F444847

General Info

Members Datasets Scaffolds Average Seq Length
442 250 882 90

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10066247|Ga0081538_100662473
Length 97
Sequence VTVRLRWFGATGRRVPEIAVEGEDDIPLEEALVLDGVEDEQRLRAAHAEGTPVVVRAADEEAVTRALARPEVACVLVPAERRELRDLDLRRLTYGHE

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
168 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
169 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
173 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
174 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
186 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
187 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
207 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 7.92
Rhizosphere 90.95
Stem 0
Stem Tuber 0
Unclassified 23.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10066247 3300005981 Archaea 2026
2 Ga0070683_100005256 3300005329 Bacteria 10777
3 Ga0070683_100005855 3300005329 Bacteria 10288
4 Ga0070683_100010814 3300005329 Bacteria 7853
5 Ga0070683_100071296 3300005329 Bacteria 3242
6 Ga0070670_100065518 3300005331 Bacteria 3117
7 Ga0068869_100705248 3300005334 Unclassified 861
8 Ga0070666_10221532 3300005335 Unclassified 1335
9 Ga0068868_100683210 3300005338 Bacteria 917
10 Ga0070689_100515928 3300005340 Bacteria 1026
11 Ga0070687_101398638 3300005343 Bacteria 523
12 Ga0070661_100140146 3300005344 Bacteria 1822
13 Ga0070669_100512773 3300005353 Unclassified 996
14 Ga0070675_101464455 3300005354 Unclassified 630
15 Ga0070674_101191102 3300005356 Bacteria 676
16 Ga0070673_100746996 3300005364 Bacteria 901
17 Ga0070688_100945827 3300005365 Bacteria 682
18 Ga0070659_100376228 3300005366 Unclassified 1195
19 Ga0070709_10003375 3300005434 Bacteria 8579
20 Ga0070714_100047100 3300005435 Bacteria 3661
21 Ga0070714_100047309 3300005435 Bacteria 3654
22 Ga0070713_100000665 3300005436 Bacteria 21987
23 Ga0070710_10052366 3300005437 Bacteria 2295
24 Ga0070701_10162621 3300005438 Unclassified 1294
25 Ga0070701_10561800 3300005438 Unclassified 750
26 Ga0070711_100018221 3300005439 Bacteria 4480
27 Ga0070711_100163418 3300005439 Bacteria 1690
28 Ga0070694_100561694 3300005444 Unclassified 915
29 Ga0070678_100087119 3300005456 Bacteria 2384
30 Ga0070678_100802169 3300005456 Unclassified 855
31 Ga0070662_101002974 3300005457 Bacteria 715
32 Ga0070681_11580422 3300005458 Unclassified 581
33 Ga0068867_100332732 3300005459 Unclassified 1262
34 Ga0070685_10114432 3300005466 Unclassified 1667
35 Ga0070685_10157931 3300005466 Bacteria 1443
36 Ga0070685_10607197 3300005466 Unclassified 788
37 Ga0070706_101255781 3300005467 Bacteria 680
38 Ga0070707_100605794 3300005468 Bacteria 1058
39 Ga0070698_100016119 3300005471 Bacteria 7890
40 Ga0070698_101480871 3300005471 Bacteria 630
41 Ga0070679_101643827 3300005530 Bacteria 590
42 Ga0070684_100000684 3300005535 Bacteria 23405
43 Ga0070684_100006952 3300005535 Bacteria 8789
44 Ga0070684_100187280 3300005535 Bacteria 1883
45 Ga0070684_100313265 3300005535 Bacteria 1441
46 Ga0070684_101077013 3300005535 Bacteria 755
47 Ga0070684_101430487 3300005535 Unclassified 651
48 Ga0070672_101406714 3300005543 Unclassified 624
49 Ga0070686_100122454 3300005544 Unclassified 1788
50 Ga0070696_100742908 3300005546 Bacteria 803
51 Ga0070704_100079087 3300005549 Bacteria 2414
52 Ga0070704_101239117 3300005549 Unclassified 681
53 Ga0068855_100195109 3300005563 Bacteria 2281
54 Ga0070664_100097546 3300005564 Bacteria 2552
55 Ga0070664_100180858 3300005564 Bacteria 1874
56 Ga0068857_100001754 3300005577 Bacteria 17436
57 Ga0068857_100003359 3300005577 Bacteria 13322
58 Ga0068857_100076479 3300005577 Unclassified 2985
59 Ga0068857_100107758 3300005577 Bacteria 2503
60 Ga0068857_100108061 3300005577 Unclassified 2499
61 Ga0068854_100942503 3300005578 Unclassified 761
62 Ga0068854_102220914 3300005578 Bacteria 508
63 Ga0068856_100143328 3300005614 Bacteria 2397
64 Ga0068856_100203393 3300005614 Unclassified 1995
65 Ga0068856_100225248 3300005614 Bacteria 1891
66 Ga0070702_100391636 3300005615 Unclassified 991
67 Ga0070702_100535859 3300005615 Bacteria 866
68 Ga0068852_101647408 3300005616 Unclassified 664
69 Ga0068864_100232160 3300005618 Unclassified 1707
70 Ga0068861_101264093 3300005719 Bacteria 716
71 Ga0068870_10116985 3300005840 Unclassified 1530
72 Ga0068858_100195305 3300005842 Unclassified 1912
73 Ga0068858_101756698 3300005842 Unclassified 613
74 Ga0068862_100498178 3300005844 Bacteria 1156
75 Ga0081455_10023318 3300005937 Bacteria 5761
76 Ga0081455_10024712 3300005937 Bacteria 5557
77 Ga0081455_10047881 3300005937 Unclassified 3698
78 Ga0081455_10109496 3300005937 Bacteria 2198
79 Ga0081455_10431318 3300005937 Bacteria 906
80 Ga0081538_10024848 3300005981 Bacteria 4251
81 Ga0081538_10196312 3300005981 Bacteria 837
82 Ga0081540_1002004 3300005983 Bacteria 16993
83 Ga0081539_10002896 3300005985 Bacteria 22735
84 Ga0070717_10027025 3300006028 Bacteria 4584
85 Ga0075432_10398385 3300006058 Unclassified 594
86 Ga0070715_10006216 3300006163 Bacteria 4045
87 Ga0070716_100004644 3300006173 Bacteria 6581
88 Ga0070712_100047759 3300006175 Bacteria 2964
89 Ga0070712_100089572 3300006175 Bacteria 2251
90 Ga0075366_10737007 3300006195 Unclassified 612
91 Ga0097621_100379079 3300006237 Bacteria 1263
92 Ga0068871_101682131 3300006358 Bacteria 602
93 Ga0075428_100097097 3300006844 Bacteria 3212
94 Ga0075428_101155120 3300006844 Unclassified 817
95 Ga0075428_101925705 3300006844 Bacteria 614
96 Ga0075428_102248846 3300006844 Unclassified 562
97 Ga0075430_100082694 3300006846 Bacteria 2690
98 Ga0075430_100113944 3300006846 Bacteria 2253
99 Ga0075430_100546125 3300006846 Bacteria 956
100 Ga0075431_100519282 3300006847 Bacteria 1180
101 Ga0075433_10531152 3300006852 Bacteria 1035
102 Ga0075429_100011553 3300006880 Bacteria 7658
103 Ga0075429_100155439 3300006880 Bacteria 2003
104 Ga0075429_100380596 3300006880 Bacteria 1236
105 Ga0068865_100269679 3300006881 Bacteria 1351
106 Ga0105251_10256829 3300009011 Bacteria 788
107 Ga0105240_10576366 3300009093 Bacteria 1242
108 Ga0111539_10001945 3300009094 Bacteria 27545
109 Ga0111539_10403705 3300009094 Bacteria 1592
110 Ga0111539_11000446 3300009094 Bacteria 972
111 Ga0111539_11936920 3300009094 Bacteria 683
112 Ga0105245_10194198 3300009098 Unclassified 1946
113 Ga0105245_10234656 3300009098 Bacteria 1776
114 Ga0105245_10356557 3300009098 Bacteria 1450
115 Ga0105245_10406768 3300009098 Bacteria 1361
116 Ga0114129_10133754 3300009147 Bacteria 3404
117 Ga0114129_10551443 3300009147 Bacteria 1499
118 Ga0114129_10688605 3300009147 Bacteria 1315
119 Ga0114129_11844782 3300009147 Bacteria 734
120 Ga0105243_10518342 3300009148 Unclassified 1133
121 Ga0105243_11086472 3300009148 Bacteria 807
122 Ga0105243_11918198 3300009148 Bacteria 625
123 Ga0105241_11151540 3300009174 Bacteria 732
124 Ga0105242_10086709 3300009176 Bacteria 2627
125 Ga0105248_10502553 3300009177 Unclassified 1367
126 Ga0105249_10133061 3300009553 Bacteria 2376
127 Ga0105239_10023125 3300010375 Bacteria 6849
128 Ga0105239_10435356 3300010375 Bacteria 1486
129 Ga0105246_10044989 3300011119 Bacteria 3004
130 Ga0105246_10350152 3300011119 Bacteria 1210
131 Ga0157374_10089816 3300013296 Bacteria 2928
132 Ga0157374_11096926 3300013296 Bacteria 816
133 Ga0157378_12816257 3300013297 Bacteria 539
134 Ga0163162_10622716 3300013306 Unclassified 1204
135 Ga0157375_11039872 3300013308 Unclassified 957
136 Ga0157375_11354039 3300013308 Unclassified 838
137 Ga0163163_10380970 3300014325 Bacteria 1468
138 Ga0163163_11523826 3300014325 Bacteria 730
139 Ga0157377_10329000 3300014745 Unclassified 1018
140 Ga0157376_10444303 3300014969 Unclassified 1263
141 Ga0157376_12407014 3300014969 Unclassified 566
142 Ga0197907_10573683 3300020069 Bacteria 1790
143 Ga0213871_10196930 3300021441 Archaea 627
144 Ga0224712_10076446 3300022467 Unclassified 1372
145 Ga0207692_10004525 3300025898 Bacteria 5515
146 Ga0207642_10391888 3300025899 Bacteria 829
147 Ga0207710_10072371 3300025900 Bacteria 1583
148 Ga0207688_10008351 3300025901 Bacteria 5632
149 Ga0207680_10775772 3300025903 Unclassified 687
150 Ga0207685_10012639 3300025905 Bacteria 2583
151 Ga0207699_10019938 3300025906 Bacteria 3585
152 Ga0207643_10044021 3300025908 Unclassified 2520
153 Ga0207705_11424013 3300025909 Bacteria 526
154 Ga0207684_10847749 3300025910 Unclassified 770
155 Ga0207654_10435446 3300025911 Bacteria 917
156 Ga0207693_10002222 3300025915 Bacteria 16897
157 Ga0207693_10104327 3300025915 Bacteria 2223
158 Ga0207663_10015497 3300025916 Bacteria 4206
159 Ga0207663_10137096 3300025916 Bacteria 1700
160 Ga0207649_10970840 3300025920 Bacteria 668
161 Ga0207646_10185383 3300025922 Bacteria 1879
162 Ga0207659_11318273 3300025926 Unclassified 620
163 Ga0207687_10300227 3300025927 Bacteria 1293
164 Ga0207687_10425966 3300025927 Bacteria 1096
165 Ga0207700_10018468 3300025928 Bacteria 4686
166 Ga0207664_10005597 3300025929 Bacteria 8600
167 Ga0207664_10021374 3300025929 Bacteria 4810
168 Ga0207706_10114384 3300025933 Unclassified 2373
169 Ga0207686_10357936 3300025934 Bacteria 1101
170 Ga0207686_11461581 3300025934 Bacteria 563
171 Ga0207709_10396046 3300025935 Unclassified 1054
172 Ga0207709_10841523 3300025935 Bacteria 743
173 Ga0207709_11496872 3300025935 Bacteria 560
174 Ga0207709_11521790 3300025935 Bacteria 555
175 Ga0207669_10685611 3300025937 Bacteria 841
176 Ga0207669_10746675 3300025937 Bacteria 808
177 Ga0207669_11336006 3300025937 Unclassified 609
178 Ga0207704_10250847 3300025938 Bacteria 1328
179 Ga0207704_11153670 3300025938 Bacteria 660
180 Ga0207665_10000562 3300025939 Bacteria 25011
181 Ga0207689_10137348 3300025942 Unclassified 2013
182 Ga0207689_11634840 3300025942 Unclassified 535
183 Ga0207661_10090337 3300025944 Bacteria 2550
184 Ga0207661_10109319 3300025944 Bacteria 2335
185 Ga0207661_10115209 3300025944 Bacteria 2280
186 Ga0207661_10149829 3300025944 Bacteria 2015
187 Ga0207661_10825666 3300025944 Bacteria 853
188 Ga0207661_10900616 3300025944 Unclassified 815
189 Ga0207661_11770997 3300025944 Bacteria 563
190 Ga0207679_10079839 3300025945 Bacteria 2496
191 Ga0207667_10120371 3300025949 Bacteria 2705
192 Ga0207651_10312561 3300025960 Bacteria 1311
193 Ga0207712_10358510 3300025961 Bacteria 1214
194 Ga0207677_10727514 3300026023 Bacteria 883
195 Ga0207677_11311126 3300026023 Bacteria 665
196 Ga0207703_11604797 3300026035 Unclassified 626
197 Ga0207678_10301101 3300026067 Bacteria 1378
198 Ga0207708_10736806 3300026075 Bacteria 845
199 Ga0207708_11804272 3300026075 Bacteria 537
200 Ga0207702_10174415 3300026078 Bacteria 1974
201 Ga0207702_10277023 3300026078 Bacteria 1584
202 Ga0207648_10483381 3300026089 Unclassified 1131
203 Ga0207674_10000820 3300026116 Bacteria 40413
204 Ga0207674_10002796 3300026116 Bacteria 21727
205 Ga0207674_10069097 3300026116 Unclassified 3553
206 Ga0207674_10180748 3300026116 Bacteria 2061
207 Ga0207674_10184404 3300026116 Unclassified 2037
208 Ga0207675_102616939 3300026118 Bacteria 514
209 Ga0207683_10575066 3300026121 Unclassified 1042
210 Ga0207683_11226435 3300026121 Bacteria 695
211 Ga0209998_10048489 3300027717 Bacteria 978
212 Ga0207428_10176315 3300027907 Bacteria 1617
213 Ga0265322_10022381 3300028654 Bacteria 1807
214 Ga0265336_10085783 3300028666 Bacteria 939
215 Ga0265338_10009062 3300028800 Bacteria 11970
216 Ga0265330_10054312 3300031235 Bacteria 1751
217 Ga0265325_10134025 3300031241 Bacteria 1183
218 Ga0265329_10026691 3300031242 Bacteria 1901
219 Ga0265340_10028067 3300031247 Bacteria 2833
220 Ga0265339_10065169 3300031249 Bacteria 1953
221 Ga0265331_10100367 3300031250 Bacteria 1332
222 Ga0265327_10010926 3300031251 Bacteria 6318
223 Ga0265316_10054408 3300031344 Bacteria 3133
224 Ga0307408_100068587 3300031548 Bacteria 2612
225 Ga0265313_10006421 3300031595 Bacteria 8325
226 Ga0265314_10005226 3300031711 Bacteria 11767
227 Ga0265342_10034711 3300031712 Bacteria 3092
228 Ga0307405_10181800 3300031731 Unclassified 1510
229 Ga0307405_10485279 3300031731 Bacteria 987
230 Ga0307413_10125102 3300031824 Unclassified 1749
231 Ga0307413_10276789 3300031824 Archaea 1260
232 Ga0307413_10310975 3300031824 Bacteria 1199
233 Ga0307410_10020365 3300031852 Bacteria 4056
234 Ga0307410_10598575 3300031852 Bacteria 919
235 Ga0307410_10812671 3300031852 Unclassified 796
236 Ga0307406_10010044 3300031901 Bacteria 5329
237 Ga0307406_10024605 3300031901 Bacteria 3598
238 Ga0307406_10206313 3300031901 Bacteria 1451
239 Ga0307406_10334935 3300031901 Unclassified 1176
240 Ga0307407_10209483 3300031903 Bacteria 1311
241 Ga0307407_10326091 3300031903 Bacteria 1079
242 Ga0307407_11429765 3300031903 Unclassified 545
243 Ga0307412_10077016 3300031911 Bacteria 2293
244 Ga0307412_10443856 3300031911 Bacteria 1067
245 Ga0307409_100072392 3300031995 Bacteria 2745
246 Ga0307409_100129084 3300031995 Bacteria 2156
247 Ga0307409_100159691 3300031995 Bacteria 1970
248 Ga0307416_100003519 3300032002 Bacteria 9221
249 Ga0307416_100135574 3300032002 Bacteria 2226
250 Ga0307416_100936820 3300032002 Unclassified 967
251 Ga0307411_10207099 3300032005 Bacteria 1511
252 Ga0307415_100000519 3300032126 Bacteria 16814
253 Ga0307415_100120445 3300032126 Bacteria 1966
254 Ga0307415_101142204 3300032126 Unclassified 731
255 Ga0373938_0060153 3300034957 Bacteria 887
256 Ga0373943_0396670 3300035170 Bacteria 796
257 Ga0373946_0200639 3300035171 Bacteria 955
258 Ga0373931_0182662 3300035691 Bacteria 1243
259 Ga0373935_0695447 3300035692 Bacteria 747
260 Ga0395899_0003223 3300037312 Bacteria 12940
261 Ga0395899_0009535 3300037312 Bacteria 7452
262 Ga0395899_0020484 3300037312 Bacteria 5013
263 Ga0395899_0059172 3300037312 Bacteria 2824
264 Ga0395899_0072169 3300037312 Bacteria 2526
265 Ga0395899_0159597 3300037312 Bacteria 1594
266 Ga0395899_0390989 3300037312 Archaea 922
267 Ga0395899_0546165 3300037312 Bacteria 745
268 Ga0395900_0005079 3300037418 Bacteria 13808
269 Ga0395900_0014859 3300037418 Bacteria 7934
270 Ga0395900_0040757 3300037418 Bacteria 4786
271 Ga0395900_0048907 3300037418 Bacteria 4355
272 Ga0395900_0101241 3300037418 Bacteria 2959
273 Ga0395900_0115698 3300037418 Bacteria 2752
274 Ga0395900_0124464 3300037418 Bacteria 2644
275 Ga0395900_0163350 3300037418 Bacteria 2270
276 Ga0395900_0205265 3300037418 Unclassified 1992
277 Ga0395900_0254607 3300037418 Bacteria 1755
278 Ga0395900_0265989 3300037418 Unclassified 1711
279 Ga0395900_0508170 3300037418 Bacteria 1154
280 Ga0395900_0689883 3300037418 Bacteria 955
281 Ga0395898_0002841 3300037466 Bacteria 19817
282 Ga0395898_0016670 3300037466 Bacteria 7510
283 Ga0395898_0037623 3300037466 Bacteria 4799
284 Ga0395898_0050158 3300037466 Unclassified 4086
285 Ga0395898_0051385 3300037466 Bacteria 4031
286 Ga0395898_0071383 3300037466 Bacteria 3355
287 Ga0395898_0195456 3300037466 Bacteria 1932
288 Ga0395898_0502029 3300037466 Bacteria 1154
289 Ga0395898_0688387 3300037466 Archaea 964
290 Ga0395905_0007192 3300037471 Bacteria 11113
291 Ga0395905_0017070 3300037471 Bacteria 6893
292 Ga0395905_0026329 3300037471 Bacteria 5485
293 Ga0395905_0061616 3300037471 Bacteria 3509
294 Ga0395905_0097670 3300037471 Bacteria 2758
295 Ga0395905_0192343 3300037471 Bacteria 1914
296 Ga0395905_0324300 3300037471 Unclassified 1430
297 Ga0395905_0364684 3300037471 Unclassified 1337
298 Ga0395905_0433040 3300037471 Bacteria 1212
299 Ga0395905_0514598 3300037471 Bacteria 1097
300 Ga0395901_0019470 3300038443 Bacteria 6940
301 Ga0395901_0020607 3300038443 Bacteria 6748
302 Ga0395901_0039106 3300038443 Bacteria 4908
303 Ga0395901_0049560 3300038443 Unclassified 4364
304 Ga0395901_0065824 3300038443 Bacteria 3774
305 Ga0395901_0107570 3300038443 Archaea 2928
306 Ga0395901_0189146 3300038443 Bacteria 2159
307 Ga0395901_0243609 3300038443 Bacteria 1874
308 Ga0395901_0357896 3300038443 Bacteria 1505
309 Ga0395901_0529371 3300038443 Unclassified 1196
310 Ga0395901_0529514 3300038443 Bacteria 1196
311 Ga0395901_0533920 3300038443 Bacteria 1190
312 Ga0395901_1921407 3300038443 Bacteria 539
313 Ga0436360_0990681 3300039438 Archaea 1493
314 Ga0436362_0610958 3300039453 Archaea 883
315 Ga0439466_0217320 3300041411 Unclassified 580
316 Ga0451800_0090452 3300041459 Bacteria 1126
317 Ga0451800_1268273 3300041459 Bacteria 547
318 Ga0451855_1618504 3300041511 Unclassified 1207
319 Ga0451853_1490333 3300041512 Bacteria 5637
320 Ga0451853_2903880 3300041512 Bacteria 738
321 Ga0439448_0320979 3300042005 Unclassified 551
322 Ga0450923_047506 3300042125 Bacteria 916
323 Ga0450907_023083 3300042146 Archaea 1048
324 Ga0439440_0154839 3300042993 Unclassified 658
325 Ga0495603_0068995 3300046455 Bacteria 2080
326 Ga0495590_0064416 3300046457 Bacteria 1283
327 Ga0495641_0122388 3300046461 Bacteria 1161
328 Ga0495582_0003878 3300046473 Bacteria 8421
329 Ga0495639_0185929 3300046475 Bacteria 1013
330 Ga0495584_0096334 3300046491 Bacteria 1494
331 Ga0495584_0181175 3300046491 Bacteria 1071
332 Ga0495594_0092342 3300046499 Bacteria 1697
333 Ga0495596_0093275 3300046500 Bacteria 1169
334 Ga0495596_0372641 3300046500 Bacteria 556
335 Ga0495607_0253167 3300046501 Bacteria 847
336 Ga0495630_0475270 3300046517 Bacteria 958
337 Ga0495637_0339333 3300046520 Unclassified 528
338 Ga0495644_0449426 3300046523 Unclassified 513
339 Ga0495663_0048072 3300046525 Bacteria 1315
340 Ga0495665_0113540 3300046531 Bacteria 1420
341 Ga0495609_0145179 3300046538 Bacteria 1011
342 Ga0495656_0038253 3300046615 Bacteria 1986
343 Ga0495656_0123448 3300046615 Bacteria 1225
344 Ga0495656_0631623 3300046615 Unclassified 574
345 Ga0495656_0709252 3300046615 Bacteria 541
346 Ga0495668_0141415 3300046616 Unclassified 1317
347 Ga0495611_0594004 3300046648 Bacteria 500
348 Ga0495659_0259538 3300046664 Unclassified 726
349 Ga0495661_0595693 3300046665 Bacteria 520
350 Ga0495588_0080066 3300046674 Bacteria 1705
351 Ga0495658_0070285 3300046683 Bacteria 2031
352 Ga0495669_0067770 3300046684 Bacteria 1623
353 Ga0495624_0310777 3300046690 Bacteria 950
354 Ga0495670_0070977 3300046691 Bacteria 1763
355 Ga0495671_0158830 3300046692 Bacteria 1100
356 Ga0495649_0616237 3300046694 Bacteria 535
357 Ga0495660_0316771 3300046810 Unclassified 702
358 Ga0495581_0033138 3300047315 Bacteria 2991
359 Ga0495676_0042812 3300047321 Bacteria 3713
360 Ga0495614_0294616 3300048089 Bacteria 749
361 Ga0495615_0230232 3300048090 Unclassified 581
362 Ga0495626_0420937 3300048091 Unclassified 515
363 Ga0496100_0020270 3300048903 Bacteria 3983
364 Ga0496100_1587600 3300048903 Bacteria 517
365 Ga0496101_0059473 3300048904 Bacteria 2769
366 Ga0496101_0299154 3300048904 Unclassified 1260
367 Ga0496102_0015415 3300048905 Bacteria 6657
368 Ga0496102_0269353 3300048905 Bacteria 1606
369 Ga0496102_0384441 3300048905 Unclassified 1321
370 Ga0496103_0007924 3300048906 Bacteria 6317
371 Ga0496104_1585000 3300048907 Bacteria 557
372 Ga0496105_0039095 3300048908 Bacteria 3909
373 Ga0496106_0026577 3300048909 Bacteria 4310
374 Ga0496106_0194429 3300048909 Unclassified 1613
375 Ga0496107_0001749 3300048910 Bacteria 13668
376 Ga0496108_0016349 3300048911 Bacteria 6051
377 Ga0496108_0162345 3300048911 Bacteria 1931
378 Ga0496108_0445581 3300048911 Bacteria 1131
379 Ga0496108_0909433 3300048911 Bacteria 755
380 Ga0496109_0040564 3300048912 Bacteria 4216
381 Ga0496109_0064874 3300048912 Bacteria 3342
382 Ga0496109_0095073 3300048912 Bacteria 2758
383 Ga0496110_0026436 3300048913 Bacteria 4967
384 Ga0496110_1003053 3300048913 Bacteria 742
385 Ga0496110_1364290 3300048913 Bacteria 618
386 Ga0496111_0005406 3300048914 Bacteria 8180
387 Ga0496111_0011015 3300048914 Bacteria 6086
388 Ga0496111_0031211 3300048914 Bacteria 3795
389 Ga0496111_0049441 3300048914 Bacteria 3032
390 Ga0496112_0276894 3300048915 Bacteria 1625
391 Ga0496112_0727335 3300048915 Bacteria 919
392 Ga0496113_0020857 3300048916 Bacteria 4614
393 Ga0496113_0032767 3300048916 Unclassified 3778
394 Ga0496114_0061075 3300048917 Bacteria 3152
395 Ga0496115_0068445 3300048918 Bacteria 2874
396 Ga0501036_1230018 3300049572 Bacteria 610
397 Ga0501038_0680959 3300049574 Bacteria 772
398 Ga0501040_0424870 3300049576 Bacteria 955
399 Ga0501042_0447589 3300049578 Bacteria 937
400 Ga0501048_0367004 3300049582 Unclassified 1027
401 Ga0501048_0508806 3300049582 Bacteria 864
402 Ga0501069_1035592 3300049585 Unclassified 502
403 Ga0501071_0040622 3300049587 Bacteria 3329
404 Ga0501071_1000654 3300049587 Bacteria 646
405 Ga0501072_0234074 3300049588 Bacteria 1463
406 Ga0501072_0287557 3300049588 Unclassified 1307
407 Ga0501072_0956276 3300049588 Bacteria 668
408 Ga0501075_0085225 3300049591 Bacteria 2394
409 Ga0501075_0442168 3300049591 Bacteria 992
410 Ga0501076_0561816 3300049592 Unclassified 941
411 Ga0501076_1786690 3300049592 Bacteria 504
412 Ga0501077_0637232 3300049593 Unclassified 685
413 Ga0501202_027121 3300049652 Unclassified 1176
414 Ga0501079_0609221 3300049741 Unclassified 859
415 Ga0501079_1189922 3300049741 Unclassified 600
416 Ga0501079_1441704 3300049741 Unclassified 542
417 Ga0501079_1481792 3300049741 Bacteria 534
418 Ga0501080_0508975 3300049742 Bacteria 1075
419 Ga0501081_0475220 3300049743 Bacteria 930
420 nmdc:mga0k408_695260_c1 3300050493 Unclassified 596
421 nmdc:mga05p37_2188802_c1 3300050507 Bacteria 514
422 nmdc:mga05p37_287617_c1 3300050507 Bacteria 1957
423 nmdc:mga05p37_6606_c2 3300050507 Bacteria 10272
424 nmdc:mga09592_19675_c1 3300050508 Bacteria 5545
425 nmdc:mga09592_253266_c1 3300050508 Archaea 1526
426 nmdc:mga09592_392138_c1 3300050508 Bacteria 1200
427 nmdc:mga0qj67_396503_c1 3300050509 Bacteria 1114
428 nmdc:mga0qj67_460542_c1 3300050509 Bacteria 1024
429 nmdc:mga0qj67_86917_c1 3300050509 Unclassified 2509
430 nmdc:mga06r32_229169_c1 3300050510 Bacteria 1846
431 nmdc:mga08y16_56115_c1 3300050511 Bacteria 4117
432 nmdc:mga08y16_569411_c1 3300050511 Unclassified 1145
433 nmdc:mga08y16_742189_c1 3300050511 Unclassified 978
434 nmdc:mga0n895_1906050_c1 3300050512 Unclassified 553
435 nmdc:mga0a205_499916_c1 3300050515 Bacteria 1073
436 Ga0501084_0260213 3300054114 Unclassified 1465
437 Ga0501084_0441383 3300054114 Unclassified 1100
438 Ga0590077_003848 3300059426 Bacteria 3094
439 Ga0501082_1285271 3300060353 Unclassified 639
440 Ga0530510_0968336 3300061734 Bacteria 651
441 Ga0530510_1593176 3300061734 Unclassified 502
442 Ga0081538_10066247
443 Ga0070683_100005256
444 Ga0070683_100005855
445 Ga0070683_100010814
446 Ga0070683_100071296
447 Ga0070670_100065518
448 Ga0068869_100705248
449 Ga0070666_10221532
450 Ga0068868_100683210
451 Ga0070689_100515928
452 Ga0070687_101398638
453 Ga0070661_100140146
454 Ga0070669_100512773
455 Ga0070675_101464455
456 Ga0070674_101191102
457 Ga0070673_100746996
458 Ga0070688_100945827
459 Ga0070659_100376228
460 Ga0070709_10003375
461 Ga0070714_100047100
462 Ga0070714_100047309
463 Ga0070713_100000665
464 Ga0070710_10052366
465 Ga0070701_10162621
466 Ga0070701_10561800
467 Ga0070711_100018221
468 Ga0070711_100163418
469 Ga0070694_100561694
470 Ga0070678_100087119
471 Ga0070678_100802169
472 Ga0070662_101002974
473 Ga0070681_11580422
474 Ga0068867_100332732
475 Ga0070685_10114432
476 Ga0070685_10157931
477 Ga0070685_10607197
478 Ga0070706_101255781
479 Ga0070707_100605794
480 Ga0070698_100016119
481 Ga0070698_101480871
482 Ga0070679_101643827
483 Ga0070684_100000684
484 Ga0070684_100006952
485 Ga0070684_100187280
486 Ga0070684_100313265
487 Ga0070684_101077013
488 Ga0070684_101430487
489 Ga0070672_101406714
490 Ga0070686_100122454
491 Ga0070696_100742908
492 Ga0070704_100079087
493 Ga0070704_101239117
494 Ga0068855_100195109
495 Ga0070664_100097546
496 Ga0070664_100180858
497 Ga0068857_100001754
498 Ga0068857_100003359
499 Ga0068857_100076479
500 Ga0068857_100107758
501 Ga0068857_100108061
502 Ga0068854_100942503
503 Ga0068854_102220914
504 Ga0068856_100143328
505 Ga0068856_100203393
506 Ga0068856_100225248
507 Ga0070702_100391636
508 Ga0070702_100535859
509 Ga0068852_101647408
510 Ga0068864_100232160
511 Ga0068861_101264093
512 Ga0068870_10116985
513 Ga0068858_100195305
514 Ga0068858_101756698
515 Ga0068862_100498178
516 Ga0081455_10023318
517 Ga0081455_10024712
518 Ga0081455_10047881
519 Ga0081455_10109496
520 Ga0081455_10431318
521 Ga0081538_10024848
522 Ga0081538_10196312
523 Ga0081540_1002004
524 Ga0081539_10002896
525 Ga0070717_10027025
526 Ga0075432_10398385
527 Ga0070715_10006216
528 Ga0070716_100004644
529 Ga0070712_100047759
530 Ga0070712_100089572
531 Ga0075366_10737007
532 Ga0097621_100379079
533 Ga0068871_101682131
534 Ga0075428_100097097
535 Ga0075428_101155120
536 Ga0075428_101925705
537 Ga0075428_102248846
538 Ga0075430_100082694
539 Ga0075430_100113944
540 Ga0075430_100546125
541 Ga0075431_100519282
542 Ga0075433_10531152
543 Ga0075429_100011553
544 Ga0075429_100155439
545 Ga0075429_100380596
546 Ga0068865_100269679
547 Ga0105251_10256829
548 Ga0105240_10576366
549 Ga0111539_10001945
550 Ga0111539_10403705
551 Ga0111539_11000446
552 Ga0111539_11936920
553 Ga0105245_10194198
554 Ga0105245_10234656
555 Ga0105245_10356557
556 Ga0105245_10406768
557 Ga0114129_10133754
558 Ga0114129_10551443
559 Ga0114129_10688605
560 Ga0114129_11844782
561 Ga0105243_10518342
562 Ga0105243_11086472
563 Ga0105243_11918198
564 Ga0105241_11151540
565 Ga0105242_10086709
566 Ga0105248_10502553
567 Ga0105249_10133061
568 Ga0105239_10023125
569 Ga0105239_10435356
570 Ga0105246_10044989
571 Ga0105246_10350152
572 Ga0157374_10089816
573 Ga0157374_11096926
574 Ga0157378_12816257
575 Ga0163162_10622716
576 Ga0157375_11039872
577 Ga0157375_11354039
578 Ga0163163_10380970
579 Ga0163163_11523826
580 Ga0157377_10329000
581 Ga0157376_10444303
582 Ga0157376_12407014
583 Ga0197907_10573683
584 Ga0213871_10196930
585 Ga0224712_10076446
586 Ga0207692_10004525
587 Ga0207642_10391888
588 Ga0207710_10072371
589 Ga0207688_10008351
590 Ga0207680_10775772
591 Ga0207685_10012639
592 Ga0207699_10019938
593 Ga0207643_10044021
594 Ga0207705_11424013
595 Ga0207684_10847749
596 Ga0207654_10435446
597 Ga0207693_10002222
598 Ga0207693_10104327
599 Ga0207663_10015497
600 Ga0207663_10137096
601 Ga0207649_10970840
602 Ga0207646_10185383
603 Ga0207659_11318273
604 Ga0207687_10300227
605 Ga0207687_10425966
606 Ga0207700_10018468
607 Ga0207664_10005597
608 Ga0207664_10021374
609 Ga0207706_10114384
610 Ga0207686_10357936
611 Ga0207686_11461581
612 Ga0207709_10396046
613 Ga0207709_10841523
614 Ga0207709_11496872
615 Ga0207709_11521790
616 Ga0207669_10685611
617 Ga0207669_10746675
618 Ga0207669_11336006
619 Ga0207704_10250847
620 Ga0207704_11153670
621 Ga0207665_10000562
622 Ga0207689_10137348
623 Ga0207689_11634840
624 Ga0207661_10090337
625 Ga0207661_10109319
626 Ga0207661_10115209
627 Ga0207661_10149829
628 Ga0207661_10825666
629 Ga0207661_10900616
630 Ga0207661_11770997
631 Ga0207679_10079839
632 Ga0207667_10120371
633 Ga0207651_10312561
634 Ga0207712_10358510
635 Ga0207677_10727514
636 Ga0207677_11311126
637 Ga0207703_11604797
638 Ga0207678_10301101
639 Ga0207708_10736806
640 Ga0207708_11804272
641 Ga0207702_10174415
642 Ga0207702_10277023
643 Ga0207648_10483381
644 Ga0207674_10000820
645 Ga0207674_10002796
646 Ga0207674_10069097
647 Ga0207674_10180748
648 Ga0207674_10184404
649 Ga0207675_102616939
650 Ga0207683_10575066
651 Ga0207683_11226435
652 Ga0209998_10048489
653 Ga0207428_10176315
654 Ga0265322_10022381
655 Ga0265336_10085783
656 Ga0265338_10009062
657 Ga0265330_10054312
658 Ga0265325_10134025
659 Ga0265329_10026691
660 Ga0265340_10028067
661 Ga0265339_10065169
662 Ga0265331_10100367
663 Ga0265327_10010926
664 Ga0265316_10054408
665 Ga0307408_100068587
666 Ga0265313_10006421
667 Ga0265314_10005226
668 Ga0265342_10034711
669 Ga0307405_10181800
670 Ga0307405_10485279
671 Ga0307413_10125102
672 Ga0307413_10276789
673 Ga0307413_10310975
674 Ga0307410_10020365
675 Ga0307410_10598575
676 Ga0307410_10812671
677 Ga0307406_10010044
678 Ga0307406_10024605
679 Ga0307406_10206313
680 Ga0307406_10334935
681 Ga0307407_10209483
682 Ga0307407_10326091
683 Ga0307407_11429765
684 Ga0307412_10077016
685 Ga0307412_10443856
686 Ga0307409_100072392
687 Ga0307409_100129084
688 Ga0307409_100159691
689 Ga0307416_100003519
690 Ga0307416_100135574
691 Ga0307416_100936820
692 Ga0307411_10207099
693 Ga0307415_100000519
694 Ga0307415_100120445
695 Ga0307415_101142204
696 Ga0373938_0060153
697 Ga0373943_0396670
698 Ga0373946_0200639
699 Ga0373931_0182662
700 Ga0373935_0695447
701 Ga0395899_0003223
702 Ga0395899_0009535
703 Ga0395899_0020484
704 Ga0395899_0059172
705 Ga0395899_0072169
706 Ga0395899_0159597
707 Ga0395899_0390989
708 Ga0395899_0546165
709 Ga0395900_0005079
710 Ga0395900_0014859
711 Ga0395900_0040757
712 Ga0395900_0048907
713 Ga0395900_0101241
714 Ga0395900_0115698
715 Ga0395900_0124464
716 Ga0395900_0163350
717 Ga0395900_0205265
718 Ga0395900_0254607
719 Ga0395900_0265989
720 Ga0395900_0508170
721 Ga0395900_0689883
722 Ga0395898_0002841
723 Ga0395898_0016670
724 Ga0395898_0037623
725 Ga0395898_0050158
726 Ga0395898_0051385
727 Ga0395898_0071383
728 Ga0395898_0195456
729 Ga0395898_0502029
730 Ga0395898_0688387
731 Ga0395905_0007192
732 Ga0395905_0017070
733 Ga0395905_0026329
734 Ga0395905_0061616
735 Ga0395905_0097670
736 Ga0395905_0192343
737 Ga0395905_0324300
738 Ga0395905_0364684
739 Ga0395905_0433040
740 Ga0395905_0514598
741 Ga0395901_0019470
742 Ga0395901_0020607
743 Ga0395901_0039106
744 Ga0395901_0049560
745 Ga0395901_0065824
746 Ga0395901_0107570
747 Ga0395901_0189146
748 Ga0395901_0243609
749 Ga0395901_0357896
750 Ga0395901_0529371
751 Ga0395901_0529514
752 Ga0395901_0533920
753 Ga0395901_1921407
754 Ga0436360_0990681
755 Ga0436362_0610958
756 Ga0439466_0217320
757 Ga0451800_0090452
758 Ga0451800_1268273
759 Ga0451855_1618504
760 Ga0451853_1490333
761 Ga0451853_2903880
762 Ga0439448_0320979
763 Ga0450923_047506
764 Ga0450907_023083
765 Ga0439440_0154839
766 Ga0495603_0068995
767 Ga0495590_0064416
768 Ga0495641_0122388
769 Ga0495582_0003878
770 Ga0495639_0185929
771 Ga0495584_0096334
772 Ga0495584_0181175
773 Ga0495594_0092342
774 Ga0495596_0093275
775 Ga0495596_0372641
776 Ga0495607_0253167
777 Ga0495630_0475270
778 Ga0495637_0339333
779 Ga0495644_0449426
780 Ga0495663_0048072
781 Ga0495665_0113540
782 Ga0495609_0145179
783 Ga0495656_0038253
784 Ga0495656_0123448
785 Ga0495656_0631623
786 Ga0495656_0709252
787 Ga0495668_0141415
788 Ga0495611_0594004
789 Ga0495659_0259538
790 Ga0495661_0595693
791 Ga0495588_0080066
792 Ga0495658_0070285
793 Ga0495669_0067770
794 Ga0495624_0310777
795 Ga0495670_0070977
796 Ga0495671_0158830
797 Ga0495649_0616237
798 Ga0495660_0316771
799 Ga0495581_0033138
800 Ga0495676_0042812
801 Ga0495614_0294616
802 Ga0495615_0230232
803 Ga0495626_0420937
804 Ga0496100_0020270
805 Ga0496100_1587600
806 Ga0496101_0059473
807 Ga0496101_0299154
808 Ga0496102_0015415
809 Ga0496102_0269353
810 Ga0496102_0384441
811 Ga0496103_0007924
812 Ga0496104_1585000
813 Ga0496105_0039095
814 Ga0496106_0026577
815 Ga0496106_0194429
816 Ga0496107_0001749
817 Ga0496108_0016349
818 Ga0496108_0162345
819 Ga0496108_0445581
820 Ga0496108_0909433
821 Ga0496109_0040564
822 Ga0496109_0064874
823 Ga0496109_0095073
824 Ga0496110_0026436
825 Ga0496110_1003053
826 Ga0496110_1364290
827 Ga0496111_0005406
828 Ga0496111_0011015
829 Ga0496111_0031211
830 Ga0496111_0049441
831 Ga0496112_0276894
832 Ga0496112_0727335
833 Ga0496113_0020857
834 Ga0496113_0032767
835 Ga0496114_0061075
836 Ga0496115_0068445
837 Ga0501036_1230018
838 Ga0501038_0680959
839 Ga0501040_0424870
840 Ga0501042_0447589
841 Ga0501048_0367004
842 Ga0501048_0508806
843 Ga0501069_1035592
844 Ga0501071_0040622
845 Ga0501071_1000654
846 Ga0501072_0234074
847 Ga0501072_0287557
848 Ga0501072_0956276
849 Ga0501075_0085225
850 Ga0501075_0442168
851 Ga0501076_0561816
852 Ga0501076_1786690
853 Ga0501077_0637232
854 Ga0501202_027121
855 Ga0501079_0609221
856 Ga0501079_1189922
857 Ga0501079_1441704
858 Ga0501079_1481792
859 Ga0501080_0508975
860 Ga0501081_0475220
861 nmdc:mga0k408_695260_c1
862 nmdc:mga05p37_2188802_c1
863 nmdc:mga05p37_287617_c1
864 nmdc:mga05p37_6606_c2
865 nmdc:mga09592_19675_c1
866 nmdc:mga09592_253266_c1
867 nmdc:mga09592_392138_c1
868 nmdc:mga0qj67_396503_c1
869 nmdc:mga0qj67_460542_c1
870 nmdc:mga0qj67_86917_c1
871 nmdc:mga06r32_229169_c1
872 nmdc:mga08y16_56115_c1
873 nmdc:mga08y16_569411_c1
874 nmdc:mga08y16_742189_c1
875 nmdc:mga0n895_1906050_c1
876 nmdc:mga0a205_499916_c1
877 Ga0501084_0260213
878 Ga0501084_0441383
879 Ga0590077_003848
880 Ga0501082_1285271
881 Ga0530510_0968336
882 Ga0530510_1593176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2otd-assembly4.cif.gz_D the crystal structure of the glycerophosphodiester phosphodiesterase from shigella flexneri 2a 0.7813 16 65
7c1x-assembly1.cif.gz_B unliganded structure of pseudouridine kinase (puki) from arabidopsis thaliana 0.7733 24 59
2h6r-assembly2.cif.gz_F crystal structure of triosephosphate isomerase (tim) from methanocaldococcus jannaschii 0.7664 25 64
3rv3-assembly1.cif.gz_B crystal structure of e.coli biotin carboxylase in complex with two adp and one mg ion 0.7584 27 44
8szz-assembly1.cif.gz_J cryoem structure of computationally designed nanocage o32-zl4 0.7464 13 51
ID Description Score Start End Superfamily
af_Q58646_9_173_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8302 14 61 3.20.20.70
4utwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7933 13 59 3.20.20.70
af_P71847_8_353_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7929 17 61 3.20.20.70
af_Q0J4W4_4_271_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7921 18 61 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7756 13 51 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A538DEM1-F1-model_v4 Uncharacterized protein 0.9656 1 77
AF-A0A7V9M8X5-F1-model_v4 Uncharacterized protein 0.9605 1 77
AF-A0A538DEM1-F1-model_v4 Uncharacterized protein 0.9534 1 77
AF-A0A7V9M8X5-F1-model_v4 Uncharacterized protein 0.9485 1 77
AF-A0A7W0JKF7-F1-model_v4 Uncharacterized protein 0.9298 1 77

Map