F444967

General Info

Members Datasets Scaffolds Average Seq Length
442 273 884 388

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0172464|Ga0496126_0172464_120_1514
Length 445
Sequence MTGSAAVVWDDGLLRYNFGPGHPFDPVRWQLTMALAGELGVLGSQSVTMVSPGPASDAALETVHDGAYIEAVKRAGRELAPDLGHGLGTPDDPVFAGMHEAAALVVGATMAAAESVWSGRADHAVNVAGGHHHAMRAAASGFCVYNDLAAAIRWLLDNGAERVAYVDLDVHHGDGVQSAFYDDPRVLTISLHEHPATLFPGTGLPGETGAGDGEGYAVNVALPAGTGDAGWLRALDAVAVPLLRSFAPTVLVSQHGCDSHRLDPLAHLALSVDGQRQAQLVLHDLAHELCAGRWVATGGGGYALVQVVPRTWAHLLAIAAGQPVAPEPLTMTDGAAFNYVSFASGADPGDPVDRAILRTRSAVFPSHGLAALLFFLAPRPGVVPAGSHDLSGQQCSLTCFFRSHSCQSPPASEGARDSARPKSKNNEAIRGTCSFPYETYPGIRT

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
71 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
125 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
126 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
130 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
148 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
149 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
173 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
238 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 2508501039 Frankia saprophytica CN3 Isolate Nodule
259 2671180195 Frankia sp. CcI49 Isolate Nodule
260 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
261 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
262 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
263 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
264 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
265 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
266 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
267 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
268 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
269 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
270 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
271 8002775197 Frankia nepalensis CN7 Isolate Nodule
272 8002784119 Frankia sp. AgB1.9 Isolate Nodule
273 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.93
Metatranscriptomes 0.45
Isolates 3.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.9
Rhizoplane 3.85
Rhizosphere 90.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0172464 3300048929 Bacteria 1842
2 rootH2_10232367 3300003320 Bacteria 3057
3 JGI25404J52841_10001690 3300003659 Bacteria 3970
4 Ga0070658_10002420 3300005327 Bacteria 15622
5 Ga0070658_10007499 3300005327 Bacteria 8802
6 Ga0070658_10093485 3300005327 Bacteria 2480
7 Ga0070676_10111964 3300005328 Bacteria 1701
8 Ga0070683_100011130 3300005329 Bacteria 7759
9 Ga0070683_100105649 3300005329 Bacteria 2655
10 Ga0070683_100201973 3300005329 Bacteria 1887
11 Ga0068869_100064562 3300005334 Bacteria 2693
12 Ga0070666_10060102 3300005335 Bacteria 2571
13 Ga0070680_100227067 3300005336 Bacteria 1576
14 Ga0068868_100019898 3300005338 Bacteria 5034
15 Ga0068868_100263169 3300005338 Bacteria 1455
16 Ga0070691_10011680 3300005341 Bacteria 4016
17 Ga0070691_10040253 3300005341 Bacteria 2209
18 Ga0070661_100019933 3300005344 Bacteria 4779
19 Ga0070675_100001606 3300005354 Bacteria 16667
20 Ga0070671_100053652 3300005355 Bacteria 3351
21 Ga0070674_100132599 3300005356 Bacteria 1860
22 Ga0070673_100243207 3300005364 Bacteria 1565
23 Ga0070659_100014539 3300005366 Bacteria 5882
24 Ga0070659_100026353 3300005366 Bacteria 4473
25 Ga0070709_10002395 3300005434 Bacteria 10159
26 Ga0070709_10005585 3300005434 Bacteria 6809
27 Ga0070709_10007408 3300005434 Bacteria 6015
28 Ga0070714_100021652 3300005435 Bacteria 5261
29 Ga0070714_100109561 3300005435 Bacteria 2443
30 Ga0070714_100226600 3300005435 Bacteria 1720
31 Ga0070714_100339515 3300005435 Bacteria 1408
32 Ga0070713_100006544 3300005436 Bacteria 8091
33 Ga0070713_100137960 3300005436 Bacteria 2157
34 Ga0070713_100161874 3300005436 Bacteria 1998
35 Ga0070713_100165106 3300005436 Bacteria 1979
36 Ga0070710_10000288 3300005437 Bacteria 23860
37 Ga0070711_100004242 3300005439 Bacteria 8430
38 Ga0070711_100081576 3300005439 Bacteria 2305
39 Ga0070700_100076078 3300005441 Bacteria 2155
40 Ga0070694_100014312 3300005444 Bacteria 4965
41 Ga0070708_100008096 3300005445 Bacteria 8427
42 Ga0070708_100008717 3300005445 Bacteria 8149
43 Ga0070708_100210134 3300005445 Bacteria 1823
44 Ga0070663_100007178 3300005455 Bacteria 6768
45 Ga0070663_100024818 3300005455 Bacteria 4039
46 Ga0070678_100114203 3300005456 Bacteria 2118
47 Ga0070662_100010109 3300005457 Bacteria 6183
48 Ga0070681_10136805 3300005458 Bacteria 2380
49 Ga0070706_100005679 3300005467 Bacteria 11863
50 Ga0070706_100026115 3300005467 Bacteria 5373
51 Ga0070706_100036459 3300005467 Bacteria 4542
52 Ga0070706_100104452 3300005467 Bacteria 2635
53 Ga0070706_100207037 3300005467 Bacteria 1832
54 Ga0070707_100093061 3300005468 Bacteria 2918
55 Ga0070698_100000992 3300005471 Bacteria 31252
56 Ga0070698_100034884 3300005471 Bacteria 5204
57 Ga0070698_100082226 3300005471 Bacteria 3213
58 Ga0070698_100173588 3300005471 Bacteria 2096
59 Ga0070699_100002120 3300005518 Bacteria 18003
60 Ga0070679_100010993 3300005530 Bacteria 8604
61 Ga0070679_100083853 3300005530 Bacteria 3175
62 Ga0070679_100098475 3300005530 Bacteria 2912
63 Ga0070684_100010223 3300005535 Bacteria 7427
64 Ga0070697_100011045 3300005536 Bacteria 7057
65 Ga0070697_100262668 3300005536 Bacteria 1478
66 Ga0068853_100175936 3300005539 Bacteria 1938
67 Ga0070686_100006486 3300005544 Bacteria 6508
68 Ga0070695_100028323 3300005545 Bacteria 3476
69 Ga0070696_100038718 3300005546 Bacteria 3291
70 Ga0070693_100019749 3300005547 Bacteria 3540
71 Ga0068855_100047504 3300005563 Bacteria 5071
72 Ga0068855_100055014 3300005563 Bacteria 4675
73 Ga0068855_100072899 3300005563 Bacteria 3991
74 Ga0070664_100000984 3300005564 Bacteria 22323
75 Ga0070702_100004675 3300005615 Bacteria 6279
76 Ga0070702_100024118 3300005615 Bacteria 3241
77 Ga0068864_100124268 3300005618 Bacteria 2310
78 Ga0068866_10079746 3300005718 Bacteria 1755
79 Ga0068861_100016781 3300005719 Bacteria 5188
80 Ga0068863_100052582 3300005841 Bacteria 3860
81 Ga0068863_100314804 3300005841 Bacteria 1520
82 Ga0068858_100014941 3300005842 Bacteria 7305
83 Ga0068858_100125678 3300005842 Bacteria 2401
84 Ga0068862_100079228 3300005844 Bacteria 2847
85 Ga0068862_100106317 3300005844 Bacteria 2460
86 Ga0081540_1000097 3300005983 Bacteria 92047
87 Ga0070717_10061898 3300006028 Bacteria 3102
88 Ga0070716_100000186 3300006173 Bacteria 24421
89 Ga0070712_100165702 3300006175 Bacteria 1710
90 Ga0097621_100055460 3300006237 Bacteria 3236
91 Ga0068871_100007906 3300006358 Bacteria 7624
92 Ga0068871_100013999 3300006358 Bacteria 5967
93 Ga0075436_100084039 3300006914 Bacteria 2209
94 Ga0105251_10061575 3300009011 Bacteria 1764
95 Ga0105244_10117225 3300009036 Bacteria 1292
96 Ga0105240_10290950 3300009093 Bacteria 1873
97 Ga0111539_10017696 3300009094 Bacteria 8822
98 Ga0105247_10069207 3300009101 Bacteria 2202
99 Ga0105247_10147298 3300009101 Bacteria 1548
100 Ga0105243_10018659 3300009148 Bacteria 5256
101 Ga0105242_10256374 3300009176 Bacteria 1578
102 Ga0105248_10000072 3300009177 Bacteria 117576
103 Ga0105237_10086182 3300009545 Bacteria 3131
104 Ga0105238_10206731 3300009551 Bacteria 1939
105 Ga0105249_10053161 3300009553 Bacteria 3702
106 Ga0105246_10005791 3300011119 Bacteria 7535
107 Ga0105246_10126681 3300011119 Bacteria 1901
108 Ga0157342_1000288 3300012507 Bacteria 2853
109 Ga0157338_1000195 3300012515 Bacteria 3091
110 Ga0157373_10075709 3300013100 Bacteria 2375
111 Ga0157370_10164390 3300013104 Bacteria 2064
112 Ga0157369_10043861 3300013105 Bacteria 4872
113 Ga0157369_10062462 3300013105 Bacteria 4014
114 Ga0157369_10083534 3300013105 Bacteria 3415
115 Ga0157369_10101190 3300013105 Bacteria 3071
116 Ga0157375_10061283 3300013308 Bacteria 3734
117 Ga0163163_10025215 3300014325 Bacteria 5668
118 Ga0157377_10003575 3300014745 Bacteria 7035
119 Ga0157377_10031334 3300014745 Bacteria 2888
120 Ga0157379_10005158 3300014968 Bacteria 11216
121 Ga0157379_10303447 3300014968 Bacteria 1455
122 Ga0157376_10003151 3300014969 Bacteria 11325
123 Ga0206353_11325109 3300020082 Bacteria 1932
124 Ga0213874_10025243 3300021377 Bacteria 1674
125 Ga0213875_10000547 3300021388 Bacteria 30798
126 Ga0213875_10010368 3300021388 Bacteria 4666
127 Ga0224712_10059877 3300022467 Bacteria 1513
128 Ga0228598_1010215 3300024227 Bacteria 1871
129 Ga0207653_10000770 3300025885 Bacteria 10866
130 Ga0207692_10000108 3300025898 Bacteria 24597
131 Ga0207688_10009068 3300025901 Bacteria 5415
132 Ga0207685_10007851 3300025905 Bacteria 3003
133 Ga0207685_10017089 3300025905 Bacteria 2336
134 Ga0207699_10018508 3300025906 Bacteria 3692
135 Ga0207643_10008244 3300025908 Bacteria 5593
136 Ga0207684_10125367 3300025910 Bacteria 2203
137 Ga0207684_10158635 3300025910 Bacteria 1947
138 Ga0207684_10162930 3300025910 Bacteria 1921
139 Ga0207654_10134364 3300025911 Bacteria 1570
140 Ga0207707_10009697 3300025912 Bacteria 8354
141 Ga0207707_10082288 3300025912 Bacteria 2811
142 Ga0207693_10028413 3300025915 Bacteria 4419
143 Ga0207693_10082486 3300025915 Bacteria 2518
144 Ga0207693_10098550 3300025915 Bacteria 2292
145 Ga0207663_10027306 3300025916 Bacteria 3325
146 Ga0207660_10002954 3300025917 Bacteria 11120
147 Ga0207657_10003435 3300025919 Bacteria 16892
148 Ga0207652_10132773 3300025921 Bacteria 2222
149 Ga0207646_10006542 3300025922 Bacteria 12028
150 Ga0207646_10022213 3300025922 Bacteria 5849
151 Ga0207694_10215413 3300025924 Bacteria 1565
152 Ga0207659_10020914 3300025926 Bacteria 4334
153 Ga0207659_10031705 3300025926 Bacteria 3621
154 Ga0207687_10104766 3300025927 Bacteria 2089
155 Ga0207687_10140782 3300025927 Bacteria 1830
156 Ga0207700_10001223 3300025928 Bacteria 14707
157 Ga0207700_10025705 3300025928 Bacteria 4094
158 Ga0207700_10068124 3300025928 Bacteria 2727
159 Ga0207700_10069731 3300025928 Bacteria 2699
160 Ga0207700_10083322 3300025928 Bacteria 2503
161 Ga0207700_10111485 3300025928 Bacteria 2202
162 Ga0207700_10137109 3300025928 Bacteria 2006
163 Ga0207664_10001872 3300025929 Bacteria 13842
164 Ga0207664_10013790 3300025929 Bacteria 5816
165 Ga0207664_10063201 3300025929 Bacteria 2958
166 Ga0207664_10207211 3300025929 Bacteria 1695
167 Ga0207664_10226673 3300025929 Bacteria 1623
168 Ga0207690_10011066 3300025932 Bacteria 5381
169 Ga0207690_10028166 3300025932 Bacteria 3558
170 Ga0207706_10026723 3300025933 Bacteria 5167
171 Ga0207706_10057959 3300025933 Bacteria 3412
172 Ga0207709_10099901 3300025935 Bacteria 1916
173 Ga0207670_10047133 3300025936 Bacteria 2868
174 Ga0207665_10000278 3300025939 Bacteria 35536
175 Ga0207665_10026848 3300025939 Bacteria 3803
176 Ga0207665_10068634 3300025939 Bacteria 2416
177 Ga0207689_10003823 3300025942 Bacteria 13721
178 Ga0207689_10008040 3300025942 Bacteria 9205
179 Ga0207661_10055649 3300025944 Bacteria 3174
180 Ga0207679_10010901 3300025945 Bacteria 5861
181 Ga0207679_10076096 3300025945 Bacteria 2549
182 Ga0207667_10180368 3300025949 Bacteria 2169
183 Ga0207677_10085487 3300026023 Bacteria 2277
184 Ga0207677_10105272 3300026023 Bacteria 2087
185 Ga0207678_10009706 3300026067 Bacteria 8464
186 Ga0207678_10010962 3300026067 Bacteria 7966
187 Ga0207678_10022594 3300026067 Bacteria 5509
188 Ga0207708_10036221 3300026075 Bacteria 3756
189 Ga0207702_10099590 3300026078 Bacteria 2562
190 Ga0207641_10178222 3300026088 Bacteria 1945
191 Ga0207648_10050027 3300026089 Bacteria 3655
192 Ga0207674_10004920 3300026116 Bacteria 15972
193 Ga0207674_10005169 3300026116 Bacteria 15556
194 Ga0207674_10034549 3300026116 Bacteria 5283
195 Ga0207675_100038674 3300026118 Bacteria 4452
196 Ga0207683_10053548 3300026121 Bacteria 3538
197 Ga0207683_10147579 3300026121 Bacteria 2122
198 Ga0207428_10009693 3300027907 Bacteria 8629
199 Ga0265337_1003185 3300028556 Bacteria 7208
200 Ga0265326_10001914 3300028558 Bacteria 7127
201 Ga0265319_1000682 3300028563 Bacteria 22125
202 Ga0265334_10000160 3300028573 Bacteria 41820
203 Ga0265318_10016345 3300028577 Bacteria 3067
204 Ga0265322_10011334 3300028654 Bacteria 2586
205 Ga0265336_10002686 3300028666 Bacteria 7203
206 Ga0265338_10000148 3300028800 Bacteria 128839
207 Ga0265338_10022634 3300028800 Bacteria 6495
208 Ga0265338_10161292 3300028800 Bacteria 1731
209 Ga0265324_10012693 3300029957 Bacteria 3169
210 Ga0265332_10000443 3300031238 Bacteria 29217
211 Ga0265320_10001651 3300031240 Bacteria 15876
212 Ga0265325_10016036 3300031241 Bacteria 4192
213 Ga0265325_10033372 3300031241 Bacteria 2744
214 Ga0265340_10014594 3300031247 Bacteria 4098
215 Ga0265316_10015807 3300031344 Bacteria 6579
216 Ga0307408_100217649 3300031548 Bacteria 1556
217 Ga0316579_10000001 3300031691 Bacteria 77478
218 Ga0265342_10003642 3300031712 Bacteria 12532
219 Ga0307405_10052305 3300031731 Bacteria 2538
220 Ga0307409_100190673 3300031995 Bacteria 1824
221 Ga0307416_100224856 3300032002 Bacteria 1803
222 Ga0307415_100018185 3300032126 Bacteria 4237
223 Ga0307415_100055806 3300032126 Bacteria 2705
224 Ga0373926_0003848 3300035083 Bacteria 4901
225 Ga0373926_0013700 3300035083 Bacteria 2752
226 Ga0373934_0016206 3300035086 Bacteria 2832
227 Ga0373934_0032820 3300035086 Bacteria 2037
228 Ga0373944_0006903 3300035089 Bacteria 3030
229 Ga0373949_0012044 3300035090 Bacteria 1910
230 Ga0373951_0016181 3300035091 Bacteria 1682
231 Ga0373923_0017196 3300035111 Bacteria 2761
232 Ga0373923_0033215 3300035111 Bacteria 2088
233 Ga0373936_0001343 3300035113 Bacteria 8932
234 Ga0373945_0000863 3300035116 Bacteria 8935
235 Ga0373945_0052614 3300035116 Bacteria 1501
236 Ga0373953_0029390 3300035117 Bacteria 2125
237 Ga0373956_0047660 3300035119 Bacteria 1917
238 Ga0373957_0014816 3300035120 Bacteria 2671
239 Ga0373957_0025939 3300035120 Bacteria 2116
240 Ga0373957_0063172 3300035120 Bacteria 1437
241 Ga0373946_0010860 3300035171 Bacteria 3383
242 Ga0373946_0044579 3300035171 Bacteria 1831
243 Ga0373955_0049182 3300035172 Bacteria 2288
244 Ga0373961_0038659 3300035241 Bacteria 1368
245 Ga0373924_0002298 3300035410 Bacteria 6415
246 Ga0373924_0005160 3300035410 Bacteria 4612
247 Ga0373935_0017214 3300035692 Bacteria 4381
248 Ga0373935_0027827 3300035692 Bacteria 3494
249 Ga0373927_0019843 3300035695 Bacteria 4407
250 Ga0373927_0030094 3300035695 Bacteria 3542
251 Ga0373933_0015271 3300035724 Bacteria 4280
252 Ga0373933_0018184 3300035724 Bacteria 3949
253 Ga0373933_0039090 3300035724 Bacteria 2790
254 Ga0373947_0071113 3300035725 Bacteria 2133
255 Ga0373947_0091133 3300035725 Bacteria 1901
256 Ga0373937_0005543 3300036401 Bacteria 10824
257 Ga0373937_0062564 3300036401 Bacteria 3421
258 Ga0373937_0184160 3300036401 Bacteria 1961
259 Ga0373937_0228276 3300036401 Bacteria 1753
260 Ga0373937_0250881 3300036401 Bacteria 1668
261 Ga0373925_0000004 3300037068 Bacteria 361597
262 Ga0373925_0065831 3300037068 Bacteria 2730
263 Ga0373925_0078289 3300037068 Bacteria 2510
264 Ga0395899_0007421 3300037312 Bacteria 8472
265 Ga0395900_0071508 3300037418 Bacteria 3566
266 Ga0395898_0033632 3300037466 Bacteria 5114
267 Ga0395898_0086374 3300037466 Bacteria 3023
268 Ga0436364_0112641 3300037853 Bacteria 82637
269 Ga0436364_0203184 3300037853 Bacteria 3035
270 Ga0436364_0779991 3300037853 Bacteria 18244
271 Ga0436364_1385510 3300037853 Bacteria 5352
272 Ga0395901_0042957 3300038443 Bacteria 4689
273 Ga0436363_1035295 3300039450 Bacteria 1662
274 Ga0439436_0018419 3300041404 Bacteria 2088
275 Ga0439442_000331 3300042002 Bacteria 11256
276 Ga0439442_000471 3300042002 Bacteria 9180
277 Ga0439449_0002411 3300042007 Bacteria 7303
278 Ga0439449_0030276 3300042007 Bacteria 2017
279 Ga0450920_013566 3300042122 Bacteria 1536
280 Ga0466961_0012017 3300044693 Bacteria 5533
281 Ga0466961_0061172 3300044693 Bacteria 2393
282 Ga0466963_0047105 3300044694 Bacteria 2845
283 Ga0466957_0163387 3300044842 Bacteria 1447
284 Ga0466967_0009209 3300045976 Bacteria 7309
285 Ga0495592_0015173 3300046454 Bacteria 5851
286 Ga0495603_0022224 3300046455 Bacteria 3841
287 Ga0495629_0021601 3300046459 Bacteria 4592
288 Ga0495641_0003281 3300046461 Bacteria 12216
289 Ga0495641_0020187 3300046461 Bacteria 3387
290 Ga0495651_0011094 3300046462 Bacteria 6929
291 Ga0495651_0082326 3300046462 Bacteria 2428
292 Ga0495651_0166893 3300046462 Bacteria 1571
293 Ga0495653_0039122 3300046463 Bacteria 3717
294 Ga0495653_0061147 3300046463 Bacteria 2851
295 Ga0495580_0033650 3300046472 Bacteria 3691
296 Ga0495580_0038621 3300046472 Bacteria 3418
297 Ga0495582_0002234 3300046473 Bacteria 10842
298 Ga0495582_0013694 3300046473 Bacteria 4465
299 Ga0495639_0009516 3300046475 Bacteria 4169
300 Ga0495639_0027430 3300046475 Bacteria 2521
301 Ga0495662_0004863 3300046476 Bacteria 6729
302 Ga0495664_0031017 3300046477 Bacteria 3132
303 Ga0495594_0049680 3300046499 Bacteria 2306
304 Ga0495608_0012293 3300046511 Bacteria 5946
305 Ga0495608_0047564 3300046511 Bacteria 2851
306 Ga0495618_0016649 3300046514 Bacteria 4502
307 Ga0495628_0023856 3300046516 Bacteria 5016
308 Ga0495628_0140195 3300046516 Bacteria 1845
309 Ga0495628_0150320 3300046516 Bacteria 1774
310 Ga0495630_0004969 3300046517 Bacteria 9351
311 Ga0495630_0267447 3300046517 Bacteria 1306
312 Ga0495666_0005195 3300046526 Bacteria 6573
313 Ga0495666_0005521 3300046526 Bacteria 6368
314 Ga0495652_0034407 3300046529 Bacteria 4415
315 Ga0495652_0042542 3300046529 Bacteria 3916
316 Ga0495665_0002349 3300046531 Bacteria 10215
317 Ga0495665_0022734 3300046531 Bacteria 3368
318 Ga0495665_0029105 3300046531 Bacteria 2960
319 Ga0495640_0071476 3300046533 Bacteria 2328
320 Ga0495640_0078599 3300046533 Bacteria 2197
321 Ga0495586_0026436 3300046535 Bacteria 3105
322 Ga0495587_0016869 3300046536 Bacteria 4541
323 Ga0495587_0059521 3300046536 Bacteria 2241
324 Ga0495587_0095514 3300046536 Bacteria 1715
325 Ga0495645_0050984 3300046543 Bacteria 3011
326 Ga0495667_0008556 3300046559 Bacteria 6946
327 Ga0495667_0010821 3300046559 Bacteria 6168
328 Ga0495667_0021103 3300046559 Bacteria 4393
329 Ga0495667_0200703 3300046559 Bacteria 1276
330 Ga0495634_0002233 3300046642 Bacteria 16223
331 Ga0495634_0039989 3300046642 Bacteria 3191
332 Ga0495634_0070138 3300046642 Bacteria 2310
333 Ga0495634_0084358 3300046642 Bacteria 2071
334 Ga0495634_0129199 3300046642 Bacteria 1612
335 Ga0495635_0009646 3300046663 Bacteria 6749
336 Ga0495635_0064400 3300046663 Bacteria 2516
337 Ga0495635_0118969 3300046663 Bacteria 1802
338 Ga0495635_0126931 3300046663 Bacteria 1739
339 Ga0495657_0022989 3300046675 Bacteria 4460
340 Ga0495657_0032684 3300046675 Bacteria 3629
341 Ga0495657_0036058 3300046675 Bacteria 3421
342 Ga0495599_0033723 3300046678 Bacteria 3218
343 Ga0495623_0036879 3300046679 Bacteria 3131
344 Ga0495623_0062020 3300046679 Bacteria 2343
345 Ga0495623_0130047 3300046679 Bacteria 1508
346 Ga0495623_0132863 3300046679 Bacteria 1488
347 Ga0495623_0140922 3300046679 Bacteria 1434
348 Ga0495646_0018823 3300046680 Bacteria 4373
349 Ga0495647_0021367 3300046681 Bacteria 2329
350 Ga0495647_0029351 3300046681 Bacteria 2034
351 Ga0495658_0012202 3300046683 Bacteria 4343
352 Ga0495658_0015709 3300046683 Bacteria 3887
353 Ga0495658_0035586 3300046683 Bacteria 2741
354 Ga0495613_0028458 3300046689 Bacteria 4156
355 Ga0495624_0032897 3300046690 Bacteria 3360
356 Ga0495600_0011394 3300046809 Bacteria 5539
357 Ga0495600_0040301 3300046809 Bacteria 3041
358 Ga0495600_0085082 3300046809 Bacteria 2063
359 Ga0495581_0006889 3300047315 Bacteria 6588
360 Ga0495581_0050319 3300047315 Bacteria 2406
361 Ga0495581_0114487 3300047315 Bacteria 1568
362 Ga0495604_0008086 3300047317 Bacteria 8331
363 Ga0495604_0058033 3300047317 Bacteria 2973
364 Ga0495604_0082935 3300047317 Bacteria 2396
365 Ga0495674_0137546 3300047319 Bacteria 2054
366 Ga0495674_0164375 3300047319 Bacteria 1855
367 Ga0495676_0046635 3300047321 Bacteria 3514
368 Ga0495676_0136724 3300047321 Bacteria 1761
369 Ga0495680_0011573 3300047322 Bacteria 7799
370 Ga0495680_0012108 3300047322 Bacteria 7610
371 Ga0495680_0016877 3300047322 Bacteria 6253
372 Ga0495680_0071376 3300047322 Bacteria 2643
373 Ga0495675_0070444 3300047444 Bacteria 2207
374 Ga0495675_0105061 3300047444 Bacteria 1765
375 Ga0495684_0015495 3300047471 Bacteria 5867
376 Ga0495684_0035251 3300047471 Bacteria 3837
377 Ga0495684_0038612 3300047471 Bacteria 3660
378 Ga0495593_0007206 3300047673 Bacteria 6519
379 Ga0495593_0016161 3300047673 Bacteria 4212
380 Ga0495593_0018063 3300047673 Bacteria 3966
381 Ga0495602_0037492 3300048088 Bacteria 4498
382 Ga0495602_0056267 3300048088 Bacteria 3459
383 Ga0495614_0007864 3300048089 Bacteria 4741
384 Ga0495614_0054344 3300048089 Bacteria 1717
385 Ga0496101_0060835 3300048904 Bacteria 2741
386 Ga0496102_0412818 3300048905 Bacteria 1268
387 Ga0496103_0045939 3300048906 Bacteria 2695
388 Ga0496103_0104483 3300048906 Bacteria 1795
389 Ga0496104_0002819 3300048907 Bacteria 14986
390 Ga0496105_0007958 3300048908 Bacteria 8241
391 Ga0496108_0044877 3300048911 Bacteria 3690
392 Ga0496108_0122466 3300048911 Bacteria 2231
393 Ga0496109_0018817 3300048912 Bacteria 6075
394 Ga0496109_0398667 3300048912 Bacteria 1300
395 Ga0496110_0059435 3300048913 Bacteria 3369
396 Ga0496110_0179716 3300048913 Bacteria 1921
397 Ga0496111_0037567 3300048914 Bacteria 3465
398 Ga0496112_0030214 3300048915 Bacteria 5243
399 Ga0496112_0126274 3300048915 Bacteria 2529
400 Ga0496113_0180661 3300048916 Bacteria 1672
401 Ga0496115_0256091 3300048918 Bacteria 1440
402 Ga0496116_0000406 3300048919 Bacteria 62016
403 Ga0496117_0050741 3300048920 Bacteria 2940
404 Ga0496118_0010068 3300048921 Bacteria 9415
405 Ga0496119_0007997 3300048922 Bacteria 9399
406 Ga0496125_0001887 3300048928 Bacteria 28810
407 Ga0496126_0020690 3300048929 Bacteria 6444
408 Ga0496126_0045860 3300048929 Bacteria 4014
409 Ga0501032_0000821 3300049569 Bacteria 25247
410 Ga0501032_0005794 3300049569 Bacteria 9141
411 Ga0501037_0008911 3300049573 Bacteria 7347
412 Ga0501038_0036377 3300049574 Bacteria 4321
413 Ga0501043_0049367 3300049579 Bacteria 3308
414 Ga0501047_0229541 3300049581 Bacteria 1710
415 Ga0501070_0068286 3300049586 Bacteria 2943
416 Ga0501044_0167806 3300049823 Bacteria 2168
417 nmdc:mga09592_269701_c1 3300050508 Bacteria 1476
418 nmdc:mga08y16_4845_c1 3300050511 Bacteria 14045
419 nmdc:mga0n895_317337_c1 3300050512 Bacteria 1579
420 nmdc:mga0rr50_235507_c1 3300050513 Bacteria 1516
421 nmdc:mga08x19_98595_c1 3300050514 Bacteria 1936
422 Ga0495601_0010870 3300053077 Bacteria 5431
423 Ga0495612_0031130 3300053078 Bacteria 2150
424 Ga0495595_0015628 3300053084 Bacteria 3238
425 Ga0495619_0013019 3300053085 Bacteria 5241
426 Ga0495619_0020341 3300053085 Bacteria 4225
427 2508677260 2508501039 Bacteria 9978592
428 2671835046 2671180195 Bacteria 9757215
429 2676474559 2675903058 Bacteria 6822861
430 2775655716 2775506735 Bacteria 4556596
431 2808828450 2808606357 Bacteria 4466944
432 2808849694 2808606360 Bacteria 4404006
433 2812319840 2811994871 Bacteria 4497550
434 2812364260 2811994880 Bacteria 4147780
435 2827632967 2827628540 Bacteria 6858585
436 2883826461 2883821847 Bacteria 5121194
437 2919393483 2919391150 Bacteria 4884741
438 2945917580 2945916053 Bacteria 4555517
439 2945960571 2945956166 Bacteria 5110334
440 8002781117 8002775197 Bacteria 10728764
441 8002787312 8002784119 Bacteria 9788632
442 8054109664 8054107350 Bacteria 5022511
443 Ga0496126_0172464
444 rootH2_10232367
445 JGI25404J52841_10001690
446 Ga0070658_10002420
447 Ga0070658_10007499
448 Ga0070658_10093485
449 Ga0070676_10111964
450 Ga0070683_100011130
451 Ga0070683_100105649
452 Ga0070683_100201973
453 Ga0068869_100064562
454 Ga0070666_10060102
455 Ga0070680_100227067
456 Ga0068868_100019898
457 Ga0068868_100263169
458 Ga0070691_10011680
459 Ga0070691_10040253
460 Ga0070661_100019933
461 Ga0070675_100001606
462 Ga0070671_100053652
463 Ga0070674_100132599
464 Ga0070673_100243207
465 Ga0070659_100014539
466 Ga0070659_100026353
467 Ga0070709_10002395
468 Ga0070709_10005585
469 Ga0070709_10007408
470 Ga0070714_100021652
471 Ga0070714_100109561
472 Ga0070714_100226600
473 Ga0070714_100339515
474 Ga0070713_100006544
475 Ga0070713_100137960
476 Ga0070713_100161874
477 Ga0070713_100165106
478 Ga0070710_10000288
479 Ga0070711_100004242
480 Ga0070711_100081576
481 Ga0070700_100076078
482 Ga0070694_100014312
483 Ga0070708_100008096
484 Ga0070708_100008717
485 Ga0070708_100210134
486 Ga0070663_100007178
487 Ga0070663_100024818
488 Ga0070678_100114203
489 Ga0070662_100010109
490 Ga0070681_10136805
491 Ga0070706_100005679
492 Ga0070706_100026115
493 Ga0070706_100036459
494 Ga0070706_100104452
495 Ga0070706_100207037
496 Ga0070707_100093061
497 Ga0070698_100000992
498 Ga0070698_100034884
499 Ga0070698_100082226
500 Ga0070698_100173588
501 Ga0070699_100002120
502 Ga0070679_100010993
503 Ga0070679_100083853
504 Ga0070679_100098475
505 Ga0070684_100010223
506 Ga0070697_100011045
507 Ga0070697_100262668
508 Ga0068853_100175936
509 Ga0070686_100006486
510 Ga0070695_100028323
511 Ga0070696_100038718
512 Ga0070693_100019749
513 Ga0068855_100047504
514 Ga0068855_100055014
515 Ga0068855_100072899
516 Ga0070664_100000984
517 Ga0070702_100004675
518 Ga0070702_100024118
519 Ga0068864_100124268
520 Ga0068866_10079746
521 Ga0068861_100016781
522 Ga0068863_100052582
523 Ga0068863_100314804
524 Ga0068858_100014941
525 Ga0068858_100125678
526 Ga0068862_100079228
527 Ga0068862_100106317
528 Ga0081540_1000097
529 Ga0070717_10061898
530 Ga0070716_100000186
531 Ga0070712_100165702
532 Ga0097621_100055460
533 Ga0068871_100007906
534 Ga0068871_100013999
535 Ga0075436_100084039
536 Ga0105251_10061575
537 Ga0105244_10117225
538 Ga0105240_10290950
539 Ga0111539_10017696
540 Ga0105247_10069207
541 Ga0105247_10147298
542 Ga0105243_10018659
543 Ga0105242_10256374
544 Ga0105248_10000072
545 Ga0105237_10086182
546 Ga0105238_10206731
547 Ga0105249_10053161
548 Ga0105246_10005791
549 Ga0105246_10126681
550 Ga0157342_1000288
551 Ga0157338_1000195
552 Ga0157373_10075709
553 Ga0157370_10164390
554 Ga0157369_10043861
555 Ga0157369_10062462
556 Ga0157369_10083534
557 Ga0157369_10101190
558 Ga0157375_10061283
559 Ga0163163_10025215
560 Ga0157377_10003575
561 Ga0157377_10031334
562 Ga0157379_10005158
563 Ga0157379_10303447
564 Ga0157376_10003151
565 Ga0206353_11325109
566 Ga0213874_10025243
567 Ga0213875_10000547
568 Ga0213875_10010368
569 Ga0224712_10059877
570 Ga0228598_1010215
571 Ga0207653_10000770
572 Ga0207692_10000108
573 Ga0207688_10009068
574 Ga0207685_10007851
575 Ga0207685_10017089
576 Ga0207699_10018508
577 Ga0207643_10008244
578 Ga0207684_10125367
579 Ga0207684_10158635
580 Ga0207684_10162930
581 Ga0207654_10134364
582 Ga0207707_10009697
583 Ga0207707_10082288
584 Ga0207693_10028413
585 Ga0207693_10082486
586 Ga0207693_10098550
587 Ga0207663_10027306
588 Ga0207660_10002954
589 Ga0207657_10003435
590 Ga0207652_10132773
591 Ga0207646_10006542
592 Ga0207646_10022213
593 Ga0207694_10215413
594 Ga0207659_10020914
595 Ga0207659_10031705
596 Ga0207687_10104766
597 Ga0207687_10140782
598 Ga0207700_10001223
599 Ga0207700_10025705
600 Ga0207700_10068124
601 Ga0207700_10069731
602 Ga0207700_10083322
603 Ga0207700_10111485
604 Ga0207700_10137109
605 Ga0207664_10001872
606 Ga0207664_10013790
607 Ga0207664_10063201
608 Ga0207664_10207211
609 Ga0207664_10226673
610 Ga0207690_10011066
611 Ga0207690_10028166
612 Ga0207706_10026723
613 Ga0207706_10057959
614 Ga0207709_10099901
615 Ga0207670_10047133
616 Ga0207665_10000278
617 Ga0207665_10026848
618 Ga0207665_10068634
619 Ga0207689_10003823
620 Ga0207689_10008040
621 Ga0207661_10055649
622 Ga0207679_10010901
623 Ga0207679_10076096
624 Ga0207667_10180368
625 Ga0207677_10085487
626 Ga0207677_10105272
627 Ga0207678_10009706
628 Ga0207678_10010962
629 Ga0207678_10022594
630 Ga0207708_10036221
631 Ga0207702_10099590
632 Ga0207641_10178222
633 Ga0207648_10050027
634 Ga0207674_10004920
635 Ga0207674_10005169
636 Ga0207674_10034549
637 Ga0207675_100038674
638 Ga0207683_10053548
639 Ga0207683_10147579
640 Ga0207428_10009693
641 Ga0265337_1003185
642 Ga0265326_10001914
643 Ga0265319_1000682
644 Ga0265334_10000160
645 Ga0265318_10016345
646 Ga0265322_10011334
647 Ga0265336_10002686
648 Ga0265338_10000148
649 Ga0265338_10022634
650 Ga0265338_10161292
651 Ga0265324_10012693
652 Ga0265332_10000443
653 Ga0265320_10001651
654 Ga0265325_10016036
655 Ga0265325_10033372
656 Ga0265340_10014594
657 Ga0265316_10015807
658 Ga0307408_100217649
659 Ga0316579_10000001
660 Ga0265342_10003642
661 Ga0307405_10052305
662 Ga0307409_100190673
663 Ga0307416_100224856
664 Ga0307415_100018185
665 Ga0307415_100055806
666 Ga0373926_0003848
667 Ga0373926_0013700
668 Ga0373934_0016206
669 Ga0373934_0032820
670 Ga0373944_0006903
671 Ga0373949_0012044
672 Ga0373951_0016181
673 Ga0373923_0017196
674 Ga0373923_0033215
675 Ga0373936_0001343
676 Ga0373945_0000863
677 Ga0373945_0052614
678 Ga0373953_0029390
679 Ga0373956_0047660
680 Ga0373957_0014816
681 Ga0373957_0025939
682 Ga0373957_0063172
683 Ga0373946_0010860
684 Ga0373946_0044579
685 Ga0373955_0049182
686 Ga0373961_0038659
687 Ga0373924_0002298
688 Ga0373924_0005160
689 Ga0373935_0017214
690 Ga0373935_0027827
691 Ga0373927_0019843
692 Ga0373927_0030094
693 Ga0373933_0015271
694 Ga0373933_0018184
695 Ga0373933_0039090
696 Ga0373947_0071113
697 Ga0373947_0091133
698 Ga0373937_0005543
699 Ga0373937_0062564
700 Ga0373937_0184160
701 Ga0373937_0228276
702 Ga0373937_0250881
703 Ga0373925_0000004
704 Ga0373925_0065831
705 Ga0373925_0078289
706 Ga0395899_0007421
707 Ga0395900_0071508
708 Ga0395898_0033632
709 Ga0395898_0086374
710 Ga0436364_0112641
711 Ga0436364_0203184
712 Ga0436364_0779991
713 Ga0436364_1385510
714 Ga0395901_0042957
715 Ga0436363_1035295
716 Ga0439436_0018419
717 Ga0439442_000331
718 Ga0439442_000471
719 Ga0439449_0002411
720 Ga0439449_0030276
721 Ga0450920_013566
722 Ga0466961_0012017
723 Ga0466961_0061172
724 Ga0466963_0047105
725 Ga0466957_0163387
726 Ga0466967_0009209
727 Ga0495592_0015173
728 Ga0495603_0022224
729 Ga0495629_0021601
730 Ga0495641_0003281
731 Ga0495641_0020187
732 Ga0495651_0011094
733 Ga0495651_0082326
734 Ga0495651_0166893
735 Ga0495653_0039122
736 Ga0495653_0061147
737 Ga0495580_0033650
738 Ga0495580_0038621
739 Ga0495582_0002234
740 Ga0495582_0013694
741 Ga0495639_0009516
742 Ga0495639_0027430
743 Ga0495662_0004863
744 Ga0495664_0031017
745 Ga0495594_0049680
746 Ga0495608_0012293
747 Ga0495608_0047564
748 Ga0495618_0016649
749 Ga0495628_0023856
750 Ga0495628_0140195
751 Ga0495628_0150320
752 Ga0495630_0004969
753 Ga0495630_0267447
754 Ga0495666_0005195
755 Ga0495666_0005521
756 Ga0495652_0034407
757 Ga0495652_0042542
758 Ga0495665_0002349
759 Ga0495665_0022734
760 Ga0495665_0029105
761 Ga0495640_0071476
762 Ga0495640_0078599
763 Ga0495586_0026436
764 Ga0495587_0016869
765 Ga0495587_0059521
766 Ga0495587_0095514
767 Ga0495645_0050984
768 Ga0495667_0008556
769 Ga0495667_0010821
770 Ga0495667_0021103
771 Ga0495667_0200703
772 Ga0495634_0002233
773 Ga0495634_0039989
774 Ga0495634_0070138
775 Ga0495634_0084358
776 Ga0495634_0129199
777 Ga0495635_0009646
778 Ga0495635_0064400
779 Ga0495635_0118969
780 Ga0495635_0126931
781 Ga0495657_0022989
782 Ga0495657_0032684
783 Ga0495657_0036058
784 Ga0495599_0033723
785 Ga0495623_0036879
786 Ga0495623_0062020
787 Ga0495623_0130047
788 Ga0495623_0132863
789 Ga0495623_0140922
790 Ga0495646_0018823
791 Ga0495647_0021367
792 Ga0495647_0029351
793 Ga0495658_0012202
794 Ga0495658_0015709
795 Ga0495658_0035586
796 Ga0495613_0028458
797 Ga0495624_0032897
798 Ga0495600_0011394
799 Ga0495600_0040301
800 Ga0495600_0085082
801 Ga0495581_0006889
802 Ga0495581_0050319
803 Ga0495581_0114487
804 Ga0495604_0008086
805 Ga0495604_0058033
806 Ga0495604_0082935
807 Ga0495674_0137546
808 Ga0495674_0164375
809 Ga0495676_0046635
810 Ga0495676_0136724
811 Ga0495680_0011573
812 Ga0495680_0012108
813 Ga0495680_0016877
814 Ga0495680_0071376
815 Ga0495675_0070444
816 Ga0495675_0105061
817 Ga0495684_0015495
818 Ga0495684_0035251
819 Ga0495684_0038612
820 Ga0495593_0007206
821 Ga0495593_0016161
822 Ga0495593_0018063
823 Ga0495602_0037492
824 Ga0495602_0056267
825 Ga0495614_0007864
826 Ga0495614_0054344
827 Ga0496101_0060835
828 Ga0496102_0412818
829 Ga0496103_0045939
830 Ga0496103_0104483
831 Ga0496104_0002819
832 Ga0496105_0007958
833 Ga0496108_0044877
834 Ga0496108_0122466
835 Ga0496109_0018817
836 Ga0496109_0398667
837 Ga0496110_0059435
838 Ga0496110_0179716
839 Ga0496111_0037567
840 Ga0496112_0030214
841 Ga0496112_0126274
842 Ga0496113_0180661
843 Ga0496115_0256091
844 Ga0496116_0000406
845 Ga0496117_0050741
846 Ga0496118_0010068
847 Ga0496119_0007997
848 Ga0496125_0001887
849 Ga0496126_0020690
850 Ga0496126_0045860
851 Ga0501032_0000821
852 Ga0501032_0005794
853 Ga0501037_0008911
854 Ga0501038_0036377
855 Ga0501043_0049367
856 Ga0501047_0229541
857 Ga0501070_0068286
858 Ga0501044_0167806
859 nmdc:mga09592_269701_c1
860 nmdc:mga08y16_4845_c1
861 nmdc:mga0n895_317337_c1
862 nmdc:mga0rr50_235507_c1
863 nmdc:mga08x19_98595_c1
864 Ga0495601_0010870
865 Ga0495612_0031130
866 Ga0495595_0015628
867 Ga0495619_0013019
868 Ga0495619_0020341
869 2508677260
870 2671835046
871 2676474559
872 2775655716
873 2808828450
874 2808849694
875 2812319840
876 2812364260
877 2827632967
878 2883826461
879 2919393483
880 2945917580
881 2945960571
882 8002781117
883 8002787312
884 8054109664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00850

Hist_deacetyl

Histone deacetylase domain

22

319

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8szt-assembly1.cif.gz_C-2 structure of kdac1 from acinetobacter baumannii 0.9048 14 327
8szt-assembly1.cif.gz_B structure of kdac1 from acinetobacter baumannii 0.9003 14 327
3rqd-assembly3.cif.gz_B ideal thiolate-zinc coordination geometry in depsipeptide binding to histone deacetylase 8 0.8966 11 389
4rn2-assembly3.cif.gz_A crystal structure of s39d hdac8 in complex with a largazole analogue. 0.8962 14 390
4qa1-assembly1.cif.gz_A crystal structure of a188t hdac8 in complex with m344 0.8957 12 390
ID Description Score Start End Superfamily
af_Q2G292_6_379_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9149 13 384 3.40.800.20
af_Q2G292_6_379_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9078 13 384 3.40.800.20
af_A4I0X6_83_423_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.8865 14 343 3.40.800.20
4qa5B00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.8808 11 390 3.40.800.20
af_Q55BW2_3_393_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.8733 12 399 3.40.800.20
ID Description Score Start End GO Terms
AF-A0A3N3ZTC1-F1-model_v4 Acetoin utilization protein AcuC 0.9876 5 399 GO:0004407
GO:0040029
GO:0045150
AF-D9XZ29-F1-model_v4 Acetoin utilization protein AcuC 0.9831 17 396 GO:0004407
GO:0040029
GO:0045150
AF-A0A0U3HIR7-F1-model_v4 Acetoin utilization protein AcuC 0.9821 3 399 GO:0004407
GO:0040029
GO:0045150
AF-A0A510TCT8-F1-model_v4 Acetoin utilization protein AcuC 0.9812 13 394 GO:0004407
GO:0040029
GO:0045150
AF-A0A6G2N574-F1-model_v4 Acetoin utilization protein AcuC 0.9805 10 396 GO:0004407
GO:0040029
GO:0045150

Map