688_100105449 3300005365 Bacteria 1866
54 Ga0070659_100014243 3300005366 Bacteria 5936
55 Ga0070659_100446302 3300005366 Unclassified 1097
56 Ga0070667_100137182 3300005367 Bacteria 2139
57 Ga0070713_100043397 3300005436 Bacteria 3676
58 Ga0070713_100083070 3300005436 Bacteria 2737
59 Ga0070713_100313835 3300005436 Bacteria 1446
60 Ga0070710_10778605 3300005437 Bacteria 682
61 Ga0070701_10178414 3300005438 Unclassified 1241
62 Ga0070711_100087228 3300005439 Bacteria 2240
63 Ga0070711_100212919 3300005439 Bacteria 1498
64 Ga0070711_100742885 3300005439 Unclassified 829
65 Ga0070705_100188146 3300005440 Bacteria 1405
66 Ga0070705_100763112 3300005440 Bacteria 766
67 Ga0070700_100182931 3300005441 Bacteria 1460
68 Ga0070708_100032749 3300005445 Bacteria 4510
69 Ga0070708_100475661 3300005445 Bacteria 1179
70 Ga0070708_101017126 3300005445 Bacteria 777
71 Ga0070708_101213233 3300005445 Bacteria 706
72 Ga0070678_100108980 3300005456 Bacteria 2162
73 Ga0070662_100200876 3300005457 Unclassified 1582
74 Ga0070706_100000918 3300005467 Bacteria 32326
75 Ga0070706_100024572 3300005467 Bacteria 5547
76 Ga0070706_100027704 3300005467 Bacteria 5213
77 Ga0070706_100190586 3300005467 Bacteria 1916
78 Ga0070706_100223237 3300005467 Bacteria 1759
79 Ga0070706_100306082 3300005467 Bacteria 1482
80 Ga0070706_100456148 3300005467 Bacteria 1189
81 Ga0070706_100513444 3300005467 Bacteria 1115
82 Ga0070706_100662054 3300005467 Bacteria 969
83 Ga0070706_100998211 3300005467 Bacteria 772
84 Ga0070707_100004116 3300005468 Bacteria 13649
85 Ga0070707_100008511 3300005468 Bacteria 9529
86 Ga0070707_100010922 3300005468 Bacteria 8456
87 Ga0070707_100106786 3300005468 Bacteria 2715
88 Ga0070707_100206274 3300005468 Bacteria 1916
89 Ga0070707_101367020 3300005468 Bacteria 675
90 Ga0070698_100003843 3300005471 Bacteria 16515
91 Ga0070698_100015290 3300005471 Bacteria 8114
92 Ga0070698_100060132 3300005471 Bacteria 3834
93 Ga0070699_100117376 3300005518 Bacteria 2339
94 Ga0070699_100412010 3300005518 Bacteria 1223
95 Ga0070699_100818060 3300005518 Bacteria 853
96 Ga0070679_100095875 3300005530 Bacteria 2954
97 Ga0070684_100018341 3300005535 Bacteria 5763
98 Ga0070684_100165765 3300005535 Bacteria 2005
99 Ga0070684_100327845 3300005535 Bacteria 1407
100 Ga0070697_100009187 3300005536 Bacteria 7724
101 Ga0070697_100087395 3300005536 Bacteria 2574
102 Ga0070697_100089967 3300005536 Bacteria 2537
103 Ga0070697_100093491 3300005536 Bacteria 2490
104 Ga0070697_100320248 3300005536 Bacteria 1335
105 Ga0070672_100191147 3300005543 Bacteria 1709
106 Ga0070672_100469585 3300005543 Bacteria 1085
107 Ga0070665_100063026 3300005548 Bacteria 3717
108 Ga0070665_100068206 3300005548 Bacteria 3566
109 Ga0070665_100193464 3300005548 Bacteria 2034
110 Ga0070704_100010779 3300005549 Bacteria 5572
111 Ga0070704_100569263 3300005549 Bacteria 992
112 Ga0070664_100068349 3300005564 Bacteria 3037
113 Ga0070664_100425558 3300005564 Bacteria 1217
114 Ga0068856_100124330 3300005614 Bacteria 2582
115 Ga0068856_101473039 3300005614 Unclassified 695
116 Ga0070702_100093963 3300005615 Bacteria 1825
117 Ga0070702_100568098 3300005615 Bacteria 845
118 Ga0068859_100275596 3300005617 Bacteria 1775
119 Ga0068864_100151674 3300005618 Bacteria 2100
120 Ga0068864_100580226 3300005618 Bacteria 1086
121 Ga0068863_100034793 3300005841 Bacteria 4797
122 Ga0068860_100053983 3300005843 Bacteria 3819
123 Ga0068860_100153996 3300005843 Bacteria 2215
124 Ga0081455_10000241 3300005937 Bacteria 70932
125 Ga0081455_10007227 3300005937 Bacteria 11728
126 Ga0081455_10015261 3300005937 Bacteria 7471
127 Ga0081455_10018512 3300005937 Bacteria 6631
128 Ga0081455_10087628 3300005937 Bacteria 2532
129 Ga0081455_10094092 3300005937 Bacteria 2421
130 Ga0081455_10383416 3300005937 Bacteria 981
131 Ga0081540_1027055 3300005983 Bacteria 3258
132 Ga0081540_1103985 3300005983 Unclassified 1216
133 Ga0081540_1104036 3300005983 Bacteria 1216
134 Ga0081540_1131152 3300005983 Bacteria 1023
135 Ga0081539_10000403 3300005985 Bacteria 92820
136 Ga0081539_10017216 3300005985 Bacteria 5088
137 Ga0070717_10008403 3300006028 Bacteria 7710
138 Ga0070717_10009501 3300006028 Bacteria 7312
139 Ga0070717_10122432 3300006028 Bacteria 2230
140 Ga0070717_10543892 3300006028 Bacteria 1051
141 Ga0070715_10132132 3300006163 Unclassified 1203
142 Ga0070716_100060047 3300006173 Bacteria 2194
143 Ga0070716_100117263 3300006173 Bacteria 1660
144 Ga0070712_100016383 3300006175 Bacteria 4787
145 Ga0070712_100216029 3300006175 Bacteria 1515
146 Ga0070712_100418886 3300006175 Bacteria 1109
147 Ga0070712_100432720 3300006175 Bacteria 1092
148 Ga0097621_100115698 3300006237 Bacteria 2270
149 Ga0097621_100402287 3300006237 Bacteria 1226
150 Ga0097621_100671300 3300006237 Bacteria 952
151 Ga0075428_100132264 3300006844 Bacteria 2713
152 Ga0075434_100502995 3300006871 Bacteria 1233
153 Ga0075434_100518815 3300006871 Bacteria 1212
154 Ga0075436_100019696 3300006914 Bacteria 4626
155 Ga0075436_100033956 3300006914 Bacteria 3516
156 Ga0075436_100565043 3300006914 Bacteria 836
157 Ga0097620_100275587 3300006931 Bacteria 1775
158 Ga0075435_100542653 3300007076 Bacteria 1007
159 Ga0111539_10416910 3300009094 Bacteria 1564
160 Ga0111539_10951606 3300009094 Bacteria 999
161 Ga0105245_10243867 3300009098 Bacteria 1743
162 Ga0114129_10126772 3300009147 Bacteria 3509
163 Ga0114129_10317702 3300009147 Bacteria 2071
164 Ga0114129_10456131 3300009147 Bacteria 1676
165 Ga0105242_10600089 3300009176 Unclassified 1063
166 Ga0105242_11104783 3300009176 Bacteria 807
167 Ga0105248_10346819 3300009177 Bacteria 1672
168 Ga0105237_10328773 3300009545 Bacteria 1533
169 Ga0105249_10047134 3300009553 Bacteria 3926
170 Ga0105249_10385349 3300009553 Bacteria 1429
171 Ga0105249_10388132 3300009553 Bacteria 1424
172 Ga0105249_10430351 3300009553 Bacteria 1355
173 Ga0105239_10615448 3300010375 Bacteria 1239
174 Ga0105246_10135537 3300011119 Bacteria 1845
175 Ga0105246_10752160 3300011119 Bacteria 860
176 Ga0157370_10449838 3300013104 Unclassified 1184
177 Ga0157369_10269817 3300013105 Bacteria 1773
178 Ga0157374_10007233 3300013296 Bacteria 9458
179 Ga0157374_10051837 3300013296 Bacteria 3819
180 Ga0157374_10128100 3300013296 Bacteria 2455
181 Ga0157374_10155615 3300013296 Bacteria 2224
182 Ga0157374_10323082 3300013296 Bacteria 1529
183 Ga0157374_10409848 3300013296 Bacteria 1353
184 Ga0157378_10059203 3300013297 Bacteria 3417
185 Ga0157378_10086515 3300013297 Bacteria 2841
186 Ga0157378_10731637 3300013297 Bacteria 1011
187 Ga0157378_11028236 3300013297 Bacteria 859
188 Ga0157378_11150639 3300013297 Bacteria 814
189 Ga0163162_10047251 3300013306 Bacteria 4314
190 Ga0163162_10070686 3300013306 Bacteria 3542
191 Ga0163162_10498647 3300013306 Bacteria 1348
192 Ga0163162_10730438 3300013306 Bacteria 1110
193 Ga0157372_10328561 3300013307 Bacteria 1780
194 Ga0157375_10004350 3300013308 Bacteria 12297
195 Ga0157375_10016579 3300013308 Bacteria 6624
196 Ga0157375_10094844 3300013308 Bacteria 3053
197 Ga0157375_10199571 3300013308 Bacteria 2156
198 Ga0157375_10462232 3300013308 Bacteria 1434
199 Ga0157375_11573472 3300013308 Bacteria 777
200 Ga0163163_10065541 3300014325 Bacteria 3606
201 Ga0163163_10330763 3300014325 Bacteria 1578
202 Ga0163163_11183809 3300014325 Bacteria 827
203 Ga0182008_10014521 3300014497 Bacteria 4123
204 Ga0157377_10204973 3300014745 Bacteria 1254
205 Ga0157377_10322588 3300014745 Bacteria 1027
206 Ga0157377_10534431 3300014745 Bacteria 825
207 Ga0157379_10049371 3300014968 Bacteria 3757
208 Ga0157376_10016162 3300014969 Bacteria 5659
209 Ga0157376_10096589 3300014969 Bacteria 2572
210 Ga0157376_10199506 3300014969 Bacteria 1840
211 Ga0157376_10650978 3300014969 Bacteria 1054
212 Ga0157376_10732897 3300014969 Unclassified 996
213 Ga0163161_11383441 3300017792 Unclassified 614
214 Ga0207666_1005069 3300025271 Bacteria 1674
215 Ga0207673_1001233 3300025290 Bacteria 2754
216 Ga0207673_1004464 3300025290 Bacteria 1675
217 Ga0207697_10002173 3300025315 Bacteria 10268
218 Ga0207697_10002622 3300025315 Bacteria 9249
219 Ga0207697_10003811 3300025315 Bacteria 7358
220 Ga0207697_10006086 3300025315 Bacteria 5515
221 Ga0207697_10007617 3300025315 Bacteria 4809
222 Ga0207697_10014723 3300025315 Bacteria 3241
223 Ga0207697_10049590 3300025315 Bacteria 1733
224 Ga0207697_10075964 3300025315 Unclassified 1412
225 Ga0207692_10039753 3300025898 Bacteria 2317
226 Ga0207692_10066004 3300025898 Bacteria 1890
227 Ga0207688_10016711 3300025901 Bacteria 3983
228 Ga0207688_10240677 3300025901 Bacteria 1094
229 Ga0207680_10077809 3300025903 Bacteria 2076
230 Ga0207680_10163330 3300025903 Unclassified 1495
231 Ga0207647_10004882 3300025904 Bacteria 9899
232 Ga0207685_10090574 3300025905 Unclassified 1287
233 Ga0207645_10025105 3300025907 Bacteria 3859
234 Ga0207684_10000126 3300025910 Bacteria 140178
235 Ga0207684_10011522 3300025910 Bacteria 7725
236 Ga0207684_10020657 3300025910 Bacteria 5627
237 Ga0207684_10138754 3300025910 Bacteria 2089
238 Ga0207684_10184870 3300025910 Bacteria 1797
239 Ga0207684_10549996 3300025910 Bacteria 988
240 Ga0207684_10595880 3300025910 Unclassified 944
241 Ga0207684_10659788 3300025910 Bacteria 891
242 Ga0207707_10184958 3300025912 Bacteria 1818
243 Ga0207671_10475042 3300025914 Unclassified 996
244 Ga0207693_10082595 3300025915 Bacteria 2516
245 Ga0207693_10193983 3300025915 Bacteria 1598
246 Ga0207693_10357666 3300025915 Bacteria 1142
247 Ga0207693_10376966 3300025915 Bacteria 1110
248 Ga0207693_10618890 3300025915 Bacteria 842
249 Ga0207663_10073488 3300025916 Unclassified 2213
250 Ga0207663_10330319 3300025916 Bacteria 1148
251 Ga0207657_10164814 3300025919 Bacteria 1798
252 Ga0207649_10047925 3300025920 Bacteria 2633
253 Ga0207646_10020469 3300025922 Bacteria 6129
254 Ga0207646_10032922 3300025922 Bacteria 4688
255 Ga0207646_10033340 3300025922 Bacteria 4659
256 Ga0207646_10166268 3300025922 Bacteria 1991
257 Ga0207646_10638682 3300025922 Bacteria 954
258 Ga0207646_10783992 3300025922 Bacteria 849
259 Ga0207646_11265118 3300025922 Unclassified 645
260 Ga0207681_10054230 3300025923 Unclassified 2725
261 Ga0207681_10066369 3300025923 Bacteria 2498
262 Ga0207681_10090147 3300025923 Bacteria 2188
263 Ga0207681_10194704 3300025923 Bacteria 1553
264 Ga0207650_10240528 3300025925 Bacteria 1463
265 Ga0207659_10129899 3300025926 Bacteria 1943
266 Ga0207659_10233633 3300025926 Bacteria 1484
267 Ga0207659_10262645 3300025926 Bacteria 1405
268 Ga0207659_11021718 3300025926 Bacteria 711
269 Ga0207700_10060530 3300025928 Bacteria 2868
270 Ga0207700_10641410 3300025928 Bacteria 947
271 Ga0207644_10033940 3300025931 Bacteria 3570
272 Ga0207644_10300238 3300025931 Bacteria 1294
273 Ga0207644_10336666 3300025931 Bacteria 1223
274 Ga0207690_10049438 3300025932 Bacteria 2803
275 Ga0207690_10345958 3300025932 Unclassified 1175
276 Ga0207706_10008411 3300025933 Bacteria 9522
277 Ga0207706_10491287 3300025933 Bacteria 1060
278 Ga0207670_10054409 3300025936 Bacteria 2700
279 Ga0207670_10418659 3300025936 Bacteria 1074
280 Ga0207670_10990966 3300025936 Bacteria 707
281 Ga0207665_10084595 3300025939 Bacteria 2189
282 Ga0207665_10422184 3300025939 Bacteria 1019
283 Ga0207665_10476220 3300025939 Bacteria 961
284 Ga0207691_10028541 3300025940 Bacteria 5224
285 Ga0207691_10279106 3300025940 Bacteria 1438
286 Ga0207711_10359650 3300025941 Bacteria 1348
287 Ga0207661_10055930 3300025944 Bacteria 3166
288 Ga0207661_10108194 3300025944 Bacteria 2346
289 Ga0207661_10142506 3300025944 Bacteria 2064
290 Ga0207661_10508485 3300025944 Bacteria 1101
291 Ga0207679_10077766 3300025945 Bacteria 2525
292 Ga0207679_10157465 3300025945 Bacteria 1856
293 Ga0207679_10280145 3300025945 Bacteria 1429
294 Ga0207651_10224745 3300025960 Bacteria 1520
295 Ga0207651_10237145 3300025960 Bacteria 1484
296 Ga0207712_10034659 3300025961 Bacteria 3422
297 Ga0207712_10067173 3300025961 Bacteria 2565
298 Ga0207658_10324897 3300025986 Bacteria 1333
299 Ga0207677_10401524 3300026023 Unclassified 1162
300 Ga0207708_10099603 3300026075 Bacteria 2248
301 Ga0207641_10037749 3300026088 Bacteria 4036
302 Ga0207641_10136700 3300026088 Bacteria 2207
303 Ga0207676_10097402 3300026095 Bacteria 2430
304 Ga0207675_100066862 3300026118 Bacteria 3360
305 Ga0207683_10010617 3300026121 Bacteria 7854
306 Ga0207683_10360440 3300026121 Unclassified 1335
307 Ga0209974_10014206 3300027876 Bacteria 2653
308 Ga0209974_10028341 3300027876 Bacteria 1855
309 Ga0207428_10168181 3300027907 Bacteria 1661
310 Ga0268266_10036643 3300028379 Bacteria 4176
311 Ga0268266_10110172 3300028379 Bacteria 2438
312 Ga0268266_10130028 3300028379 Bacteria 2251
313 Ga0268266_10452250 3300028379 Bacteria 1221
314 Ga0268264_10032671 3300028381 Bacteria 4270
315 Ga0373934_0171510 3300035086 Bacteria 891
316 Ga0373923_0021725 3300035111 Bacteria 2509
317 Ga0373936_0192392 3300035113 Bacteria 898
318 Ga0373939_0244462 3300035114 Unclassified 696
319 Ga0373953_0020888 3300035117 Bacteria 2451
320 Ga0373953_0092174 3300035117 Bacteria 1268
321 Ga0373954_0206981 3300035118 Bacteria 964
322 Ga0373943_0038083 3300035170 Bacteria 2311
323 Ga0373955_0013148 3300035172 Bacteria 3993
324 Ga0373955_0056662 3300035172 Bacteria 2150
325 Ga0373931_0120683 3300035691 Bacteria 1498
326 Ga0373931_0488796 3300035691 Unclassified 792
327 Ga0373935_0013325 3300035692 Bacteria 4961
328 Ga0373935_0066836 3300035692 Bacteria 2310
329 Ga0373935_0111483 3300035692 Bacteria 1817
330 Ga0373935_0274369 3300035692 Unclassified 1186
331 Ga0373927_0131383 3300035695 Bacteria 1636
332 Ga0373933_0040346 3300035724 Bacteria 2750
333 Ga0373933_0122315 3300035724 Bacteria 1631
334 Ga0373933_0954030 3300035724 Bacteria 565
335 Ga0373947_0086790 3300035725 Bacteria 1946
336 Ga0373947_0159675 3300035725 Bacteria 1457
337 Ga0373947_0240409 3300035725 Bacteria 1195
338 Ga0373937_0167366 3300036401 Bacteria 2061
339 Ga0373925_0097407 3300037068 Bacteria 2256
340 Ga0373925_0109890 3300037068 Bacteria 2128
341 Ga0373925_0153127 3300037068 Bacteria 1812
342 Ga0395899_0304214 3300037312 Unclassified 1078
343 Ga0395900_0001611 3300037418 Bacteria 26605
344 Ga0395900_0502154 3300037418 Bacteria 1163
345 Ga0395900_1030777 3300037418 Unclassified 742
346 Ga0395898_0003937 3300037466 Bacteria 16390
347 Ga0395905_0017922 3300037471 Bacteria 6726
348 Ga0395901_0074537 3300038443 Bacteria 3541
349 Ga0395901_0251123 3300038443 Bacteria 1842
350 Ga0439448_0011767 3300042005 Bacteria 2610
351 Ga0439455_0000717 3300042012 Bacteria 4918
352 Ga0439458_0005974 3300042157 Bacteria 2724
353 Ga0439464_0005693 3300042439 Bacteria 3230
354 Ga0439460_0029899 3300042461 Bacteria 1545
355 Ga0453683_0684875 3300044673 Unclassified 671
356 Ga0466964_0074158 3300044706 Bacteria 1446
357 Ga0495592_0003325 3300046454 Bacteria 11508
358 Ga0495592_0123015 3300046454 Bacteria 1823
359 Ga0495592_0419136 3300046454 Bacteria 845
360 Ga0495603_0040298 3300046455 Bacteria 2796
361 Ga0495651_0112902 3300046462 Bacteria 2007
362 Ga0495582_0162881 3300046473 Bacteria 1269
363 Ga0495639_0071180 3300046475 Bacteria 1607
364 Ga0495639_0280550 3300046475 Unclassified 828
365 Ga0495594_0368609 3300046499 Bacteria 817
366 Ga0495608_0209681 3300046511 Bacteria 1225
367 Ga0495618_0076181 3300046514 Bacteria 2137
368 Ga0495628_0002539 3300046516 Bacteria 16420
369 Ga0495630_0079300 3300046517 Bacteria 2477
370 Ga0495630_0128164 3300046517 Bacteria 1926
371 Ga0495666_0119685 3300046526 Bacteria 1234
372 Ga0495652_0162230 3300046529 Bacteria 1734
373 Ga0495640_0122481 3300046533 Bacteria 1689
374 Ga0495640_0226438 3300046533 Unclassified 1177
375 Ga0495640_0440950 3300046533 Bacteria 796
376 Ga0495586_0148193 3300046535 Unclassified 1319
377 Ga0495587_0008567 3300046536 Bacteria 6573
378 Ga0495598_0092858 3300046537 Bacteria 987
379 Ga0495645_0002207 3300046543 Bacteria 13243
380 Ga0495657_0484915 3300046675 Bacteria 722
381 Ga0495599_0000882 3300046678 Bacteria 16732
382 Ga0495623_0006635 3300046679 Bacteria 7533
383 Ga0495623_0252959 3300046679 Unclassified 990
384 Ga0495646_0357159 3300046680 Unclassified 765
385 Ga0495647_0117421 3300046681 Unclassified 1116
386 Ga0495658_0017461 3300046683 Bacteria 3707
387 Ga0495669_0056385 3300046684 Bacteria 1771
388 Ga0495669_0104002 3300046684 Bacteria 1321
389 Ga0495613_0356974 3300046689 Unclassified 1003
390 Ga0495624_0036610 3300046690 Bacteria 3162
391 Ga0495624_0281889 3300046690 Unclassified 1003
392 Ga0495600_0376583 3300046809 Bacteria 886
393 Ga0495581_0040556 3300047315 Bacteria 2694
394 Ga0495604_0020417 3300047317 Bacteria 5290
395 Ga0495674_0038175 3300047319 Bacteria 4313
396 Ga0495674_0068753 3300047319 Bacteria 3064
397 Ga0495676_0095118 3300047321 Bacteria 2218
398 Ga0495675_0044286 3300047444 Bacteria 2835
399 Ga0495675_0066777 3300047444 Bacteria 2273
400 Ga0495684_0014707 3300047471 Bacteria 6024
401 Ga0495684_0580565 3300047471 Unclassified 759
402 Ga0496101_0051504 3300048904 Bacteria 2967
403 Ga0496101_0466640 3300048904 Unclassified 996
404 Ga0496101_0788223 3300048904 Bacteria 750
405 Ga0496102_0029545 3300048905 Bacteria 4905
406 Ga0496102_0235733 3300048905 Bacteria 1725
407 Ga0496102_0659195 3300048905 Unclassified 970
408 Ga0496103_0139716 3300048906 Bacteria 1549
409 Ga0496103_0784540 3300048906 Bacteria 601
410 Ga0496104_0200946 3300048907 Bacteria 1905
411 Ga0496105_0174636 3300048908 Bacteria 1760
412 Ga0496106_1011958 3300048909 Unclassified 653
413 Ga0496107_0055724 3300048910 Bacteria 2855
414 Ga0496107_0181723 3300048910 Bacteria 1562
415 Ga0496108_0102241 3300048911 Bacteria 2445
416 Ga0496108_0124814 3300048911 Bacteria 2210
417 Ga0496108_0457401 3300048911 Bacteria 1115
418 Ga0496108_1235622 3300048911 Bacteria 631
419 Ga0496109_0125464 3300048912 Bacteria 2393
420 Ga0496109_0748912 3300048912 Bacteria 915
421 Ga0496110_0437650 3300048913 Bacteria 1192
422 Ga0496110_0445309 3300048913 Unclassified 1180
423 Ga0496112_0121887 3300048915 Bacteria 2578
424 Ga0496112_0315785 3300048915 Bacteria 1507
425 Ga0496112_0401103 3300048915 Bacteria 1311
426 Ga0496113_1090484 3300048916 Bacteria 626
427 Ga0496114_0082013 3300048917 Bacteria 2725
428 Ga0496115_0002115 3300048918 Bacteria 14210
429 Ga0496115_0165120 3300048918 Bacteria 1831
430 Ga0496115_0417476 3300048918 Bacteria 1087
431 Ga0496115_0429721 3300048918 Bacteria 1069
432 Ga0501067_0420877 3300049583 Bacteria 745
433 Ga0501068_0300330 3300049584 Bacteria 1028
434 Ga0501069_0304516 3300049585 Bacteria 935
435 nmdc:mga05p37_121365_c1 3300050507 Bacteria 3210
436 nmdc:mga0rr50_818353_c1 3300050513 Bacteria 794
437 nmdc:mga08x19_40872_c1 3300050514 Bacteria 2952
438 nmdc:mga08x19_4587_c1 3300050514 Bacteria 8202
439 nmdc:mga08x19_71503_c1 3300050514 Bacteria 2262
440 nmdc:mga0a205_263405_c1 3300050515 Bacteria 1601
441 Ga0495601_0000516 3300053077 Bacteria 20381
442 Ga0495595_0087317 3300053084 Unclassified 1493
443 Ga0495619_0574120 3300053085 Unclassified 773
444 Ga0070716_100201659
445 SwRhRL2b_contig_2126086
446 JGI24737J22298_10053533
447 JGI25406J46586_10000036
448 JGI25405J52794_10004849
449 JGI25405J52794_10004877
450 JGI25405J52794_10015640
451 Ga0065704_10018575
452 Ga0065704_10022605
453 Ga0065704_10462466
454 Ga0065712_10012493
455 Ga0065712_10025273
456 Ga0065712_10166002
457 Ga0065712_10248464
458 Ga0065715_10016749
459 Ga0065715_10089960
460 Ga0065715_10139274
461 Ga0065715_10149135
462 Ga0065715_10215202
463 Ga0065715_10328405
464 Ga0065707_10317773
465 Ga0070676_10836179
466 Ga0070683_100037740
467 Ga0070683_100211239
468 Ga0070683_100244488
469 Ga0070690_100170819
470 Ga0070690_100813047
471 Ga0070670_100129392
472 Ga0070670_100379920
473 Ga0070666_10040004
474 Ga0070680_100089872
475 Ga0070660_100140862
476 Ga0070660_100450211
477 Ga0070689_100019846
478 Ga0070661_100050137
479 Ga0070661_100050283
480 Ga0070668_100210498
481 Ga0070669_100373824
482 Ga0070669_100497781
483 Ga0070675_100038085
484 Ga0070675_100105451
485 Ga0070675_100277622
486 Ga0070675_100530035
487 Ga0070675_101162119
488 Ga0070671_100010298
489 Ga0070671_101102540
490 Ga0070674_100011159
491 Ga0070673_100081578
492 Ga0070673_100214943
493 Ga0070673_100243570
494 Ga0070673_100592900
495 Ga0070688_100025270
496 Ga0070688_100105449
497 Ga0070659_100014243
498 Ga0070659_100446302
499 Ga0070667_100137182
500 Ga0070713_100043397
501 Ga0070713_100083070
502 Ga0070713_100313835
503 Ga0070710_10778605
504 Ga0070701_10178414
505 Ga0070711_100087228
506 Ga0070711_100212919
507 Ga0070711_100742885
508 Ga0070705_100188146
509 Ga0070705_100763112
510 Ga0070700_100182931
511 Ga0070708_100032749
512 Ga0070708_100475661
513 Ga0070708_101017126
514 Ga0070708_101213233
515 Ga0070678_100108980
516 Ga0070662_100200876
517 Ga0070706_100000918
518 Ga0070706_100024572
519 Ga0070706_100027704
520 Ga0070706_100190586
521 Ga0070706_100223237
522 Ga0070706_100306082
523 Ga0070706_100456148
524 Ga0070706_100513444
525 Ga0070706_100662054
526 Ga0070706_100998211
527 Ga0070707_100004116
528 Ga0070707_100008511
529 Ga0070707_100010922
530 Ga0070707_100106786
531 Ga0070707_100206274
532 Ga0070707_101367020
533 Ga0070698_100003843
534 Ga0070698_100015290
535 Ga0070698_100060132
536 Ga0070699_100117376
537 Ga0070699_100412010
538 Ga0070699_100818060
539 Ga0070679_100095875
540 Ga0070684_100018341
541 Ga0070684_100165765
542 Ga0070684_100327845
543 Ga0070697_100009187
544 Ga0070697_100087395
545 Ga0070697_100089967
546 Ga0070697_100093491
547 Ga0070697_100320248
548 Ga0070672_100191147
549 Ga0070672_100469585
550 Ga0070665_100063026
551 Ga0070665_100068206
552 Ga0070665_100193464
553 Ga0070704_100010779
554 Ga0070704_100569263
555 Ga0070664_100068349
556 Ga0070664_100425558
557 Ga0068856_100124330
558 Ga0068856_101473039
559 Ga0070702_100093963
560 Ga0070702_100568098
561 Ga0068859_100275596
562 Ga0068864_100151674
563 Ga0068864_100580226
564 Ga0068863_100034793
565 Ga0068860_100053983
566 Ga0068860_100153996
567 Ga0081455_10000241
568 Ga0081455_10007227
569 Ga0081455_10015261
570 Ga0081455_10018512
571 Ga0081455_10087628
572 Ga0081455_10094092
573 Ga0081455_10383416
574 Ga0081540_1027055
575 Ga0081540_1103985
576 Ga0081540_1104036
577 Ga0081540_1131152
578 Ga0081539_10000403
579 Ga0081539_10017216
580 Ga0070717_10008403
581 Ga0070717_10009501
582 Ga0070717_10122432
583 Ga0070717_10543892
584 Ga0070715_10132132
585 Ga0070716_100060047
586 Ga0070716_100117263
587 Ga0070712_100016383
588 Ga0070712_100216029
589 Ga0070712_100418886
590 Ga0070712_100432720
591 Ga0097621_100115698
592 Ga0097621_100402287
593 Ga0097621_100671300
594 Ga0075428_100132264
595 Ga0075434_100502995
596 Ga0075434_100518815
597 Ga0075436_100019696
598 Ga0075436_100033956
599 Ga0075436_100565043
600 Ga0097620_100275587
601 Ga0075435_100542653
602 Ga0111539_10416910
603 Ga0111539_10951606
604 Ga0105245_10243867
605 Ga0114129_10126772
606 Ga0114129_10317702
607 Ga0114129_10456131
608 Ga0105242_10600089
609 Ga0105242_11104783
610 Ga0105248_10346819
611 Ga0105237_10328773
612 Ga0105249_10047134
613 Ga0105249_10385349
614 Ga0105249_10388132
615 Ga0105249_10430351
616 Ga0105239_10615448
617 Ga0105246_10135537
618 Ga0105246_10752160
619 Ga0157370_10449838
620 Ga0157369_10269817
621 Ga0157374_10007233
622 Ga0157374_10051837
623 Ga0157374_10128100
624 Ga0157374_10155615
625 Ga0157374_10323082
626 Ga0157374_10409848
627 Ga0157378_10059203
628 Ga0157378_10086515
629 Ga0157378_10731637
630 Ga0157378_11028236
631 Ga0157378_11150639
632 Ga0163162_10047251
633 Ga0163162_10070686
634 Ga0163162_10498647
635 Ga0163162_10730438
636 Ga0157372_10328561
637 Ga0157375_10004350
638 Ga0157375_10016579
639 Ga0157375_10094844
640 Ga0157375_10199571
641 Ga0157375_10462232
642 Ga0157375_11573472
643 Ga0163163_10065541
644 Ga0163163_10330763
645 Ga0163163_11183809
646 Ga0182008_10014521
647 Ga0157377_10204973
648 Ga0157377_10322588
649 Ga0157377_10534431
650 Ga0157379_10049371
651 Ga0157376_10016162
652 Ga0157376_10096589
653 Ga0157376_10199506
654 Ga0157376_10650978
655 Ga0157376_10732897
656 Ga0163161_11383441
657 Ga0207666_1005069
658 Ga0207673_1001233
659 Ga0207673_1004464
660 Ga0207697_10002173
661 Ga0207697_10002622
662 Ga0207697_10003811
663 Ga0207697_10006086
664 Ga0207697_10007617
665 Ga0207697_10014723
666 Ga0207697_10049590
667 Ga0207697_10075964
668 Ga0207692_10039753
669 Ga0207692_10066004
670 Ga0207688_10016711
671 Ga0207688_10240677
672 Ga0207680_10077809
673 Ga0207680_10163330
674 Ga0207647_10004882
675 Ga0207685_10090574
676 Ga0207645_10025105
677 Ga0207684_10000126
678 Ga0207684_10011522
679 Ga0207684_10020657
680 Ga0207684_10138754
681 Ga0207684_10184870
682 Ga0207684_10549996
683 Ga0207684_10595880
684 Ga0207684_10659788
685 Ga0207707_10184958
686 Ga0207671_10475042
687 Ga0207693_10082595
688 Ga0207693_10193983
689 Ga0207693_10357666
690 Ga0207693_10376966
691 Ga0207693_10618890
692 Ga0207663_10073488
693 Ga0207663_10330319
694 Ga0207657_10164814
695 Ga0207649_10047925
696 Ga0207646_10020469
697 Ga0207646_10032922
698 Ga0207646_10033340
699 Ga0207646_10166268
700 Ga0207646_10638682
701 Ga0207646_10783992
702 Ga0207646_11265118
703 Ga0207681_10054230
704 Ga0207681_10066369
705 Ga0207681_10090147
706 Ga0207681_10194704
707 Ga0207650_10240528
708 Ga0207659_10129899
709 Ga0207659_10233633
710 Ga0207659_10262645
711 Ga0207659_11021718
712 Ga0207700_10060530
713 Ga0207700_10641410
714 Ga0207644_10033940
715 Ga0207644_10300238
716 Ga0207644_10336666
717 Ga0207690_10049438
718 Ga0207690_10345958
719 Ga0207706_10008411
720 Ga0207706_10491287
721 Ga0207670_10054409
722 Ga0207670_10418659
723 Ga0207670_10990966
724 Ga0207665_10084595
725 Ga0207665_10422184
726 Ga0207665_10476220
727 Ga0207691_10028541
728 Ga0207691_10279106
729 Ga0207711_10359650
730 Ga0207661_10055930
731 Ga0207661_10108194
732 Ga0207661_10142506
733 Ga0207661_10508485
734 Ga0207679_10077766
735 Ga0207679_10157465
736 Ga0207679_10280145
737 Ga0207651_10224745
738 Ga0207651_10237145
739 Ga0207712_10034659
740 Ga0207712_10067173
741 Ga0207658_10324897
742 Ga0207677_10401524
743 Ga0207708_10099603
744 Ga0207641_10037749
745 Ga0207641_10136700
746 Ga0207676_10097402
747 Ga0207675_100066862
748 Ga0207683_10010617
749 Ga0207683_10360440
750 Ga0209974_10014206
751 Ga0209974_10028341
752 Ga0207428_10168181
753 Ga0268266_10036643
754 Ga0268266_10110172
755 Ga0268266_10130028
756 Ga0268266_10452250
757 Ga0268264_10032671
758 Ga0373934_0171510
759 Ga0373923_0021725
760 Ga0373936_0192392
761 Ga0373939_0244462
762 Ga0373953_0020888
763 Ga0373953_0092174
764 Ga0373954_0206981
765 Ga0373943_0038083
766 Ga0373955_0013148
767 Ga0373955_0056662
768 Ga0373931_0120683
769 Ga0373931_0488796
770 Ga0373935_0013325
771 Ga0373935_0066836
772 Ga0373935_0111483
773 Ga0373935_0274369
774 Ga0373927_0131383
775 Ga0373933_0040346
776 Ga0373933_0122315
777 Ga0373933_0954030
778 Ga0373947_0086790
779 Ga0373947_0159675
780 Ga0373947_0240409
781 Ga0373937_0167366
782 Ga0373925_0097407
783 Ga0373925_0109890
784 Ga0373925_0153127
785 Ga0395899_0304214
786 Ga0395900_0001611
787 Ga0395900_0502154
788 Ga0395900_1030777
789 Ga0395898_0003937
790 Ga0395905_0017922
791 Ga0395901_0074537
792 Ga0395901_0251123
793 Ga0439448_0011767
794 Ga0439455_0000717
795 Ga0439458_0005974
796 Ga0439464_0005693
797 Ga0439460_0029899
798 Ga0453683_0684875
799 Ga0466964_0074158
800 Ga0495592_0003325
801 Ga0495592_0123015
802 Ga0495592_0419136
803 Ga0495603_0040298
804 Ga0495651_0112902
805 Ga0495582_0162881
806 Ga0495639_0071180
807 Ga0495639_0280550
808 Ga0495594_0368609
809 Ga0495608_0209681
810 Ga0495618_0076181
811 Ga0495628_0002539
812 Ga0495630_0079300
813 Ga0495630_0128164
814 Ga0495666_0119685
815 Ga0495652_0162230
816 Ga0495640_0122481
817 Ga0495640_0226438
818 Ga0495640_0440950
819 Ga0495586_0148193
820 Ga0495587_0008567
821 Ga0495598_0092858
822 Ga0495645_0002207
823 Ga0495657_0484915
824 Ga0495599_0000882
825 Ga0495623_0006635
826 Ga0495623_0252959
827 Ga0495646_0357159
828 Ga0495647_0117421
829 Ga0495658_0017461
830 Ga0495669_0056385
831 Ga0495669_0104002
832 Ga0495613_0356974
833 Ga0495624_0036610
834 Ga0495624_0281889
835 Ga0495600_0376583
836 Ga0495581_0040556
837 Ga0495604_0020417
838 Ga0495674_0038175
839 Ga0495674_0068753
840 Ga0495676_0095118
841 Ga0495675_0044286
842 Ga0495675_0066777
843 Ga0495684_0014707
844 Ga0495684_0580565
845 Ga0496101_0051504
846 Ga0496101_0466640
847 Ga0496101_0788223
848 Ga0496102_0029545
849 Ga0496102_0235733
850 Ga0496102_0659195
851 Ga0496103_0139716
852 Ga0496103_0784540
853 Ga0496104_0200946
854 Ga0496105_0174636
855 Ga0496106_1011958
856 Ga0496107_0055724
857 Ga0496107_0181723
858 Ga0496108_0102241
859 Ga0496108_0124814
860 Ga0496108_0457401
861 Ga0496108_1235622
862 Ga0496109_0125464
863 Ga0496109_0748912
864 Ga0496110_0437650
865 Ga0496110_0445309
866 Ga0496112_0121887
867 Ga0496112_0315785
868 Ga0496112_0401103
869 Ga0496113_1090484
870 Ga0496114_0082013
871 Ga0496115_0002115
872 Ga0496115_0165120
873 Ga0496115_0417476
874 Ga0496115_0429721
875 Ga0501067_0420877
876 Ga0501068_0300330
877 Ga0501069_0304516
878 nmdc:mga05p37_121365_c1
879 nmdc:mga0rr50_818353_c1
880 nmdc:mga08x19_40872_c1
881 nmdc:mga08x19_4587_c1
882 nmdc:mga08x19_71503_c1
883 nmdc:mga0a205_263405_c1
884 Ga0495601_0000516
885 Ga0495595_0087317
886 Ga0495619_0574120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

11

158

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p83-assembly1.cif.gz_A structure of engineered pyrr protein (purple pyrr) 0.9627 13 184
4p80-assembly1.cif.gz_B structure of ancestral pyrr protein (ancgreenpyrr) 0.9591 11 187
4p81-assembly1.cif.gz_B structure of ancestral pyrr protein (ancorangepyrr) 0.9557 11 187
4p81-assembly1.cif.gz_A structure of ancestral pyrr protein (ancorangepyrr) 0.9557 11 187
4p81-assembly1.cif.gz_D structure of ancestral pyrr protein (ancorangepyrr) 0.9549 9 187
ID Description Score Start End Superfamily
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9506 13 186 3.40.50.2020
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9345 13 186 3.40.50.2020
4rhtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8583 14 160 3.40.50.2020
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8434 1 186 3.40.50.2020
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8279 1 186 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A2V6S976-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR 0.9593 100 189 GO:0016757
AF-A0A2V5L737-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR 0.9585 98 187 GO:0016757
AF-A0A4Y1ZBX1-F1-model_v4 Uracil phosphoribosyltransferase (EC 2.4.2.9) 0.9583 97 187 GO:0004845
AF-W4TDL9-F1-model_v4 deleted 0.9552 105 189
AF-A0A2V5L737-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR 0.9483 98 187 GO:0016757

Map