F444955

General Info

Members Datasets Scaffolds Average Seq Length
442 241 884 194

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0257872|Ga0495674_0257872_578_1255
Length 225
Sequence VGGLADRDMAAGMRCDEHGPHDNGPVDRPELIRARALAKRYGRKRVLTNVDLDLAAGDLLLVTGPNGAGKTTLLRLLAGLAAPTGGELKHTIEREEVGFLGHEPLVYRELSALENLDLFGRLYRIPERRERIGMLLERYGLWEVRHQRVGSYSRGMQQRLGLCRTLLHEPRLLVLDEPFTGLDAAGADLLERELGEARQRDCGLVVATHDPERLATLATARLALA

Samples

Sample ID Description Type Environment
1 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
131 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
132 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.44
Rhizosphere 87.56
Stem 0
Stem Tuber 0
Unclassified 7.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495674_0257872 3300047319 Bacteria 1433
2 Ga0070658_10447233 3300005327 Bacteria 1113
3 Ga0070683_100405662 3300005329 Bacteria 1300
4 Ga0068869_100524700 3300005334 Archaea 992
5 Ga0070660_100008257 3300005339 Bacteria 7278
6 Ga0070661_100077639 3300005344 Bacteria 2448
7 Ga0070659_100004574 3300005366 Bacteria 9892
8 Ga0070667_100002001 3300005367 Bacteria 18056
9 Ga0070709_10118783 3300005434 Bacteria 1788
10 Ga0070714_100107809 3300005435 Bacteria 2462
11 Ga0070713_100001060 3300005436 Bacteria 17565
12 Ga0070713_100122635 3300005436 Bacteria 2281
13 Ga0070713_100495933 3300005436 Bacteria 1152
14 Ga0070710_10003601 3300005437 Bacteria 7338
15 Ga0070710_10045820 3300005437 Bacteria 2433
16 Ga0070711_100010538 3300005439 Bacteria 5724
17 Ga0070711_100013538 3300005439 Bacteria 5122
18 Ga0070711_100897966 3300005439 Unclassified 756
19 Ga0070700_100261396 3300005441 Unclassified 1247
20 Ga0070663_100127906 3300005455 Bacteria 1926
21 Ga0070678_100317736 3300005456 Unclassified 1329
22 Ga0070662_100054865 3300005457 Bacteria 2889
23 Ga0070681_10218363 3300005458 Bacteria 1822
24 Ga0070685_10254324 3300005466 Unclassified 1165
25 Ga0070707_100193711 3300005468 Bacteria 1982
26 Ga0070679_100280231 3300005530 Unclassified 1620
27 Ga0070684_100113410 3300005535 Bacteria 2432
28 Ga0070684_100221445 3300005535 Bacteria 1726
29 Ga0070686_100270291 3300005544 Unclassified 1250
30 Ga0070695_100000029 3300005545 Bacteria 53859
31 Ga0070693_100049515 3300005547 Bacteria 2397
32 Ga0068855_100023527 3300005563 Bacteria 7376
33 Ga0068855_100034915 3300005563 Bacteria 5992
34 Ga0068855_101475939 3300005563 Bacteria 699
35 Ga0070664_101196813 3300005564 Bacteria 717
36 Ga0068856_100170642 3300005614 Bacteria 2187
37 Ga0070702_100203745 3300005615 Bacteria 1312
38 Ga0068852_100058909 3300005616 Bacteria 3329
39 Ga0068864_100077415 3300005618 Bacteria 2908
40 Ga0068866_10388424 3300005718 Bacteria 897
41 Ga0068851_10336701 3300005834 Unclassified 875
42 Ga0068860_100437465 3300005843 Unclassified 1299
43 Ga0081538_10000755 3300005981 Bacteria 35288
44 Ga0081538_10080474 3300005981 Bacteria 1738
45 Ga0081539_10008668 3300005985 Bacteria 8758
46 Ga0070717_10005467 3300006028 Bacteria 9275
47 Ga0070717_10007849 3300006028 Bacteria 7943
48 Ga0070717_10055101 3300006028 Bacteria 3280
49 Ga0070717_10095683 3300006028 Bacteria 2514
50 Ga0070715_10012869 3300006163 Bacteria 3059
51 Ga0070716_100001457 3300006173 Bacteria 10535
52 Ga0070712_100050404 3300006175 Bacteria 2896
53 Ga0097621_100467162 3300006237 Unclassified 1139
54 Ga0068871_100294551 3300006358 Unclassified 1423
55 Ga0075428_100005327 3300006844 Bacteria 14298
56 Ga0075428_100114666 3300006844 Bacteria 2935
57 Ga0075430_100062354 3300006846 Bacteria 3132
58 Ga0075429_100026506 3300006880 Bacteria 5034
59 Ga0105240_10017296 3300009093 Bacteria 9720
60 Ga0105240_10520667 3300009093 Bacteria 1320
61 Ga0105240_10864539 3300009093 Bacteria 975
62 Ga0111539_10001300 3300009094 Bacteria 33359
63 Ga0105245_10177538 3300009098 Bacteria 2032
64 Ga0105245_11130609 3300009098 Bacteria 830
65 Ga0114129_10003789 3300009147 Bacteria 21316
66 Ga0114129_11948167 3300009147 Bacteria 712
67 Ga0105248_10525659 3300009177 Unclassified 1334
68 Ga0105237_10242432 3300009545 Bacteria 1804
69 Ga0105237_10589854 3300009545 Bacteria 1118
70 Ga0105238_10279935 3300009551 Bacteria 1649
71 Ga0105249_10676968 3300009553 Bacteria 1090
72 Ga0157370_10052000 3300013104 Bacteria 3912
73 Ga0157370_10648561 3300013104 Bacteria 965
74 Ga0157369_10037107 3300013105 Bacteria 5338
75 Ga0157369_10463224 3300013105 Bacteria 1312
76 Ga0157374_10085634 3300013296 Bacteria 2997
77 Ga0157374_10448333 3300013296 Bacteria 1292
78 Ga0157378_10062284 3300013297 Bacteria 3331
79 Ga0157378_10291366 3300013297 Bacteria 1577
80 Ga0163162_10453345 3300013306 Unclassified 1414
81 Ga0157372_10212614 3300013307 Bacteria 2241
82 Ga0157372_10793621 3300013307 Bacteria 1100
83 Ga0157375_10206245 3300013308 Bacteria 2122
84 Ga0163163_10789226 3300014325 Archaea 1013
85 Ga0157379_10548508 3300014968 Unclassified 1075
86 Ga0157376_10052208 3300014969 Bacteria 3398
87 Ga0157376_10230529 3300014969 Bacteria 1720
88 Ga0157376_10761931 3300014969 Bacteria 978
89 Ga0206354_11320085 3300020081 Bacteria 1683
90 Ga0213873_10074228 3300021358 Bacteria 942
91 Ga0207692_10010091 3300025898 Bacteria 3967
92 Ga0207692_10254656 3300025898 Bacteria 1053
93 Ga0207642_10259665 3300025899 Bacteria 990
94 Ga0207688_10067602 3300025901 Bacteria 2022
95 Ga0207685_10010888 3300025905 Bacteria 2709
96 Ga0207699_10067577 3300025906 Bacteria 2173
97 Ga0207699_10410639 3300025906 Bacteria 966
98 Ga0207705_10052949 3300025909 Bacteria 2923
99 Ga0207705_10240828 3300025909 Unclassified 1378
100 Ga0207705_10397196 3300025909 Bacteria 1066
101 Ga0207707_10033767 3300025912 Bacteria 4477
102 Ga0207695_10357531 3300025913 Bacteria 1347
103 Ga0207671_10040792 3300025914 Bacteria 3435
104 Ga0207693_10000282 3300025915 Bacteria 47278
105 Ga0207693_10027484 3300025915 Bacteria 4497
106 Ga0207663_10161941 3300025916 Bacteria 1580
107 Ga0207663_10271518 3300025916 Bacteria 1256
108 Ga0207657_10000988 3300025919 Bacteria 30190
109 Ga0207646_10001768 3300025922 Bacteria 26172
110 Ga0207681_10324315 3300025923 Unclassified 1226
111 Ga0207694_10237991 3300025924 Bacteria 1487
112 Ga0207659_10581063 3300025926 Bacteria 954
113 Ga0207687_10323510 3300025927 Bacteria 1249
114 Ga0207700_10099280 3300025928 Bacteria 2318
115 Ga0207700_10199972 3300025928 Bacteria 1683
116 Ga0207664_10012931 3300025929 Bacteria 5980
117 Ga0207644_10277549 3300025931 Bacteria 1345
118 Ga0207690_10157488 3300025932 Unclassified 1690
119 Ga0207706_10412619 3300025933 Unclassified 1170
120 Ga0207686_10211286 3300025934 Unclassified 1395
121 Ga0207704_10086150 3300025938 Archaea 2048
122 Ga0207665_10046984 3300025939 Bacteria 2893
123 Ga0207665_10253744 3300025939 Bacteria 1301
124 Ga0207691_10428276 3300025940 Bacteria 1127
125 Ga0207711_10328741 3300025941 Unclassified 1414
126 Ga0207689_10010513 3300025942 Bacteria 7969
127 Ga0207661_10031156 3300025944 Bacteria 4116
128 Ga0207661_10311554 3300025944 Bacteria 1413
129 Ga0207667_10233129 3300025949 Bacteria 1884
130 Ga0207667_10958007 3300025949 Bacteria 845
131 Ga0207651_10139431 3300025960 Unclassified 1871
132 Ga0207640_10027665 3300025981 Bacteria 3458
133 Ga0207658_10002326 3300025986 Bacteria 13958
134 Ga0207678_10238502 3300026067 Unclassified 1557
135 Ga0207708_10113002 3300026075 Unclassified 2110
136 Ga0207702_10074335 3300026078 Bacteria 2933
137 Ga0207702_10168929 3300026078 Unclassified 2004
138 Ga0207702_10180055 3300026078 Bacteria 1946
139 Ga0207641_10298552 3300026088 Bacteria 1521
140 Ga0207674_10447324 3300026116 Unclassified 1249
141 Ga0207683_10078578 3300026121 Bacteria 2924
142 Ga0207698_10326490 3300026142 Unclassified 1439
143 Ga0207698_10547621 3300026142 Bacteria 1133
144 Ga0207698_10549535 3300026142 Bacteria 1132
145 Ga0268264_10617957 3300028381 Unclassified 1070
146 Ga0265338_10159263 3300028800 Bacteria 1745
147 Ga0265338_10595309 3300028800 Bacteria 771
148 Ga0265330_10029460 3300031235 Bacteria 2469
149 Ga0307408_100182353 3300031548 Bacteria 1684
150 Ga0265313_10061599 3300031595 Bacteria 1755
151 Ga0307413_10761849 3300031824 Bacteria 810
152 Ga0307406_10031146 3300031901 Bacteria 3246
153 Ga0307409_100214615 3300031995 Bacteria 1732
154 Ga0307416_100025225 3300032002 Bacteria 4354
155 Ga0307416_100275042 3300032002 Bacteria 1656
156 Ga0307416_100644264 3300032002 Bacteria 1144
157 Ga0373940_0159055 3300035088 Bacteria 724
158 Ga0373944_0009886 3300035089 Bacteria 2594
159 Ga0373949_0128917 3300035090 Bacteria 716
160 Ga0373943_0019977 3300035170 Bacteria 3085
161 Ga0373931_0368858 3300035691 Bacteria 902
162 Ga0373935_0041242 3300035692 Bacteria 2899
163 Ga0373927_0063317 3300035695 Bacteria 2392
164 Ga0373933_0113008 3300035724 Bacteria 1696
165 Ga0373947_0002635 3300035725 Bacteria 10776
166 Ga0373937_0075507 3300036401 Bacteria 3112
167 Ga0395899_0033167 3300037312 Bacteria 3878
168 Ga0395900_0027999 3300037418 Bacteria 5770
169 Ga0395900_0119994 3300037418 Bacteria 2698
170 Ga0395898_0016168 3300037466 Bacteria 7643
171 Ga0395898_0136690 3300037466 Bacteria 2347
172 Ga0395898_0181317 3300037466 Bacteria 2012
173 Ga0395905_0050522 3300037471 Bacteria 3895
174 Ga0395905_0386219 3300037471 Unclassified 1294
175 Ga0395901_0058107 3300038443 Bacteria 4023
176 Ga0395901_0088306 3300038443 Bacteria 3242
177 Ga0395901_0276834 3300038443 Bacteria 1744
178 Ga0395901_0438889 3300038443 Bacteria 1337
179 Ga0395901_0563565 3300038443 Bacteria 1153
180 Ga0436362_0000471 3300039453 Bacteria 3860
181 Ga0439438_036801 3300041405 Bacteria 1282
182 Ga0450906_014602 3300042145 Bacteria 1437
183 Ga0466969_0053139 3300044656 Bacteria 1989
184 Ga0466965_0023576 3300044683 Bacteria 2972
185 Ga0466961_0391085 3300044693 Bacteria 844
186 Ga0466963_0077508 3300044694 Bacteria 2246
187 Ga0466963_0078175 3300044694 Bacteria 2236
188 Ga0466963_0181477 3300044694 Bacteria 1469
189 Ga0466963_0211398 3300044694 Bacteria 1357
190 Ga0466964_0007998 3300044706 Bacteria 3960
191 Ga0466964_0024500 3300044706 Bacteria 2352
192 Ga0466968_0020838 3300044735 Bacteria 2650
193 Ga0466957_0165828 3300044842 Bacteria 1437
194 Ga0466957_0289283 3300044842 Bacteria 1098
195 Ga0466959_0036203 3300045049 Bacteria 3647
196 Ga0466959_0299207 3300045049 Bacteria 1102
197 Ga0466958_0032165 3300045836 Bacteria 3120
198 Ga0466958_0041087 3300045836 Bacteria 2781
199 Ga0466967_0025255 3300045976 Bacteria 4897
200 Ga0466967_0037568 3300045976 Bacteria 4145
201 Ga0466967_0405652 3300045976 Bacteria 1327
202 Ga0466967_0426292 3300045976 Bacteria 1293
203 Ga0466967_0762391 3300045976 Bacteria 960
204 Ga0495592_0584903 3300046454 Bacteria 682
205 Ga0495603_0083302 3300046455 Bacteria 1873
206 Ga0495629_0112651 3300046459 Bacteria 1896
207 Ga0495641_0019598 3300046461 Bacteria 3454
208 Ga0495641_0038382 3300046461 Bacteria 2238
209 Ga0495641_0043074 3300046461 Bacteria 2088
210 Ga0495641_0083368 3300046461 Bacteria 1432
211 Ga0495653_0143061 3300046463 Bacteria 1680
212 Ga0495582_0069467 3300046473 Bacteria 1948
213 Ga0495582_0116618 3300046473 Bacteria 1502
214 Ga0495605_0069507 3300046474 Bacteria 1667
215 Ga0495662_0177524 3300046476 Bacteria 1050
216 Ga0495664_0136601 3300046477 Bacteria 1485
217 Ga0495664_0186000 3300046477 Bacteria 1259
218 Ga0495584_0010750 3300046491 Bacteria 4701
219 Ga0495585_0044217 3300046492 Bacteria 2489
220 Ga0495607_0032668 3300046501 Bacteria 3174
221 Ga0495607_0208494 3300046501 Bacteria 963
222 Ga0495618_0094128 3300046514 Bacteria 1916
223 Ga0495618_0561653 3300046514 Bacteria 682
224 Ga0495630_0011832 3300046517 Bacteria 6323
225 Ga0495630_0480587 3300046517 Bacteria 952
226 Ga0495630_0704429 3300046517 Bacteria 772
227 Ga0495630_0863965 3300046517 Archaea 690
228 Ga0495644_0009501 3300046523 Bacteria 3749
229 Ga0495644_0218891 3300046523 Bacteria 736
230 Ga0495663_0059928 3300046525 Bacteria 1195
231 Ga0495642_0133732 3300046528 Bacteria 1068
232 Ga0495652_0034234 3300046529 Bacteria 4428
233 Ga0495640_0026151 3300046533 Bacteria 4221
234 Ga0495586_0480710 3300046535 Bacteria 716
235 Ga0495587_0053413 3300046536 Bacteria 2382
236 Ga0495609_0047883 3300046538 Bacteria 1912
237 Ga0495645_0090312 3300046543 Bacteria 2189
238 Ga0495667_0029836 3300046559 Bacteria 3669
239 Ga0495656_0003250 3300046615 Bacteria 5481
240 Ga0495634_0085799 3300046642 Bacteria 2051
241 Ga0495661_0121304 3300046665 Bacteria 1444
242 Ga0495599_0110985 3300046678 Bacteria 1708
243 Ga0495647_0043727 3300046681 Bacteria 1715
244 Ga0495647_0116964 3300046681 Bacteria 1118
245 Ga0495658_0122850 3300046683 Bacteria 1572
246 Ga0495658_0310019 3300046683 Bacteria 999
247 Ga0495669_0167979 3300046684 Bacteria 1043
248 Ga0495613_0031151 3300046689 Bacteria 3961
249 Ga0495613_0289388 3300046689 Bacteria 1136
250 Ga0495624_0030034 3300046690 Bacteria 3542
251 Ga0495624_0059830 3300046690 Bacteria 2389
252 Ga0495624_0553987 3300046690 Bacteria 687
253 Ga0495581_0079772 3300047315 Bacteria 1894
254 Ga0495604_0064035 3300047317 Bacteria 2803
255 Ga0495604_0242938 3300047317 Bacteria 1230
256 Ga0495636_0147057 3300047318 Bacteria 1055
257 Ga0495674_0011878 3300047319 Bacteria 8209
258 Ga0495674_0021386 3300047319 Bacteria 5984
259 Ga0495674_0146197 3300047319 Bacteria 1984
260 Ga0495676_0043187 3300047321 Bacteria 3693
261 Ga0495676_0168832 3300047321 Archaea 1541
262 Ga0495680_0005532 3300047322 Bacteria 11858
263 Ga0495683_0156718 3300047323 Bacteria 1056
264 Ga0495684_0349329 3300047471 Bacteria 1050
265 Ga0495602_0240004 3300048088 Bacteria 1356
266 Ga0496100_0009080 3300048903 Bacteria 5573
267 Ga0496100_0168952 3300048903 Bacteria 1573
268 Ga0496100_0569675 3300048903 Bacteria 877
269 Ga0496101_0012492 3300048904 Bacteria 5667
270 Ga0496101_0075242 3300048904 Bacteria 2485
271 Ga0496101_0180970 3300048904 Bacteria 1623
272 Ga0496101_0202072 3300048904 Bacteria 1537
273 Ga0496101_0632599 3300048904 Bacteria 846
274 Ga0496102_0013068 3300048905 Bacteria 7189
275 Ga0496102_0070550 3300048905 Bacteria 3208
276 Ga0496102_0923789 3300048905 Bacteria 794
277 Ga0496104_0055988 3300048907 Bacteria 3728
278 Ga0496104_0088948 3300048907 Bacteria 2950
279 Ga0496104_0152100 3300048907 Bacteria 2221
280 Ga0496104_0375070 3300048907 Bacteria 1335
281 Ga0496104_0645456 3300048907 Bacteria 967
282 Ga0496105_0001042 3300048908 Bacteria 19175
283 Ga0496105_0090037 3300048908 Bacteria 2534
284 Ga0496105_0149450 3300048908 Bacteria 1920
285 Ga0496106_0013216 3300048909 Bacteria 6092
286 Ga0496106_0093144 3300048909 Bacteria 2328
287 Ga0496106_0437519 3300048909 Unclassified 1051
288 Ga0496107_0001734 3300048910 Bacteria 13705
289 Ga0496107_0177223 3300048910 Bacteria 1583
290 Ga0496107_0352381 3300048910 Archaea 1095
291 Ga0496108_0008931 3300048911 Bacteria 8122
292 Ga0496108_0028356 3300048911 Bacteria 4631
293 Ga0496108_0035181 3300048911 Bacteria 4163
294 Ga0496108_0061474 3300048911 Bacteria 3161
295 Ga0496108_0100312 3300048911 Bacteria 2469
296 Ga0496109_0001931 3300048912 Bacteria 17224
297 Ga0496109_0008195 3300048912 Bacteria 8865
298 Ga0496109_0018533 3300048912 Bacteria 6114
299 Ga0496109_0032272 3300048912 Bacteria 4707
300 Ga0496109_0067449 3300048912 Bacteria 3277
301 Ga0496109_0465637 3300048912 Bacteria 1194
302 Ga0496110_0010243 3300048913 Bacteria 7615
303 Ga0496110_0052227 3300048913 Bacteria 3592
304 Ga0496110_0110237 3300048913 Bacteria 2473
305 Ga0496110_0257769 3300048913 Bacteria 1587
306 Ga0496111_0003145 3300048914 Bacteria 10157
307 Ga0496111_0044002 3300048914 Bacteria 3209
308 Ga0496111_0269762 3300048914 Bacteria 1262
309 Ga0496112_0040719 3300048915 Bacteria 4543
310 Ga0496112_0121074 3300048915 Bacteria 2586
311 Ga0496112_0229968 3300048915 Bacteria 1809
312 Ga0496112_0392558 3300048915 Bacteria 1328
313 Ga0496113_0040146 3300048916 Bacteria 3447
314 Ga0496113_0289116 3300048916 Unclassified 1311
315 Ga0496114_0003362 3300048917 Bacteria 12289
316 Ga0496114_0072617 3300048917 Bacteria 2894
317 Ga0496114_0212410 3300048917 Bacteria 1697
318 Ga0496114_0471777 3300048917 Bacteria 1110
319 Ga0496115_0013798 3300048918 Bacteria 6118
320 Ga0496115_0107174 3300048918 Bacteria 2294
321 Ga0501031_0001016 3300049568 Bacteria 16984
322 Ga0501031_0033909 3300049568 Bacteria 3332
323 Ga0501031_0047523 3300049568 Bacteria 2798
324 Ga0501031_0149216 3300049568 Bacteria 1527
325 Ga0501033_0021378 3300049570 Bacteria 4881
326 Ga0501033_0111765 3300049570 Bacteria 1988
327 Ga0501033_0151378 3300049570 Bacteria 1674
328 Ga0501034_0034567 3300049571 Bacteria 5124
329 Ga0501036_0002076 3300049572 Bacteria 15616
330 Ga0501036_0017389 3300049572 Bacteria 6011
331 Ga0501036_0083628 3300049572 Bacteria 2698
332 Ga0501037_0001731 3300049573 Bacteria 15846
333 Ga0501037_0058380 3300049573 Bacteria 2816
334 Ga0501037_0107482 3300049573 Bacteria 2010
335 Ga0501038_0006788 3300049574 Bacteria 10571
336 Ga0501038_0015616 3300049574 Bacteria 6902
337 Ga0501038_0130460 3300049574 Bacteria 2064
338 Ga0501038_0294167 3300049574 Bacteria 1275
339 Ga0501039_0015823 3300049575 Bacteria 5775
340 Ga0501039_0059112 3300049575 Bacteria 2969
341 Ga0501039_0062951 3300049575 Bacteria 2874
342 Ga0501040_0010557 3300049576 Bacteria 6039
343 Ga0501040_0011896 3300049576 Bacteria 5693
344 Ga0501040_0016677 3300049576 Bacteria 4866
345 Ga0501040_0034592 3300049576 Bacteria 3422
346 Ga0501040_0055433 3300049576 Bacteria 2718
347 Ga0501040_0166593 3300049576 Bacteria 1559
348 Ga0501041_0000235 3300049577 Bacteria 25715
349 Ga0501041_0019626 3300049577 Bacteria 4038
350 Ga0501041_0048794 3300049577 Bacteria 2578
351 Ga0501042_0000886 3300049578 Bacteria 16731
352 Ga0501042_0028598 3300049578 Bacteria 3929
353 Ga0501042_0046216 3300049578 Bacteria 3103
354 Ga0501043_0001696 3300049579 Bacteria 19096
355 Ga0501043_0070086 3300049579 Bacteria 2754
356 Ga0501046_0013699 3300049580 Bacteria 6856
357 Ga0501046_0073728 3300049580 Bacteria 2649
358 Ga0501046_0262854 3300049580 Bacteria 1267
359 Ga0501048_0004344 3300049582 Bacteria 10793
360 Ga0501048_0021282 3300049582 Bacteria 4749
361 Ga0501048_0038503 3300049582 Bacteria 3430
362 Ga0501067_0044955 3300049583 Bacteria 2453
363 Ga0501068_0001541 3300049584 Bacteria 12248
364 Ga0501068_0003100 3300049584 Bacteria 8878
365 Ga0501068_0375298 3300049584 Bacteria 915
366 Ga0501068_0510812 3300049584 Bacteria 780
367 Ga0501069_0002583 3300049585 Bacteria 9242
368 Ga0501069_0019637 3300049585 Bacteria 3656
369 Ga0501069_0097100 3300049585 Bacteria 1670
370 Ga0501070_0007108 3300049586 Bacteria 9518
371 Ga0501070_0555449 3300049586 Bacteria 919
372 Ga0501070_0997483 3300049586 Bacteria 649
373 Ga0501071_0001612 3300049587 Bacteria 13234
374 Ga0501071_0008377 3300049587 Bacteria 6832
375 Ga0501071_0018706 3300049587 Bacteria 4802
376 Ga0501071_0071580 3300049587 Bacteria 2528
377 Ga0501072_0000556 3300049588 Bacteria 26850
378 Ga0501072_0011384 3300049588 Bacteria 6798
379 Ga0501072_0068110 3300049588 Bacteria 2810
380 Ga0501072_0073672 3300049588 Bacteria 2699
381 Ga0501073_0009280 3300049589 Bacteria 7256
382 Ga0501074_0054359 3300049590 Bacteria 2887
383 Ga0501074_0088264 3300049590 Bacteria 2221
384 Ga0501075_0005486 3300049591 Bacteria 8676
385 Ga0501075_0009278 3300049591 Bacteria 6884
386 Ga0501075_0023721 3300049591 Bacteria 4492
387 Ga0501075_0083439 3300049591 Bacteria 2420
388 Ga0501075_0516673 3300049591 Bacteria 911
389 Ga0501076_0001551 3300049592 Bacteria 15383
390 Ga0501076_0002839 3300049592 Bacteria 11983
391 Ga0501076_0291965 3300049592 Bacteria 1336
392 Ga0501076_0774475 3300049592 Bacteria 792
393 Ga0501077_0039285 3300049593 Bacteria 3014
394 Ga0501077_0044949 3300049593 Bacteria 2805
395 Ga0501077_0065653 3300049593 Bacteria 2301
396 Ga0501077_0129089 3300049593 Bacteria 1602
397 Ga0501079_0008274 3300049741 Bacteria 7886
398 Ga0501079_0014711 3300049741 Bacteria 5963
399 Ga0501079_0028003 3300049741 Bacteria 4322
400 Ga0501079_0171385 3300049741 Bacteria 1692
401 Ga0501079_0197791 3300049741 Bacteria 1569
402 Ga0501079_0535929 3300049741 Bacteria 920
403 Ga0501080_0067454 3300049742 Bacteria 3327
404 Ga0501080_0067996 3300049742 Bacteria 3314
405 Ga0501080_0465118 3300049742 Bacteria 1133
406 Ga0501081_0031502 3300049743 Bacteria 3593
407 Ga0501081_0046940 3300049743 Bacteria 2970
408 Ga0501081_0368549 3300049743 Bacteria 1060
409 Ga0501083_0007136 3300049744 Bacteria 7933
410 Ga0501083_0042546 3300049744 Bacteria 3079
411 Ga0501035_0008865 3300049822 Bacteria 9360
412 Ga0501035_0089086 3300049822 Bacteria 2718
413 Ga0501044_0011094 3300049823 Bacteria 9773
414 Ga0501045_0001594 3300049824 Bacteria 15148
415 Ga0501045_0053066 3300049824 Bacteria 2961
416 Ga0501045_0084199 3300049824 Bacteria 2346
417 Ga0501045_0162355 3300049824 Bacteria 1663
418 nmdc:mga05p37_482423_c1 3300050507 Bacteria 1427
419 nmdc:mga05p37_6300_c1 3300050507 Bacteria 13965
420 nmdc:mga09592_48816_c1 3300050508 Bacteria 3569
421 nmdc:mga0qj67_4025_c2 3300050509 Bacteria 9592
422 nmdc:mga06r32_1108112_c1 3300050510 Bacteria 740
423 nmdc:mga06r32_294301_c1 3300050510 Bacteria 1610
424 nmdc:mga08y16_145724_c1 3300050511 Unclassified 2462
425 nmdc:mga0n895_693804_c1 3300050512 Unclassified 1014
426 Ga0495601_0050832 3300053077 Bacteria 2615
427 Ga0495601_0241413 3300053077 Bacteria 1179
428 Ga0495619_0135036 3300053085 Bacteria 1697
429 Ga0501084_0003746 3300054114 Bacteria 12353
430 Ga0501084_0032475 3300054114 Bacteria 4366
431 Ga0501084_0130733 3300054114 Bacteria 2113
432 Ga0501084_0131933 3300054114 Bacteria 2103
433 Ga0501084_0568186 3300054114 Bacteria 958
434 Ga0501082_0019625 3300060353 Bacteria 5828
435 Ga0501082_0304700 3300060353 Bacteria 1387
436 Ga0501082_0340685 3300060353 Bacteria 1306
437 Ga0501082_0414702 3300060353 Bacteria 1176
438 Ga0466962_0049203 3300061719 Bacteria 2015
439 Ga0466962_0087694 3300061719 Bacteria 1490
440 Ga0530510_0003924 3300061734 Bacteria 10260
441 Ga0530510_0007685 3300061734 Bacteria 7509
442 Ga0530510_0491321 3300061734 Bacteria 930
443 Ga0495674_0257872
444 Ga0070658_10447233
445 Ga0070683_100405662
446 Ga0068869_100524700
447 Ga0070660_100008257
448 Ga0070661_100077639
449 Ga0070659_100004574
450 Ga0070667_100002001
451 Ga0070709_10118783
452 Ga0070714_100107809
453 Ga0070713_100001060
454 Ga0070713_100122635
455 Ga0070713_100495933
456 Ga0070710_10003601
457 Ga0070710_10045820
458 Ga0070711_100010538
459 Ga0070711_100013538
460 Ga0070711_100897966
461 Ga0070700_100261396
462 Ga0070663_100127906
463 Ga0070678_100317736
464 Ga0070662_100054865
465 Ga0070681_10218363
466 Ga0070685_10254324
467 Ga0070707_100193711
468 Ga0070679_100280231
469 Ga0070684_100113410
470 Ga0070684_100221445
471 Ga0070686_100270291
472 Ga0070695_100000029
473 Ga0070693_100049515
474 Ga0068855_100023527
475 Ga0068855_100034915
476 Ga0068855_101475939
477 Ga0070664_101196813
478 Ga0068856_100170642
479 Ga0070702_100203745
480 Ga0068852_100058909
481 Ga0068864_100077415
482 Ga0068866_10388424
483 Ga0068851_10336701
484 Ga0068860_100437465
485 Ga0081538_10000755
486 Ga0081538_10080474
487 Ga0081539_10008668
488 Ga0070717_10005467
489 Ga0070717_10007849
490 Ga0070717_10055101
491 Ga0070717_10095683
492 Ga0070715_10012869
493 Ga0070716_100001457
494 Ga0070712_100050404
495 Ga0097621_100467162
496 Ga0068871_100294551
497 Ga0075428_100005327
498 Ga0075428_100114666
499 Ga0075430_100062354
500 Ga0075429_100026506
501 Ga0105240_10017296
502 Ga0105240_10520667
503 Ga0105240_10864539
504 Ga0111539_10001300
505 Ga0105245_10177538
506 Ga0105245_11130609
507 Ga0114129_10003789
508 Ga0114129_11948167
509 Ga0105248_10525659
510 Ga0105237_10242432
511 Ga0105237_10589854
512 Ga0105238_10279935
513 Ga0105249_10676968
514 Ga0157370_10052000
515 Ga0157370_10648561
516 Ga0157369_10037107
517 Ga0157369_10463224
518 Ga0157374_10085634
519 Ga0157374_10448333
520 Ga0157378_10062284
521 Ga0157378_10291366
522 Ga0163162_10453345
523 Ga0157372_10212614
524 Ga0157372_10793621
525 Ga0157375_10206245
526 Ga0163163_10789226
527 Ga0157379_10548508
528 Ga0157376_10052208
529 Ga0157376_10230529
530 Ga0157376_10761931
531 Ga0206354_11320085
532 Ga0213873_10074228
533 Ga0207692_10010091
534 Ga0207692_10254656
535 Ga0207642_10259665
536 Ga0207688_10067602
537 Ga0207685_10010888
538 Ga0207699_10067577
539 Ga0207699_10410639
540 Ga0207705_10052949
541 Ga0207705_10240828
542 Ga0207705_10397196
543 Ga0207707_10033767
544 Ga0207695_10357531
545 Ga0207671_10040792
546 Ga0207693_10000282
547 Ga0207693_10027484
548 Ga0207663_10161941
549 Ga0207663_10271518
550 Ga0207657_10000988
551 Ga0207646_10001768
552 Ga0207681_10324315
553 Ga0207694_10237991
554 Ga0207659_10581063
555 Ga0207687_10323510
556 Ga0207700_10099280
557 Ga0207700_10199972
558 Ga0207664_10012931
559 Ga0207644_10277549
560 Ga0207690_10157488
561 Ga0207706_10412619
562 Ga0207686_10211286
563 Ga0207704_10086150
564 Ga0207665_10046984
565 Ga0207665_10253744
566 Ga0207691_10428276
567 Ga0207711_10328741
568 Ga0207689_10010513
569 Ga0207661_10031156
570 Ga0207661_10311554
571 Ga0207667_10233129
572 Ga0207667_10958007
573 Ga0207651_10139431
574 Ga0207640_10027665
575 Ga0207658_10002326
576 Ga0207678_10238502
577 Ga0207708_10113002
578 Ga0207702_10074335
579 Ga0207702_10168929
580 Ga0207702_10180055
581 Ga0207641_10298552
582 Ga0207674_10447324
583 Ga0207683_10078578
584 Ga0207698_10326490
585 Ga0207698_10547621
586 Ga0207698_10549535
587 Ga0268264_10617957
588 Ga0265338_10159263
589 Ga0265338_10595309
590 Ga0265330_10029460
591 Ga0307408_100182353
592 Ga0265313_10061599
593 Ga0307413_10761849
594 Ga0307406_10031146
595 Ga0307409_100214615
596 Ga0307416_100025225
597 Ga0307416_100275042
598 Ga0307416_100644264
599 Ga0373940_0159055
600 Ga0373944_0009886
601 Ga0373949_0128917
602 Ga0373943_0019977
603 Ga0373931_0368858
604 Ga0373935_0041242
605 Ga0373927_0063317
606 Ga0373933_0113008
607 Ga0373947_0002635
608 Ga0373937_0075507
609 Ga0395899_0033167
610 Ga0395900_0027999
611 Ga0395900_0119994
612 Ga0395898_0016168
613 Ga0395898_0136690
614 Ga0395898_0181317
615 Ga0395905_0050522
616 Ga0395905_0386219
617 Ga0395901_0058107
618 Ga0395901_0088306
619 Ga0395901_0276834
620 Ga0395901_0438889
621 Ga0395901_0563565
622 Ga0436362_0000471
623 Ga0439438_036801
624 Ga0450906_014602
625 Ga0466969_0053139
626 Ga0466965_0023576
627 Ga0466961_0391085
628 Ga0466963_0077508
629 Ga0466963_0078175
630 Ga0466963_0181477
631 Ga0466963_0211398
632 Ga0466964_0007998
633 Ga0466964_0024500
634 Ga0466968_0020838
635 Ga0466957_0165828
636 Ga0466957_0289283
637 Ga0466959_0036203
638 Ga0466959_0299207
639 Ga0466958_0032165
640 Ga0466958_0041087
641 Ga0466967_0025255
642 Ga0466967_0037568
643 Ga0466967_0405652
644 Ga0466967_0426292
645 Ga0466967_0762391
646 Ga0495592_0584903
647 Ga0495603_0083302
648 Ga0495629_0112651
649 Ga0495641_0019598
650 Ga0495641_0038382
651 Ga0495641_0043074
652 Ga0495641_0083368
653 Ga0495653_0143061
654 Ga0495582_0069467
655 Ga0495582_0116618
656 Ga0495605_0069507
657 Ga0495662_0177524
658 Ga0495664_0136601
659 Ga0495664_0186000
660 Ga0495584_0010750
661 Ga0495585_0044217
662 Ga0495607_0032668
663 Ga0495607_0208494
664 Ga0495618_0094128
665 Ga0495618_0561653
666 Ga0495630_0011832
667 Ga0495630_0480587
668 Ga0495630_0704429
669 Ga0495630_0863965
670 Ga0495644_0009501
671 Ga0495644_0218891
672 Ga0495663_0059928
673 Ga0495642_0133732
674 Ga0495652_0034234
675 Ga0495640_0026151
676 Ga0495586_0480710
677 Ga0495587_0053413
678 Ga0495609_0047883
679 Ga0495645_0090312
680 Ga0495667_0029836
681 Ga0495656_0003250
682 Ga0495634_0085799
683 Ga0495661_0121304
684 Ga0495599_0110985
685 Ga0495647_0043727
686 Ga0495647_0116964
687 Ga0495658_0122850
688 Ga0495658_0310019
689 Ga0495669_0167979
690 Ga0495613_0031151
691 Ga0495613_0289388
692 Ga0495624_0030034
693 Ga0495624_0059830
694 Ga0495624_0553987
695 Ga0495581_0079772
696 Ga0495604_0064035
697 Ga0495604_0242938
698 Ga0495636_0147057
699 Ga0495674_0011878
700 Ga0495674_0021386
701 Ga0495674_0146197
702 Ga0495676_0043187
703 Ga0495676_0168832
704 Ga0495680_0005532
705 Ga0495683_0156718
706 Ga0495684_0349329
707 Ga0495602_0240004
708 Ga0496100_0009080
709 Ga0496100_0168952
710 Ga0496100_0569675
711 Ga0496101_0012492
712 Ga0496101_0075242
713 Ga0496101_0180970
714 Ga0496101_0202072
715 Ga0496101_0632599
716 Ga0496102_0013068
717 Ga0496102_0070550
718 Ga0496102_0923789
719 Ga0496104_0055988
720 Ga0496104_0088948
721 Ga0496104_0152100
722 Ga0496104_0375070
723 Ga0496104_0645456
724 Ga0496105_0001042
725 Ga0496105_0090037
726 Ga0496105_0149450
727 Ga0496106_0013216
728 Ga0496106_0093144
729 Ga0496106_0437519
730 Ga0496107_0001734
731 Ga0496107_0177223
732 Ga0496107_0352381
733 Ga0496108_0008931
734 Ga0496108_0028356
735 Ga0496108_0035181
736 Ga0496108_0061474
737 Ga0496108_0100312
738 Ga0496109_0001931
739 Ga0496109_0008195
740 Ga0496109_0018533
741 Ga0496109_0032272
742 Ga0496109_0067449
743 Ga0496109_0465637
744 Ga0496110_0010243
745 Ga0496110_0052227
746 Ga0496110_0110237
747 Ga0496110_0257769
748 Ga0496111_0003145
749 Ga0496111_0044002
750 Ga0496111_0269762
751 Ga0496112_0040719
752 Ga0496112_0121074
753 Ga0496112_0229968
754 Ga0496112_0392558
755 Ga0496113_0040146
756 Ga0496113_0289116
757 Ga0496114_0003362
758 Ga0496114_0072617
759 Ga0496114_0212410
760 Ga0496114_0471777
761 Ga0496115_0013798
762 Ga0496115_0107174
763 Ga0501031_0001016
764 Ga0501031_0033909
765 Ga0501031_0047523
766 Ga0501031_0149216
767 Ga0501033_0021378
768 Ga0501033_0111765
769 Ga0501033_0151378
770 Ga0501034_0034567
771 Ga0501036_0002076
772 Ga0501036_0017389
773 Ga0501036_0083628
774 Ga0501037_0001731
775 Ga0501037_0058380
776 Ga0501037_0107482
777 Ga0501038_0006788
778 Ga0501038_0015616
779 Ga0501038_0130460
780 Ga0501038_0294167
781 Ga0501039_0015823
782 Ga0501039_0059112
783 Ga0501039_0062951
784 Ga0501040_0010557
785 Ga0501040_0011896
786 Ga0501040_0016677
787 Ga0501040_0034592
788 Ga0501040_0055433
789 Ga0501040_0166593
790 Ga0501041_0000235
791 Ga0501041_0019626
792 Ga0501041_0048794
793 Ga0501042_0000886
794 Ga0501042_0028598
795 Ga0501042_0046216
796 Ga0501043_0001696
797 Ga0501043_0070086
798 Ga0501046_0013699
799 Ga0501046_0073728
800 Ga0501046_0262854
801 Ga0501048_0004344
802 Ga0501048_0021282
803 Ga0501048_0038503
804 Ga0501067_0044955
805 Ga0501068_0001541
806 Ga0501068_0003100
807 Ga0501068_0375298
808 Ga0501068_0510812
809 Ga0501069_0002583
810 Ga0501069_0019637
811 Ga0501069_0097100
812 Ga0501070_0007108
813 Ga0501070_0555449
814 Ga0501070_0997483
815 Ga0501071_0001612
816 Ga0501071_0008377
817 Ga0501071_0018706
818 Ga0501071_0071580
819 Ga0501072_0000556
820 Ga0501072_0011384
821 Ga0501072_0068110
822 Ga0501072_0073672
823 Ga0501073_0009280
824 Ga0501074_0054359
825 Ga0501074_0088264
826 Ga0501075_0005486
827 Ga0501075_0009278
828 Ga0501075_0023721
829 Ga0501075_0083439
830 Ga0501075_0516673
831 Ga0501076_0001551
832 Ga0501076_0002839
833 Ga0501076_0291965
834 Ga0501076_0774475
835 Ga0501077_0039285
836 Ga0501077_0044949
837 Ga0501077_0065653
838 Ga0501077_0129089
839 Ga0501079_0008274
840 Ga0501079_0014711
841 Ga0501079_0028003
842 Ga0501079_0171385
843 Ga0501079_0197791
844 Ga0501079_0535929
845 Ga0501080_0067454
846 Ga0501080_0067996
847 Ga0501080_0465118
848 Ga0501081_0031502
849 Ga0501081_0046940
850 Ga0501081_0368549
851 Ga0501083_0007136
852 Ga0501083_0042546
853 Ga0501035_0008865
854 Ga0501035_0089086
855 Ga0501044_0011094
856 Ga0501045_0001594
857 Ga0501045_0053066
858 Ga0501045_0084199
859 Ga0501045_0162355
860 nmdc:mga05p37_482423_c1
861 nmdc:mga05p37_6300_c1
862 nmdc:mga09592_48816_c1
863 nmdc:mga0qj67_4025_c2
864 nmdc:mga06r32_1108112_c1
865 nmdc:mga06r32_294301_c1
866 nmdc:mga08y16_145724_c1
867 nmdc:mga0n895_693804_c1
868 Ga0495601_0050832
869 Ga0495601_0241413
870 Ga0495619_0135036
871 Ga0501084_0003746
872 Ga0501084_0032475
873 Ga0501084_0130733
874 Ga0501084_0131933
875 Ga0501084_0568186
876 Ga0501082_0019625
877 Ga0501082_0304700
878 Ga0501082_0340685
879 Ga0501082_0414702
880 Ga0466962_0049203
881 Ga0466962_0087694
882 Ga0530510_0003924
883 Ga0530510_0007685
884 Ga0530510_0491321

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

47

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ee6-assembly1.cif.gz_A cryo-em structure of human abca7 in pe/ch nanodiscs 0.9419 2 192
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9396 2 192
7o17-assembly1.cif.gz_B abc transporter nosdfy e154q, atp-bound in lipid nanodisc 0.9372 2 190
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.9357 2 192
5x40-assembly1.cif.gz_B structure of a cbio dimer bound with amppcp 0.9335 2 191
ID Description Score Start End Superfamily
af_Q1RS86_1791_2054_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9465 2 191 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9437 2 192 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9436 2 191 3.40.50.300
af_D3ZCF8_477_737_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9401 2 192 3.40.50.300
af_Q0E8Q7_1247_1483_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9393 2 192 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A538EVU0-F1-model_v4 ABC transporter ATP-binding protein 0.9916 2 192 GO:0005524
GO:0016887
AF-A0A538DEN6-F1-model_v4 ABC transporter ATP-binding protein 0.9913 2 192 GO:0005524
GO:0016887
AF-A0A538IJJ8-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA 0.9906 1 192 GO:0005524
GO:0016887
GO:0017004
GO:0022857
AF-A0A538I2K6-F1-model_v4 ABC transporter ATP-binding protein 0.9888 2 192 GO:0005524
GO:0016887
AF-A0A7W1H1V9-F1-model_v4 ABC transporter ATP-binding protein 0.9882 1 192 GO:0005524
GO:0016887

Map