F445053

General Info

Members Datasets Scaffolds Average Seq Length
443 312 886 235

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10006750|Ga0081455_100067503
Length 229
Sequence MDDTMPILLVPGLVSSPRIFAPVVPALWRLGPVTVANHIRDDNMGAIARRILAEAPPRFALAGHSMGGYVAKLALINTQARSDTPEAMERRRGMMARAKAGEYRAVLDELFPGFVHPSRRDDASLRQLVHDMGEDVGVDGFVRQQTAMIGRPDSRPALAWIKCPTLVLTGDEDNTIPNSLSKEMADGIHGAKLVILPNCGHLPQPEQPEATAAALIEWLRSDVSLQGCR

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
48 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
116 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
117 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
118 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
122 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
123 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
253 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
256 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
257 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
258 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
259 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
260 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
264 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
265 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
266 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
267 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
268 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
269 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
270 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
271 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
272 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
273 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
274 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
275 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
276 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
277 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
278 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
279 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
280 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
281 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
282 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
283 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
284 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
285 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
286 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
287 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
288 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
289 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
290 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
291 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
292 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
293 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
294 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
295 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
296 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
297 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
298 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
299 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
300 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
301 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
302 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
303 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
304 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
305 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
306 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
307 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
308 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
309 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
310 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
311 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
312 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.71
Metatranscriptomes 0
Isolates 11.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.71
Nodule 12.19
Rhizoplane 10.38
Rhizosphere 72.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10006750 3300005937 Bacteria 12251
2 Ga0070683_100512151 3300005329 Bacteria 1147
3 Ga0070680_100040776 3300005336 Bacteria 3762
4 Ga0070680_100163789 3300005336 Bacteria 1869
5 Ga0070682_100032099 3300005337 Bacteria 3182
6 Ga0070660_100039088 3300005339 Bacteria 3605
7 Ga0070660_100212683 3300005339 Bacteria 1570
8 Ga0070660_100232236 3300005339 Bacteria 1501
9 Ga0070689_100106005 3300005340 Bacteria 2229
10 Ga0070661_100412181 3300005344 Bacteria 1070
11 Ga0070671_100156904 3300005355 Bacteria 1923
12 Ga0070688_100392388 3300005365 Bacteria 1026
13 Ga0070659_100262041 3300005366 Bacteria 1434
14 Ga0070659_100520045 3300005366 Bacteria 1016
15 Ga0070714_100221028 3300005435 Bacteria 1741
16 Ga0070713_100028314 3300005436 Bacteria 4424
17 Ga0070710_10414228 3300005437 Bacteria 906
18 Ga0070700_100148716 3300005441 Bacteria 1600
19 Ga0070663_100468207 3300005455 Bacteria 1041
20 Ga0070678_100091499 3300005456 Bacteria 2334
21 Ga0070678_100180514 3300005456 Bacteria 1727
22 Ga0070678_100468341 3300005456 Bacteria 1106
23 Ga0070662_100169124 3300005457 Bacteria 1715
24 Ga0070681_10006922 3300005458 Bacteria 11040
25 Ga0070681_10489601 3300005458 Bacteria 1143
26 Ga0068867_100093764 3300005459 Bacteria 2282
27 Ga0068867_100435341 3300005459 Bacteria 1114
28 Ga0070707_100048023 3300005468 Bacteria 4088
29 Ga0070679_100009813 3300005530 Bacteria 9057
30 Ga0070679_100174010 3300005530 Bacteria 2125
31 Ga0070697_100418191 3300005536 Bacteria 1165
32 Ga0068853_100097762 3300005539 Bacteria 2592
33 Ga0070693_100088387 3300005547 Bacteria 1863
34 Ga0070665_100237354 3300005548 Bacteria 1824
35 Ga0070704_100477158 3300005549 Bacteria 1078
36 Ga0068855_100005422 3300005563 Bacteria 15556
37 Ga0068855_100040432 3300005563 Bacteria 5534
38 Ga0070664_100106899 3300005564 Bacteria 2439
39 Ga0068857_100060207 3300005577 Bacteria 3373
40 Ga0068852_100022549 3300005616 Bacteria 5051
41 Ga0068852_100129894 3300005616 Bacteria 2319
42 Ga0068852_100166808 3300005616 Bacteria 2061
43 Ga0068864_100161309 3300005618 Bacteria 2038
44 Ga0068866_10236296 3300005718 Bacteria 1111
45 Ga0068861_100142701 3300005719 Bacteria 1956
46 Ga0068851_10009080 3300005834 Bacteria 4614
47 Ga0068870_10203497 3300005840 Bacteria 1202
48 Ga0068858_100048191 3300005842 Bacteria 3949
49 Ga0068860_100862362 3300005843 Bacteria 920
50 Ga0081540_1008647 3300005983 Bacteria 7094
51 Ga0081540_1011097 3300005983 Bacteria 6048
52 Ga0081540_1034303 3300005983 Bacteria 2740
53 Ga0081540_1091739 3300005983 Bacteria 1335
54 Ga0070717_10002541 3300006028 Bacteria 12852
55 Ga0070715_10105387 3300006163 Bacteria 1322
56 Ga0070712_100015691 3300006175 Bacteria 4882
57 Ga0070712_100302119 3300006175 Bacteria 1296
58 Ga0075367_10135458 3300006178 Bacteria 1523
59 Ga0097621_100146379 3300006237 Bacteria 2023
60 Ga0075370_10198718 3300006353 Bacteria 1182
61 Ga0075370_10305479 3300006353 Bacteria 946
62 Ga0075434_100391437 3300006871 Bacteria 1411
63 Ga0068865_100057309 3300006881 Bacteria 2717
64 Ga0068865_100160612 3300006881 Bacteria 1714
65 Ga0068865_100489266 3300006881 Bacteria 1024
66 Ga0099824_1006625 3300006942 Bacteria 15796
67 Ga0099822_1003046 3300006943 Bacteria 21323
68 Ga0075435_100547885 3300007076 Bacteria 1002
69 Ga0105240_10050464 3300009093 Bacteria 5245
70 Ga0105240_10222116 3300009093 Bacteria 2200
71 Ga0111539_10450617 3300009094 Bacteria 1498
72 Ga0105245_10025025 3300009098 Bacteria 5247
73 Ga0105245_10205525 3300009098 Bacteria 1893
74 Ga0105245_10377361 3300009098 Bacteria 1411
75 Ga0105245_10919660 3300009098 Bacteria 917
76 Ga0105247_10464484 3300009101 Bacteria 915
77 Ga0105243_10164457 3300009148 Bacteria 1916
78 Ga0105243_10597600 3300009148 Bacteria 1062
79 Ga0105242_10105202 3300009176 Bacteria 2397
80 Ga0105242_10194309 3300009176 Bacteria 1799
81 Ga0105248_10107359 3300009177 Bacteria 3148
82 Ga0105237_10006994 3300009545 Bacteria 12431
83 Ga0105237_10114846 3300009545 Bacteria 2685
84 Ga0105237_10437475 3300009545 Bacteria 1313
85 Ga0105238_10002380 3300009551 Bacteria 18868
86 Ga0105249_10472869 3300009553 Bacteria 1295
87 Ga0105239_10065022 3300010375 Bacteria 4005
88 Ga0105239_10282516 3300010375 Bacteria 1869
89 Ga0105239_10370505 3300010375 Bacteria 1618
90 Ga0157373_10101483 3300013100 Bacteria 2024
91 Ga0157370_10049956 3300013104 Bacteria 3999
92 Ga0157370_10070387 3300013104 Bacteria 3302
93 Ga0157370_10312395 3300013104 Bacteria 1450
94 Ga0157369_10119261 3300013105 Bacteria 2800
95 Ga0157369_11187394 3300013105 Bacteria 779
96 Ga0157374_10062325 3300013296 Bacteria 3495
97 Ga0157378_10474892 3300013297 Bacteria 1245
98 Ga0163162_10259447 3300013306 Bacteria 1870
99 Ga0163162_10600967 3300013306 Bacteria 1226
100 Ga0163162_10625382 3300013306 Bacteria 1202
101 Ga0163162_10877073 3300013306 Bacteria 1011
102 Ga0157372_10488057 3300013307 Bacteria 1436
103 Ga0157375_10109756 3300013308 Bacteria 2855
104 Ga0163163_10044138 3300014325 Bacteria 4373
105 Ga0157380_10042046 3300014326 Bacteria 3571
106 Ga0157379_10182206 3300014968 Bacteria 1897
107 Ga0157379_10266772 3300014968 Bacteria 1556
108 Ga0157379_10336765 3300014968 Bacteria 1379
109 Ga0157376_10103744 3300014969 Bacteria 2490
110 Ga0157376_10449420 3300014969 Bacteria 1257
111 Ga0157376_11208953 3300014969 Bacteria 784
112 Ga0163161_10237324 3300017792 Bacteria 1417
113 Ga0209758_1002619 3300025297 Bacteria 17898
114 Ga0207656_10004381 3300025321 Bacteria 4925
115 Ga0207688_10304682 3300025901 Bacteria 975
116 Ga0207643_10120271 3300025908 Bacteria 1555
117 Ga0207654_10387592 3300025911 Bacteria 969
118 Ga0207707_10149590 3300025912 Bacteria 2041
119 Ga0207695_10165422 3300025913 Bacteria 2141
120 Ga0207695_10234287 3300025913 Bacteria 1739
121 Ga0207671_10003481 3300025914 Bacteria 15659
122 Ga0207663_10011848 3300025916 Bacteria 4694
123 Ga0207660_10330172 3300025917 Bacteria 1219
124 Ga0207657_10024791 3300025919 Bacteria 5545
125 Ga0207649_10449748 3300025920 Bacteria 972
126 Ga0207652_10040785 3300025921 Bacteria 3943
127 Ga0207646_10054831 3300025922 Bacteria 3565
128 Ga0207694_10064055 3300025924 Bacteria 2864
129 Ga0207700_10064044 3300025928 Bacteria 2799
130 Ga0207664_10205930 3300025929 Bacteria 1700
131 Ga0207644_10324919 3300025931 Bacteria 1245
132 Ga0207690_10278376 3300025932 Bacteria 1302
133 Ga0207706_10120580 3300025933 Bacteria 2306
134 Ga0207686_10556058 3300025934 Bacteria 898
135 Ga0207670_10085415 3300025936 Bacteria 2218
136 Ga0207669_10073398 3300025937 Bacteria 2158
137 Ga0207704_10130726 3300025938 Bacteria 1738
138 Ga0207704_10397093 3300025938 Bacteria 1087
139 Ga0207665_10170625 3300025939 Bacteria 1571
140 Ga0207665_10270705 3300025939 Bacteria 1261
141 Ga0207711_10653590 3300025941 Bacteria 981
142 Ga0207661_10059472 3300025944 Bacteria 3080
143 Ga0207679_10401804 3300025945 Bacteria 1205
144 Ga0207667_10004411 3300025949 Bacteria 17229
145 Ga0207667_10060224 3300025949 Bacteria 3974
146 Ga0207651_10305331 3300025960 Bacteria 1325
147 Ga0207668_10035725 3300025972 Bacteria 3311
148 Ga0207639_10123398 3300026041 Bacteria 2132
149 Ga0207639_10171182 3300026041 Bacteria 1839
150 Ga0207678_10092003 3300026067 Bacteria 2592
151 Ga0207678_10129125 3300026067 Bacteria 2155
152 Ga0207678_10169719 3300026067 Bacteria 1863
153 Ga0207678_10485966 3300026067 Bacteria 1075
154 Ga0207708_10166098 3300026075 Bacteria 1745
155 Ga0207702_10502190 3300026078 Bacteria 1182
156 Ga0207702_10542825 3300026078 Bacteria 1137
157 Ga0207648_10069971 3300026089 Bacteria 3058
158 Ga0207648_10386504 3300026089 Bacteria 1266
159 Ga0207676_10128665 3300026095 Bacteria 2149
160 Ga0207674_10022229 3300026116 Bacteria 6815
161 Ga0207675_100455140 3300026118 Bacteria 1269
162 Ga0207683_10052450 3300026121 Bacteria 3574
163 Ga0207683_10104863 3300026121 Bacteria 2527
164 Ga0207683_10150524 3300026121 Bacteria 2100
165 Ga0207698_10060239 3300026142 Bacteria 2951
166 Ga0207698_10096075 3300026142 Bacteria 2441
167 Ga0209589_1000007 3300027357 Bacteria 425699
168 Ga0209489_100008 3300027361 Bacteria 425699
169 Ga0209700_100009 3300027363 Bacteria 425699
170 Ga0209179_1037603 3300027512 Bacteria 1011
171 Ga0207428_10291542 3300027907 Bacteria 1209
172 Ga0268266_10121094 3300028379 Bacteria 2329
173 Ga0268266_10160385 3300028379 Bacteria 2034
174 Ga0265334_10029829 3300028573 Bacteria 2185
175 Ga0265323_10000820 3300028653 Bacteria 16653
176 Ga0265336_10000162 3300028666 Bacteria 47251
177 Ga0307515_10303733 3300028794 Bacteria 1278
178 Ga0265338_10001052 3300028800 Bacteria 46097
179 Ga0265324_10031744 3300029957 Bacteria 1848
180 Ga0307513_10152273 3300031456 Bacteria 2219
181 Ga0307513_10374870 3300031456 Bacteria 1164
182 Ga0307516_10037652 3300031730 Bacteria 4833
183 Ga0307510_10136648 3300033180 Bacteria 2107
184 Ga0373949_0031359 3300035090 Bacteria 1267
185 Ga0373923_0062266 3300035111 Bacteria 1587
186 Ga0373945_0127965 3300035116 Bacteria 1015
187 Ga0373954_0006596 3300035118 Bacteria 5064
188 Ga0373956_0049422 3300035119 Bacteria 1886
189 Ga0373957_0137489 3300035120 Bacteria 997
190 Ga0373943_0071513 3300035170 Bacteria 1758
191 Ga0373943_0085532 3300035170 Bacteria 1624
192 Ga0373946_0208726 3300035171 Bacteria 938
193 Ga0373955_0009928 3300035172 Bacteria 4480
194 Ga0373924_0104535 3300035410 Bacteria 1220
195 Ga0373931_0053542 3300035691 Bacteria 2153
196 Ga0373935_0008425 3300035692 Bacteria 6170
197 Ga0373935_0042351 3300035692 Bacteria 2863
198 Ga0373935_0248925 3300035692 Bacteria 1243
199 Ga0373935_0308132 3300035692 Bacteria 1121
200 Ga0373935_0361143 3300035692 Bacteria 1037
201 Ga0373927_0006645 3300035695 Bacteria 7871
202 Ga0373927_0006826 3300035695 Bacteria 7769
203 Ga0373927_0021630 3300035695 Bacteria 4217
204 Ga0373927_0045858 3300035695 Bacteria 2828
205 Ga0373927_0081815 3300035695 Bacteria 2093
206 Ga0373947_0006023 3300035725 Bacteria 7069
207 Ga0373947_0013049 3300035725 Bacteria 4764
208 Ga0373937_0042688 3300036401 Bacteria 4137
209 Ga0373925_0037456 3300037068 Bacteria 3581
210 Ga0373925_0120174 3300037068 Bacteria 2039
211 Ga0373925_0716000 3300037068 Bacteria 825
212 Ga0395899_0166558 3300037312 Bacteria 1554
213 Ga0451793_1349609 3300041452 Bacteria 1165
214 Ga0466965_0046444 3300044683 Bacteria 2150
215 Ga0495617_055865 3300046452 Bacteria 1309
216 Ga0495592_0029853 3300046454 Bacteria 4125
217 Ga0495603_0005555 3300046455 Bacteria 7527
218 Ga0495603_0082894 3300046455 Bacteria 1878
219 Ga0495590_0145666 3300046457 Bacteria 857
220 Ga0495629_0007263 3300046459 Bacteria 8160
221 Ga0495638_0166743 3300046460 Bacteria 1266
222 Ga0495641_0120713 3300046461 Bacteria 1169
223 Ga0495651_0050353 3300046462 Bacteria 3213
224 Ga0495653_0125842 3300046463 Bacteria 1820
225 Ga0495580_0005267 3300046472 Bacteria 10742
226 Ga0495582_0003611 3300046473 Bacteria 8716
227 Ga0495582_0091086 3300046473 Bacteria 1700
228 Ga0495582_0263721 3300046473 Bacteria 988
229 Ga0495639_0183601 3300046475 Bacteria 1019
230 Ga0495664_0138460 3300046477 Bacteria 1475
231 Ga0495584_0101571 3300046491 Bacteria 1454
232 Ga0495584_0125298 3300046491 Bacteria 1302
233 Ga0495594_0188767 3300046499 Bacteria 1174
234 Ga0495606_0005306 3300046507 Bacteria 12411
235 Ga0495606_0135194 3300046507 Bacteria 1461
236 Ga0495608_0046093 3300046511 Bacteria 2902
237 Ga0495628_0058654 3300046516 Bacteria 3023
238 Ga0495630_0011826 3300046517 Bacteria 6324
239 Ga0495630_0084574 3300046517 Bacteria 2395
240 Ga0495631_0184713 3300046518 Bacteria 893
241 Ga0495663_0056853 3300046525 Bacteria 1223
242 Ga0495652_0012377 3300046529 Bacteria 7698
243 Ga0495652_0038740 3300046529 Bacteria 4127
244 Ga0495665_0000574 3300046531 Bacteria 18692
245 Ga0495640_0009028 3300046533 Bacteria 7781
246 Ga0495640_0202492 3300046533 Bacteria 1257
247 Ga0495587_0018200 3300046536 Bacteria 4357
248 Ga0495598_0051969 3300046537 Bacteria 1237
249 Ga0495609_0084826 3300046538 Bacteria 1382
250 Ga0495645_0031137 3300046543 Bacteria 3886
251 Ga0495622_0009179 3300046557 Bacteria 4577
252 Ga0495667_0018078 3300046559 Bacteria 4762
253 Ga0495668_0046201 3300046616 Bacteria 2419
254 Ga0495668_0222734 3300046616 Bacteria 1033
255 Ga0495634_0003485 3300046642 Bacteria 12608
256 Ga0495634_0091038 3300046642 Bacteria 1980
257 Ga0495625_0082863 3300046660 Bacteria 2230
258 Ga0495625_0299771 3300046660 Bacteria 1029
259 Ga0495625_0316895 3300046660 Bacteria 994
260 Ga0495635_0005641 3300046663 Bacteria 8719
261 Ga0495588_0004042 3300046674 Bacteria 6449
262 Ga0495588_0202822 3300046674 Bacteria 1048
263 Ga0495599_0012392 3300046678 Bacteria 5254
264 Ga0495623_0037303 3300046679 Bacteria 3111
265 Ga0495647_0005199 3300046681 Bacteria 4262
266 Ga0495658_0003286 3300046683 Bacteria 8034
267 Ga0495669_0065691 3300046684 Bacteria 1647
268 Ga0495613_0009244 3300046689 Bacteria 7310
269 Ga0495624_0006254 3300046690 Bacteria 8468
270 Ga0495671_0131610 3300046692 Bacteria 1220
271 Ga0495581_0077495 3300047315 Bacteria 1923
272 Ga0495581_0238765 3300047315 Bacteria 1063
273 Ga0495674_0013763 3300047319 Bacteria 7594
274 Ga0495674_0105936 3300047319 Bacteria 2388
275 Ga0495674_0232178 3300047319 Bacteria 1522
276 Ga0495672_0023955 3300047320 Bacteria 3940
277 Ga0495672_0183839 3300047320 Bacteria 1056
278 Ga0495672_0241072 3300047320 Bacteria 883
279 Ga0495676_0027350 3300047321 Bacteria 4891
280 Ga0495676_0343285 3300047321 Bacteria 999
281 Ga0495680_0069268 3300047322 Bacteria 2692
282 Ga0495677_0139044 3300047445 Bacteria 932
283 Ga0495684_0062136 3300047471 Bacteria 2841
284 Ga0495684_0242054 3300047471 Bacteria 1315
285 Ga0495686_0046454 3300047472 Bacteria 2745
286 Ga0495686_0249412 3300047472 Bacteria 998
287 Ga0495593_0002074 3300047673 Bacteria 11971
288 Ga0495614_0019098 3300048089 Bacteria 2967
289 Ga0496100_0036096 3300048903 Bacteria 3115
290 Ga0496100_0208730 3300048903 Bacteria 1427
291 Ga0496100_0492816 3300048903 Bacteria 943
292 Ga0496101_0002155 3300048904 Bacteria 12022
293 Ga0496101_0011056 3300048904 Bacteria 5979
294 Ga0496101_0081295 3300048904 Bacteria 2396
295 Ga0496102_0133587 3300048905 Bacteria 2324
296 Ga0496102_0233888 3300048905 Bacteria 1732
297 Ga0496102_0463009 3300048905 Bacteria 1189
298 Ga0496103_0018497 3300048906 Bacteria 4179
299 Ga0496103_0041568 3300048906 Bacteria 2826
300 Ga0496104_0013476 3300048907 Bacteria 7366
301 Ga0496104_0077442 3300048907 Bacteria 3168
302 Ga0496105_0025831 3300048908 Bacteria 4784
303 Ga0496105_0150753 3300048908 Bacteria 1911
304 Ga0496106_0002840 3300048909 Bacteria 12855
305 Ga0496106_0035027 3300048909 Bacteria 3752
306 Ga0496106_0058579 3300048909 Bacteria 2916
307 Ga0496106_0110755 3300048909 Bacteria 2137
308 Ga0496107_0002239 3300048910 Bacteria 12464
309 Ga0496107_0010734 3300048910 Bacteria 6370
310 Ga0496108_0006250 3300048911 Bacteria 9646
311 Ga0496108_0016657 3300048911 Bacteria 6003
312 Ga0496108_0191376 3300048911 Bacteria 1773
313 Ga0496109_0001128 3300048912 Bacteria 22231
314 Ga0496110_0026171 3300048913 Bacteria 4990
315 Ga0496110_0089003 3300048913 Bacteria 2758
316 Ga0496110_0110552 3300048913 Bacteria 2469
317 Ga0496111_0004867 3300048914 Bacteria 8524
318 Ga0496111_0032036 3300048914 Bacteria 3747
319 Ga0496111_0091962 3300048914 Bacteria 2223
320 Ga0496112_0008080 3300048915 Bacteria 9395
321 Ga0496112_0035482 3300048915 Bacteria 4858
322 Ga0496112_0099507 3300048915 Bacteria 2877
323 Ga0496112_0435271 3300048915 Bacteria 1250
324 Ga0496113_0021169 3300048916 Bacteria 4584
325 Ga0496113_0336113 3300048916 Bacteria 1211
326 Ga0496114_0039861 3300048917 Bacteria 3887
327 Ga0496114_0062094 3300048917 Bacteria 3126
328 Ga0496114_0162960 3300048917 Bacteria 1940
329 Ga0496115_0014158 3300048918 Bacteria 6035
330 Ga0496115_0040723 3300048918 Bacteria 3695
331 Ga0496115_0075311 3300048918 Bacteria 2741
332 Ga0496115_0093326 3300048918 Bacteria 2461
333 Ga0496115_0117228 3300048918 Bacteria 2190
334 Ga0496122_0070229 3300048925 Bacteria 2504
335 Ga0496126_0005900 3300048929 Bacteria 13814
336 Ga0496126_0009574 3300048929 Bacteria 10276
337 Ga0496126_0261134 3300048929 Bacteria 1440
338 Ga0496126_0384291 3300048929 Bacteria 1142
339 Ga0501031_0000720 3300049568 Bacteria 19831
340 Ga0501032_0001318 3300049569 Bacteria 19897
341 Ga0501032_0067062 3300049569 Bacteria 2398
342 Ga0501033_0000060 3300049570 Bacteria 103159
343 Ga0501033_0038853 3300049570 Bacteria 3555
344 Ga0501033_0087245 3300049570 Bacteria 2284
345 Ga0501034_0000117 3300049571 Bacteria 144865
346 Ga0501034_0346129 3300049571 Bacteria 1416
347 Ga0501036_0000349 3300049572 Bacteria 32571
348 Ga0501037_0000561 3300049573 Bacteria 29494
349 Ga0501038_0000570 3300049574 Bacteria 32618
350 Ga0501039_0001028 3300049575 Bacteria 20380
351 Ga0501042_0460357 3300049578 Bacteria 922
352 Ga0501043_0000972 3300049579 Bacteria 25318
353 Ga0501043_0015768 3300049579 Bacteria 5924
354 Ga0501046_0000214 3300049580 Bacteria 60379
355 Ga0501047_0000246 3300049581 Bacteria 64361
356 Ga0501047_0261965 3300049581 Bacteria 1576
357 Ga0501047_0430562 3300049581 Bacteria 1150
358 Ga0501048_0000899 3300049582 Bacteria 21965
359 Ga0501067_0010310 3300049583 Bacteria 5171
360 Ga0501067_0027422 3300049583 Bacteria 3156
361 Ga0501068_0012303 3300049584 Bacteria 4844
362 Ga0501069_0003904 3300049585 Bacteria 7687
363 Ga0501070_0034614 3300049586 Bacteria 4221
364 Ga0501070_0675864 3300049586 Bacteria 818
365 Ga0501071_0090340 3300049587 Bacteria 2249
366 Ga0501072_0002027 3300049588 Bacteria 15079
367 Ga0501073_0000093 3300049589 Bacteria 56882
368 Ga0501074_0000410 3300049590 Bacteria 25626
369 Ga0501079_0073280 3300049741 Bacteria 2646
370 Ga0501080_0006304 3300049742 Bacteria 10643
371 Ga0501083_0001291 3300049744 Bacteria 16946
372 Ga0501035_0000212 3300049822 Bacteria 69856
373 Ga0501044_0001196 3300049823 Bacteria 30769
374 Ga0501044_0149869 3300049823 Bacteria 2315
375 Ga0501044_0193934 3300049823 Bacteria 1992
376 Ga0501045_0012612 3300049824 Bacteria 5950
377 nmdc:mga03n38_161378_c1 3300050490 Bacteria 1135
378 nmdc:mga0k408_533914_c1 3300050493 Bacteria 694
379 nmdc:mga08y16_763961_c1 3300050511 Bacteria 962
380 nmdc:mga0n895_115281_c1 3300050512 Bacteria 2705
381 nmdc:mga0rr50_485019_c1 3300050513 Bacteria 1050
382 Ga0495612_0014557 3300053078 Bacteria 3161
383 Ga0495612_0107814 3300053078 Bacteria 1190
384 Ga0495655_0023328 3300053083 Bacteria 1426
385 Ga0495619_0349894 3300053085 Bacteria 1022
386 Ga0500595_002906 3300053119 Bacteria 8201
387 Ga0500577_0005168 3300053142 Bacteria 3498
388 Ga0500589_042251 3300053147 Bacteria 2126
389 Ga0500604_0065746 3300053151 Bacteria 1148
390 Ga0500634_0111034 3300053161 Bacteria 1353
391 Ga0500611_003981 3300053727 Bacteria 1949
392 Ga0501084_0002218 3300054114 Bacteria 15588
393 Ga0501082_0009395 3300060353 Bacteria 8419
394 2507511828 2507262055 Bacteria 8048963
395 2508545495 2508501009 Bacteria 7784016
396 2508694313 2508501042 Bacteria 8719808
397 2515624764 2515154112 Bacteria 8294334
398 2879131302 2879127579 Bacteria 8294491
399 2879144653 2879142872 Bacteria 8267021
400 2881371179 2881364244 Bacteria 7710352
401 2935613532 2935608549 Bacteria 8203142
402 2935650522 2935648319 Bacteria 8801166
403 2935662964 2935656913 Bacteria 8965014
404 2935776588 2935769743 Bacteria 7878163
405 2935781426 2935777560 Bacteria 8077691
406 2935792522 2935785616 Bacteria 7962367
407 2935797991 2935793552 Bacteria 8012592
408 2935824615 2935819856 Bacteria 8261050
409 2935851835 2935847175 Bacteria 8228321
410 2935911188 2935908558 Bacteria 8568796
411 2935920720 2935916978 Bacteria 9113783
412 2935928217 2935926038 Bacteria 8601059
413 2935937862 2935934488 Bacteria 8602579
414 2935945144 2935942939 Bacteria 8599779
415 2935954351 2935951376 Bacteria 8602333
416 2935971382 2935967501 Bacteria 8603075
417 2935981987 2935975950 Bacteria 8347125
418 2935990805 2935984226 Bacteria 8302647
419 2936017122 2936011229 Bacteria 8801034
420 2936026743 2936019824 Bacteria 8804134
421 2936035486 2936028420 Bacteria 8965941
422 2936053635 2936046547 Bacteria 8903709
423 2936062710 2936055302 Bacteria 8785755
424 8016524815 8016522445 Bacteria 8156687
425 8016538384 8016530956 Bacteria 8155261
426 8016542667 8016539877 Bacteria 8155419
427 8016559032 8016557553 Bacteria 8154380
428 8016568047 8016566248 Bacteria 8158151
429 8016580732 8016575299 Bacteria 8154085
430 8016596987 8016595262 Bacteria 8149947
431 8016607891 8016603502 Bacteria 8731218
432 8016619675 8016613128 Bacteria 8794220
433 8016629938 8016622563 Bacteria 7999408
434 8016637254 8016630954 Bacteria 9217207
435 8019538055 8019530166 Bacteria 8155624
436 8019541926 8019538911 Bacteria 7872763
437 8019548872 8019547302 Bacteria 7996444
438 8019624209 8019619141 Bacteria 9218857
439 8019637816 8019629233 Bacteria 8687553
440 8019641810 8019638758 Bacteria 9062356
441 8019675268 8019668869 Bacteria 8791617
442 8019680840 8019678201 Bacteria 8863603
443 8019694944 8019687851 Bacteria 8712826
444 Ga0081455_10006750
445 Ga0070683_100512151
446 Ga0070680_100040776
447 Ga0070680_100163789
448 Ga0070682_100032099
449 Ga0070660_100039088
450 Ga0070660_100212683
451 Ga0070660_100232236
452 Ga0070689_100106005
453 Ga0070661_100412181
454 Ga0070671_100156904
455 Ga0070688_100392388
456 Ga0070659_100262041
457 Ga0070659_100520045
458 Ga0070714_100221028
459 Ga0070713_100028314
460 Ga0070710_10414228
461 Ga0070700_100148716
462 Ga0070663_100468207
463 Ga0070678_100091499
464 Ga0070678_100180514
465 Ga0070678_100468341
466 Ga0070662_100169124
467 Ga0070681_10006922
468 Ga0070681_10489601
469 Ga0068867_100093764
470 Ga0068867_100435341
471 Ga0070707_100048023
472 Ga0070679_100009813
473 Ga0070679_100174010
474 Ga0070697_100418191
475 Ga0068853_100097762
476 Ga0070693_100088387
477 Ga0070665_100237354
478 Ga0070704_100477158
479 Ga0068855_100005422
480 Ga0068855_100040432
481 Ga0070664_100106899
482 Ga0068857_100060207
483 Ga0068852_100022549
484 Ga0068852_100129894
485 Ga0068852_100166808
486 Ga0068864_100161309
487 Ga0068866_10236296
488 Ga0068861_100142701
489 Ga0068851_10009080
490 Ga0068870_10203497
491 Ga0068858_100048191
492 Ga0068860_100862362
493 Ga0081540_1008647
494 Ga0081540_1011097
495 Ga0081540_1034303
496 Ga0081540_1091739
497 Ga0070717_10002541
498 Ga0070715_10105387
499 Ga0070712_100015691
500 Ga0070712_100302119
501 Ga0075367_10135458
502 Ga0097621_100146379
503 Ga0075370_10198718
504 Ga0075370_10305479
505 Ga0075434_100391437
506 Ga0068865_100057309
507 Ga0068865_100160612
508 Ga0068865_100489266
509 Ga0099824_1006625
510 Ga0099822_1003046
511 Ga0075435_100547885
512 Ga0105240_10050464
513 Ga0105240_10222116
514 Ga0111539_10450617
515 Ga0105245_10025025
516 Ga0105245_10205525
517 Ga0105245_10377361
518 Ga0105245_10919660
519 Ga0105247_10464484
520 Ga0105243_10164457
521 Ga0105243_10597600
522 Ga0105242_10105202
523 Ga0105242_10194309
524 Ga0105248_10107359
525 Ga0105237_10006994
526 Ga0105237_10114846
527 Ga0105237_10437475
528 Ga0105238_10002380
529 Ga0105249_10472869
530 Ga0105239_10065022
531 Ga0105239_10282516
532 Ga0105239_10370505
533 Ga0157373_10101483
534 Ga0157370_10049956
535 Ga0157370_10070387
536 Ga0157370_10312395
537 Ga0157369_10119261
538 Ga0157369_11187394
539 Ga0157374_10062325
540 Ga0157378_10474892
541 Ga0163162_10259447
542 Ga0163162_10600967
543 Ga0163162_10625382
544 Ga0163162_10877073
545 Ga0157372_10488057
546 Ga0157375_10109756
547 Ga0163163_10044138
548 Ga0157380_10042046
549 Ga0157379_10182206
550 Ga0157379_10266772
551 Ga0157379_10336765
552 Ga0157376_10103744
553 Ga0157376_10449420
554 Ga0157376_11208953
555 Ga0163161_10237324
556 Ga0209758_1002619
557 Ga0207656_10004381
558 Ga0207688_10304682
559 Ga0207643_10120271
560 Ga0207654_10387592
561 Ga0207707_10149590
562 Ga0207695_10165422
563 Ga0207695_10234287
564 Ga0207671_10003481
565 Ga0207663_10011848
566 Ga0207660_10330172
567 Ga0207657_10024791
568 Ga0207649_10449748
569 Ga0207652_10040785
570 Ga0207646_10054831
571 Ga0207694_10064055
572 Ga0207700_10064044
573 Ga0207664_10205930
574 Ga0207644_10324919
575 Ga0207690_10278376
576 Ga0207706_10120580
577 Ga0207686_10556058
578 Ga0207670_10085415
579 Ga0207669_10073398
580 Ga0207704_10130726
581 Ga0207704_10397093
582 Ga0207665_10170625
583 Ga0207665_10270705
584 Ga0207711_10653590
585 Ga0207661_10059472
586 Ga0207679_10401804
587 Ga0207667_10004411
588 Ga0207667_10060224
589 Ga0207651_10305331
590 Ga0207668_10035725
591 Ga0207639_10123398
592 Ga0207639_10171182
593 Ga0207678_10092003
594 Ga0207678_10129125
595 Ga0207678_10169719
596 Ga0207678_10485966
597 Ga0207708_10166098
598 Ga0207702_10502190
599 Ga0207702_10542825
600 Ga0207648_10069971
601 Ga0207648_10386504
602 Ga0207676_10128665
603 Ga0207674_10022229
604 Ga0207675_100455140
605 Ga0207683_10052450
606 Ga0207683_10104863
607 Ga0207683_10150524
608 Ga0207698_10060239
609 Ga0207698_10096075
610 Ga0209589_1000007
611 Ga0209489_100008
612 Ga0209700_100009
613 Ga0209179_1037603
614 Ga0207428_10291542
615 Ga0268266_10121094
616 Ga0268266_10160385
617 Ga0265334_10029829
618 Ga0265323_10000820
619 Ga0265336_10000162
620 Ga0307515_10303733
621 Ga0265338_10001052
622 Ga0265324_10031744
623 Ga0307513_10152273
624 Ga0307513_10374870
625 Ga0307516_10037652
626 Ga0307510_10136648
627 Ga0373949_0031359
628 Ga0373923_0062266
629 Ga0373945_0127965
630 Ga0373954_0006596
631 Ga0373956_0049422
632 Ga0373957_0137489
633 Ga0373943_0071513
634 Ga0373943_0085532
635 Ga0373946_0208726
636 Ga0373955_0009928
637 Ga0373924_0104535
638 Ga0373931_0053542
639 Ga0373935_0008425
640 Ga0373935_0042351
641 Ga0373935_0248925
642 Ga0373935_0308132
643 Ga0373935_0361143
644 Ga0373927_0006645
645 Ga0373927_0006826
646 Ga0373927_0021630
647 Ga0373927_0045858
648 Ga0373927_0081815
649 Ga0373947_0006023
650 Ga0373947_0013049
651 Ga0373937_0042688
652 Ga0373925_0037456
653 Ga0373925_0120174
654 Ga0373925_0716000
655 Ga0395899_0166558
656 Ga0451793_1349609
657 Ga0466965_0046444
658 Ga0495617_055865
659 Ga0495592_0029853
660 Ga0495603_0005555
661 Ga0495603_0082894
662 Ga0495590_0145666
663 Ga0495629_0007263
664 Ga0495638_0166743
665 Ga0495641_0120713
666 Ga0495651_0050353
667 Ga0495653_0125842
668 Ga0495580_0005267
669 Ga0495582_0003611
670 Ga0495582_0091086
671 Ga0495582_0263721
672 Ga0495639_0183601
673 Ga0495664_0138460
674 Ga0495584_0101571
675 Ga0495584_0125298
676 Ga0495594_0188767
677 Ga0495606_0005306
678 Ga0495606_0135194
679 Ga0495608_0046093
680 Ga0495628_0058654
681 Ga0495630_0011826
682 Ga0495630_0084574
683 Ga0495631_0184713
684 Ga0495663_0056853
685 Ga0495652_0012377
686 Ga0495652_0038740
687 Ga0495665_0000574
688 Ga0495640_0009028
689 Ga0495640_0202492
690 Ga0495587_0018200
691 Ga0495598_0051969
692 Ga0495609_0084826
693 Ga0495645_0031137
694 Ga0495622_0009179
695 Ga0495667_0018078
696 Ga0495668_0046201
697 Ga0495668_0222734
698 Ga0495634_0003485
699 Ga0495634_0091038
700 Ga0495625_0082863
701 Ga0495625_0299771
702 Ga0495625_0316895
703 Ga0495635_0005641
704 Ga0495588_0004042
705 Ga0495588_0202822
706 Ga0495599_0012392
707 Ga0495623_0037303
708 Ga0495647_0005199
709 Ga0495658_0003286
710 Ga0495669_0065691
711 Ga0495613_0009244
712 Ga0495624_0006254
713 Ga0495671_0131610
714 Ga0495581_0077495
715 Ga0495581_0238765
716 Ga0495674_0013763
717 Ga0495674_0105936
718 Ga0495674_0232178
719 Ga0495672_0023955
720 Ga0495672_0183839
721 Ga0495672_0241072
722 Ga0495676_0027350
723 Ga0495676_0343285
724 Ga0495680_0069268
725 Ga0495677_0139044
726 Ga0495684_0062136
727 Ga0495684_0242054
728 Ga0495686_0046454
729 Ga0495686_0249412
730 Ga0495593_0002074
731 Ga0495614_0019098
732 Ga0496100_0036096
733 Ga0496100_0208730
734 Ga0496100_0492816
735 Ga0496101_0002155
736 Ga0496101_0011056
737 Ga0496101_0081295
738 Ga0496102_0133587
739 Ga0496102_0233888
740 Ga0496102_0463009
741 Ga0496103_0018497
742 Ga0496103_0041568
743 Ga0496104_0013476
744 Ga0496104_0077442
745 Ga0496105_0025831
746 Ga0496105_0150753
747 Ga0496106_0002840
748 Ga0496106_0035027
749 Ga0496106_0058579
750 Ga0496106_0110755
751 Ga0496107_0002239
752 Ga0496107_0010734
753 Ga0496108_0006250
754 Ga0496108_0016657
755 Ga0496108_0191376
756 Ga0496109_0001128
757 Ga0496110_0026171
758 Ga0496110_0089003
759 Ga0496110_0110552
760 Ga0496111_0004867
761 Ga0496111_0032036
762 Ga0496111_0091962
763 Ga0496112_0008080
764 Ga0496112_0035482
765 Ga0496112_0099507
766 Ga0496112_0435271
767 Ga0496113_0021169
768 Ga0496113_0336113
769 Ga0496114_0039861
770 Ga0496114_0062094
771 Ga0496114_0162960
772 Ga0496115_0014158
773 Ga0496115_0040723
774 Ga0496115_0075311
775 Ga0496115_0093326
776 Ga0496115_0117228
777 Ga0496122_0070229
778 Ga0496126_0005900
779 Ga0496126_0009574
780 Ga0496126_0261134
781 Ga0496126_0384291
782 Ga0501031_0000720
783 Ga0501032_0001318
784 Ga0501032_0067062
785 Ga0501033_0000060
786 Ga0501033_0038853
787 Ga0501033_0087245
788 Ga0501034_0000117
789 Ga0501034_0346129
790 Ga0501036_0000349
791 Ga0501037_0000561
792 Ga0501038_0000570
793 Ga0501039_0001028
794 Ga0501042_0460357
795 Ga0501043_0000972
796 Ga0501043_0015768
797 Ga0501046_0000214
798 Ga0501047_0000246
799 Ga0501047_0261965
800 Ga0501047_0430562
801 Ga0501048_0000899
802 Ga0501067_0010310
803 Ga0501067_0027422
804 Ga0501068_0012303
805 Ga0501069_0003904
806 Ga0501070_0034614
807 Ga0501070_0675864
808 Ga0501071_0090340
809 Ga0501072_0002027
810 Ga0501073_0000093
811 Ga0501074_0000410
812 Ga0501079_0073280
813 Ga0501080_0006304
814 Ga0501083_0001291
815 Ga0501035_0000212
816 Ga0501044_0001196
817 Ga0501044_0149869
818 Ga0501044_0193934
819 Ga0501045_0012612
820 nmdc:mga03n38_161378_c1
821 nmdc:mga0k408_533914_c1
822 nmdc:mga08y16_763961_c1
823 nmdc:mga0n895_115281_c1
824 nmdc:mga0rr50_485019_c1
825 Ga0495612_0014557
826 Ga0495612_0107814
827 Ga0495655_0023328
828 Ga0495619_0349894
829 Ga0500595_002906
830 Ga0500577_0005168
831 Ga0500589_042251
832 Ga0500604_0065746
833 Ga0500634_0111034
834 Ga0500611_003981
835 Ga0501084_0002218
836 Ga0501082_0009395
837 2507511828
838 2508545495
839 2508694313
840 2515624764
841 2879131302
842 2879144653
843 2881371179
844 2935613532
845 2935650522
846 2935662964
847 2935776588
848 2935781426
849 2935792522
850 2935797991
851 2935824615
852 2935851835
853 2935911188
854 2935920720
855 2935928217
856 2935937862
857 2935945144
858 2935954351
859 2935971382
860 2935981987
861 2935990805
862 2936017122
863 2936026743
864 2936035486
865 2936053635
866 2936062710
867 8016524815
868 8016538384
869 8016542667
870 8016559032
871 8016568047
872 8016580732
873 8016596987
874 8016607891
875 8016619675
876 8016629938
877 8016637254
878 8019538055
879 8019541926
880 8019548872
881 8019624209
882 8019637816
883 8019641810
884 8019675268
885 8019680840
886 8019694944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08386

Abhydrolase_4

TAP-like protein

144

222

0.8

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

7

214

0.56

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dq9-assembly4.cif.gz_D crystal structure of a type-a feruloyl esterase from gut alistipes shahii 0.9018 1 233
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.8998 3 233
7dq9-assembly4.cif.gz_D crystal structure of a type-a feruloyl esterase from gut alistipes shahii 0.8982 1 233
4uhd-assembly1.cif.gz_A structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) 0.8972 5 231
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.8888 3 233
ID Description Score Start End Superfamily
4uhfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8722 5 231 3.40.50.1820
4dgqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.864 5 233 3.40.50.1820
4q3lC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8614 1 233 3.40.50.1820
5h3hA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8613 1 233 3.40.50.1820
4q3lC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.858 1 233 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A537YCD6-F1-model_v4 Alpha/beta fold hydrolase 0.9979 43 233 GO:0016787
AF-A0A537YCD6-F1-model_v4 Alpha/beta fold hydrolase 0.9927 43 233 GO:0016787
AF-A0A7Y0GQY3-F1-model_v4 Alpha/beta fold hydrolase 0.9926 34 232 GO:0016787
AF-A0A1W9IDA1-F1-model_v4 Alpha/beta hydrolase 0.9903 1 233 GO:0016787
AF-A0A833LJ82-F1-model_v4 Alpha/beta fold hydrolase 0.9902 1 231 GO:0016787

Map