F444819

General Info

Members Datasets Scaffolds Average Seq Length
442 254 884 232

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100063926|Ga0070670_1000639262
Length 261
Sequence MQNVHYGNPLPALPVTVTRGYLGCIKNKAMITIRKSEERGHANHGWLDSHHTFSFADYHDPQHMHFRSLRVINEDHVAAGAGFPTHPHRDMEIVTYVVSGAVAHRDSTGGQGVIKPGQLQHMSAGTGVQHSEFNASKTEPLHLLQIWILPEKNGLTPSYSETALNGAPQSEPLRLVGSREGGDGALKIKQDVRLFVGKMKADETVEYTLAPDRHAWVQLISGALRVNDRDLRSGDAAAVSGESLLKLSATEPSHFLLFDLA

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
176 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
184 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
214 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
215 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
216 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
231 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
232 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
233 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
234 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
235 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
236 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
237 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
238 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
239 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
240 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
241 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
242 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
254 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.23
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 2.94
Rhizosphere 95.93
Stem 0
Stem Tuber 0
Unclassified 13.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100063926 3300005331 Bacteria 3158
2 JGI24752J21851_1005821 3300001976 Bacteria 1610
3 JGI24743J22301_10002013 3300001991 Bacteria 2976
4 JGI24749J21850_1007184 3300002076 Bacteria 1549
5 JGI24033J26618_1021470 3300002155 Bacteria 829
6 JGI24034J26672_10006442 3300002239 Bacteria 1694
7 JGI24751J29686_10004118 3300002459 Bacteria 2947
8 Ga0065712_10011859 3300005290 Bacteria 2331
9 Ga0065712_10309751 3300005290 Bacteria 846
10 Ga0065715_10029689 3300005293 Bacteria 1966
11 Ga0065715_10155239 3300005293 Bacteria 1684
12 Ga0065707_10109343 3300005295 Bacteria 2471
13 Ga0065707_10255828 3300005295 Bacteria 1093
14 Ga0070658_10002059 3300005327 Bacteria 16868
15 Ga0070658_10082597 3300005327 Bacteria 2640
16 Ga0070676_10042070 3300005328 Bacteria 2651
17 Ga0070683_100022838 3300005329 Bacteria 5595
18 Ga0070670_100146846 3300005331 Bacteria 2040
19 Ga0070677_10027932 3300005333 Bacteria 2128
20 Ga0070666_10075620 3300005335 Bacteria 2296
21 Ga0070682_100000259 3300005337 Bacteria 38232
22 Ga0070682_100090774 3300005337 Bacteria 1998
23 Ga0068868_100322891 3300005338 Bacteria 1315
24 Ga0070660_100003182 3300005339 Bacteria 11279
25 Ga0070689_100011970 3300005340 Bacteria 6232
26 Ga0070689_100028665 3300005340 Bacteria 4210
27 Ga0070689_100083854 3300005340 Bacteria 2504
28 Ga0070687_100040611 3300005343 Bacteria 2345
29 Ga0070661_100109230 3300005344 Bacteria 2064
30 Ga0070668_100085084 3300005347 Bacteria 2485
31 Ga0070675_100060323 3300005354 Bacteria 3132
32 Ga0070675_100114964 3300005354 Bacteria 2280
33 Ga0070675_100150335 3300005354 Bacteria 1996
34 Ga0070675_100253014 3300005354 Bacteria 1542
35 Ga0070671_100147038 3300005355 Bacteria 1989
36 Ga0070674_100018921 3300005356 Bacteria 4365
37 Ga0070674_100054004 3300005356 Bacteria 2777
38 Ga0070673_100041641 3300005364 Bacteria 3535
39 Ga0070673_100195374 3300005364 Unclassified 1740
40 Ga0070688_100024263 3300005365 Bacteria 3576
41 Ga0070688_100059170 3300005365 Bacteria 2415
42 Ga0070659_100008280 3300005366 Bacteria 7590
43 Ga0070667_100406042 3300005367 Bacteria 1240
44 Ga0070667_100576585 3300005367 Bacteria 1035
45 Ga0070711_100028151 3300005439 Bacteria 3695
46 Ga0070700_100204258 3300005441 Bacteria 1390
47 Ga0070663_100034128 3300005455 Bacteria 3521
48 Ga0070663_100041039 3300005455 Bacteria 3243
49 Ga0070678_100072077 3300005456 Bacteria 2588
50 Ga0070662_100077211 3300005457 Bacteria 2471
51 Ga0068867_100002152 3300005459 Bacteria 13818
52 Ga0068867_100031203 3300005459 Unclassified 3846
53 Ga0070685_10033364 3300005466 Bacteria 2891
54 Ga0070685_10046668 3300005466 Bacteria 2488
55 Ga0070685_10078100 3300005466 Bacteria 1978
56 Ga0070679_100226887 3300005530 Bacteria 1828
57 Ga0070684_100154881 3300005535 Unclassified 2078
58 Ga0070684_100175345 3300005535 Bacteria 1948
59 Ga0070697_100083399 3300005536 Bacteria 2636
60 Ga0068853_100023624 3300005539 Bacteria 5148
61 Ga0068853_100024018 3300005539 Bacteria 5109
62 Ga0068853_100570921 3300005539 Unclassified 1073
63 Ga0070672_100086172 3300005543 Bacteria 2525
64 Ga0070672_100233471 3300005543 Bacteria 1546
65 Ga0070686_100000992 3300005544 Bacteria 16380
66 Ga0070665_100297495 3300005548 Bacteria 1616
67 Ga0068855_100054704 3300005563 Bacteria 4690
68 Ga0070664_100001999 3300005564 Bacteria 16351
69 Ga0068857_100006903 3300005577 Bacteria 9775
70 Ga0068857_100456457 3300005577 Bacteria 1195
71 Ga0068854_100100219 3300005578 Bacteria 2170
72 Ga0068854_100119378 3300005578 Bacteria 1999
73 Ga0068856_100009769 3300005614 Bacteria 9323
74 Ga0070702_100027230 3300005615 Bacteria 3082
75 Ga0068852_100048148 3300005616 Bacteria 3641
76 Ga0068852_100099261 3300005616 Unclassified 2624
77 Ga0068852_100149744 3300005616 Bacteria 2169
78 Ga0068852_100154655 3300005616 Bacteria 2135
79 Ga0068859_100006881 3300005617 Bacteria 11542
80 Ga0068859_100017276 3300005617 Bacteria 7245
81 Ga0068859_100035241 3300005617 Bacteria 5021
82 Ga0068859_100056951 3300005617 Bacteria 3937
83 Ga0068859_100093334 3300005617 Bacteria 3061
84 Ga0068859_100195645 3300005617 Unclassified 2106
85 Ga0068866_10044719 3300005718 Bacteria 2217
86 Ga0068861_100039199 3300005719 Bacteria 3534
87 Ga0068861_100507480 3300005719 Bacteria 1091
88 Ga0068851_10003001 3300005834 Bacteria 7453
89 Ga0068851_10029059 3300005834 Bacteria 2734
90 Ga0068851_10129039 3300005834 Bacteria 1366
91 Ga0068870_10358148 3300005840 Bacteria 938
92 Ga0068863_100047448 3300005841 Bacteria 4073
93 Ga0068863_100166109 3300005841 Bacteria 2116
94 Ga0068863_100257150 3300005841 Bacteria 1688
95 Ga0068863_100702306 3300005841 Unclassified 1005
96 Ga0068858_100042731 3300005842 Bacteria 4202
97 Ga0068858_100047201 3300005842 Bacteria 3993
98 Ga0068858_100155367 3300005842 Bacteria 2152
99 Ga0068860_100173171 3300005843 Bacteria 2085
100 Ga0068860_100351902 3300005843 Bacteria 1450
101 Ga0068860_100829938 3300005843 Unclassified 938
102 Ga0068862_100021628 3300005844 Bacteria 5377
103 Ga0068862_100229891 3300005844 Bacteria 1682
104 Ga0068862_100304808 3300005844 Unclassified 1466
105 Ga0097621_100047846 3300006237 Bacteria 3467
106 Ga0097621_100161094 3300006237 Bacteria 1929
107 Ga0097621_100190528 3300006237 Bacteria 1776
108 Ga0097621_100294457 3300006237 Bacteria 1432
109 Ga0097621_100465926 3300006237 Bacteria 1140
110 Ga0068871_100158641 3300006358 Unclassified 1933
111 Ga0068871_100241507 3300006358 Bacteria 1570
112 Ga0068871_100620855 3300006358 Bacteria 984
113 Ga0075428_100045004 3300006844 Bacteria 4850
114 Ga0075433_10001747 3300006852 Bacteria 16232
115 Ga0075433_10011323 3300006852 Bacteria 7178
116 Ga0075434_100040795 3300006871 Unclassified 4597
117 Ga0075429_100425247 3300006880 Bacteria 1163
118 Ga0075429_100591629 3300006880 Bacteria 972
119 Ga0068865_100051141 3300006881 Bacteria 2858
120 Ga0097620_100006881 3300006931 Bacteria 11542
121 Ga0097620_100017274 3300006931 Bacteria 7245
122 Ga0097620_100035243 3300006931 Bacteria 5021
123 Ga0097620_100056950 3300006931 Bacteria 3937
124 Ga0097620_100093342 3300006931 Bacteria 3061
125 Ga0097620_100195645 3300006931 Unclassified 2106
126 Ga0097620_100676510 3300006931 Bacteria 1123
127 Ga0111539_10210235 3300009094 Unclassified 2267
128 Ga0111539_10370070 3300009094 Bacteria 1668
129 Ga0105245_10017135 3300009098 Bacteria 6321
130 Ga0105247_10035836 3300009101 Bacteria 3025
131 Ga0105247_10184538 3300009101 Unclassified 1394
132 Ga0114129_10000412 3300009147 Bacteria 50533
133 Ga0114129_10428644 3300009147 Bacteria 1738
134 Ga0114129_10724297 3300009147 Bacteria 1276
135 Ga0105243_10441412 3300009148 Bacteria 1219
136 Ga0105241_10013770 3300009174 Bacteria 5924
137 Ga0105242_10030245 3300009176 Bacteria 4324
138 Ga0105242_10045412 3300009176 Bacteria 3561
139 Ga0105248_10095900 3300009177 Bacteria 3340
140 Ga0105248_10272443 3300009177 Bacteria 1906
141 Ga0105248_10407604 3300009177 Unclassified 1531
142 Ga0105248_10774438 3300009177 Bacteria 1083
143 Ga0105237_10199933 3300009545 Unclassified 1998
144 Ga0105238_10316642 3300009551 Bacteria 1546
145 Ga0105249_10007916 3300009553 Bacteria 9262
146 Ga0105249_10033359 3300009553 Bacteria 4661
147 Ga0105249_10138386 3300009553 Bacteria 2332
148 Ga0105249_10172524 3300009553 Bacteria 2098
149 Ga0105239_10033203 3300010375 Bacteria 5668
150 Ga0105246_10029138 3300011119 Bacteria 3633
151 Ga0105246_10120224 3300011119 Bacteria 1945
152 Ga0157373_10012901 3300013100 Bacteria 6135
153 Ga0157371_10115390 3300013102 Bacteria 1907
154 Ga0157370_10080492 3300013104 Bacteria 3066
155 Ga0157370_10224441 3300013104 Bacteria 1739
156 Ga0157369_10010252 3300013105 Bacteria 10694
157 Ga0157369_10070850 3300013105 Bacteria 3744
158 Ga0157374_10020950 3300013296 Bacteria 5809
159 Ga0157374_10173250 3300013296 Bacteria 2106
160 Ga0157374_10270243 3300013296 Unclassified 1676
161 Ga0157378_10060812 3300013297 Bacteria 3370
162 Ga0157378_10095523 3300013297 Bacteria 2707
163 Ga0157378_10095787 3300013297 Bacteria 2704
164 Ga0157378_10655161 3300013297 Bacteria 1066
165 Ga0157378_10655953 3300013297 Unclassified 1065
166 Ga0163162_10011826 3300013306 Bacteria 8514
167 Ga0163162_10064309 3300013306 Bacteria 3713
168 Ga0163162_10119813 3300013306 Bacteria 2735
169 Ga0163162_10156291 3300013306 Bacteria 2401
170 Ga0163162_10253000 3300013306 Bacteria 1893
171 Ga0163162_10413333 3300013306 Unclassified 1481
172 Ga0157372_10170487 3300013307 Bacteria 2518
173 Ga0157375_10059741 3300013308 Bacteria 3778
174 Ga0157375_10097746 3300013308 Bacteria 3011
175 Ga0157375_10244876 3300013308 Bacteria 1953
176 Ga0157375_10288152 3300013308 Bacteria 1805
177 Ga0157375_10483454 3300013308 Bacteria 1403
178 Ga0157375_10942465 3300013308 Bacteria 1005
179 Ga0163163_10002225 3300014325 Bacteria 16329
180 Ga0163163_10004445 3300014325 Bacteria 11957
181 Ga0163163_10761588 3300014325 Unclassified 1031
182 Ga0157380_10016836 3300014326 Bacteria 5398
183 Ga0157380_10025950 3300014326 Bacteria 4447
184 Ga0157380_10197678 3300014326 Bacteria 1781
185 Ga0157377_10001360 3300014745 Bacteria 10503
186 Ga0157377_10084952 3300014745 Bacteria 1857
187 Ga0157379_10050176 3300014968 Bacteria 3724
188 Ga0157376_10120755 3300014969 Bacteria 2322
189 Ga0157376_10299061 3300014969 Bacteria 1523
190 Ga0157376_10299719 3300014969 Unclassified 1521
191 Ga0157376_10840762 3300014969 Bacteria 933
192 Ga0163161_10011379 3300017792 Bacteria 6169
193 Ga0163161_10086398 3300017792 Unclassified 2315
194 Ga0207697_10017686 3300025315 Bacteria 2929
195 Ga0207656_10015418 3300025321 Bacteria 2957
196 Ga0207656_10091359 3300025321 Bacteria 1382
197 Ga0207682_10018417 3300025893 Bacteria 2730
198 Ga0207642_10044322 3300025899 Bacteria 1968
199 Ga0207688_10038391 3300025901 Bacteria 2657
200 Ga0207680_10015819 3300025903 Bacteria 3947
201 Ga0207647_10000781 3300025904 Bacteria 24778
202 Ga0207647_10198775 3300025904 Unclassified 1160
203 Ga0207645_10002790 3300025907 Bacteria 13600
204 Ga0207643_10000928 3300025908 Bacteria 17570
205 Ga0207643_10276790 3300025908 Bacteria 1040
206 Ga0207705_10001059 3300025909 Bacteria 22356
207 Ga0207705_10035664 3300025909 Bacteria 3558
208 Ga0207654_10038579 3300025911 Bacteria 2681
209 Ga0207663_10136874 3300025916 Bacteria 1701
210 Ga0207662_10001345 3300025918 Bacteria 11863
211 Ga0207657_10002968 3300025919 Bacteria 18190
212 Ga0207649_10000349 3300025920 Bacteria 34894
213 Ga0207652_10701279 3300025921 Bacteria 903
214 Ga0207650_10000104 3300025925 Bacteria 111268
215 Ga0207650_10015231 3300025925 Bacteria 5351
216 Ga0207650_10028875 3300025925 Bacteria 3982
217 Ga0207659_10021296 3300025926 Bacteria 4301
218 Ga0207687_10086788 3300025927 Bacteria 2273
219 Ga0207644_10248677 3300025931 Bacteria 1418
220 Ga0207706_10003401 3300025933 Bacteria 15198
221 Ga0207706_10225101 3300025933 Bacteria 1642
222 Ga0207686_10042230 3300025934 Bacteria 2786
223 Ga0207686_10143446 3300025934 Unclassified 1654
224 Ga0207709_10351600 3300025935 Bacteria 1112
225 Ga0207670_10030672 3300025936 Bacteria 3436
226 Ga0207670_10045520 3300025936 Bacteria 2909
227 Ga0207670_10128688 3300025936 Bacteria 1851
228 Ga0207704_10134330 3300025938 Bacteria 1719
229 Ga0207704_10796486 3300025938 Bacteria 789
230 Ga0207691_10000280 3300025940 Bacteria 50497
231 Ga0207691_10442865 3300025940 Unclassified 1106
232 Ga0207711_10004306 3300025941 Bacteria 12162
233 Ga0207711_10007898 3300025941 Bacteria 8899
234 Ga0207711_10084084 3300025941 Bacteria 2785
235 Ga0207711_10213198 3300025941 Bacteria 1764
236 Ga0207711_10244363 3300025941 Bacteria 1646
237 Ga0207711_10594477 3300025941 Unclassified 1032
238 Ga0207689_10004892 3300025942 Bacteria 12080
239 Ga0207689_10007108 3300025942 Bacteria 9841
240 Ga0207689_10552227 3300025942 Unclassified 967
241 Ga0207661_10000869 3300025944 Bacteria 19833
242 Ga0207661_10231388 3300025944 Bacteria 1637
243 Ga0207679_10000089 3300025945 Bacteria 79512
244 Ga0207679_10014383 3300025945 Bacteria 5202
245 Ga0207679_10242727 3300025945 Bacteria 1527
246 Ga0207679_10634353 3300025945 Bacteria 965
247 Ga0207667_10211759 3300025949 Bacteria 1987
248 Ga0207651_10102877 3300025960 Bacteria 2124
249 Ga0207651_10560842 3300025960 Unclassified 994
250 Ga0207712_10007815 3300025961 Bacteria 6759
251 Ga0207712_10116210 3300025961 Bacteria 2015
252 Ga0207712_10184945 3300025961 Bacteria 1640
253 Ga0207712_10352024 3300025961 Bacteria 1225
254 Ga0207668_10115333 3300025972 Bacteria 2023
255 Ga0207640_10145571 3300025981 Bacteria 1733
256 Ga0207640_10791519 3300025981 Bacteria 821
257 Ga0207658_10028325 3300025986 Bacteria 3944
258 Ga0207658_10147389 3300025986 Bacteria 1913
259 Ga0207677_10152629 3300026023 Unclassified 1784
260 Ga0207703_10053682 3300026035 Bacteria 3276
261 Ga0207703_10196282 3300026035 Unclassified 1791
262 Ga0207703_10414290 3300026035 Bacteria 1252
263 Ga0207703_10947395 3300026035 Unclassified 825
264 Ga0207678_10001258 3300026067 Bacteria 23384
265 Ga0207678_10054381 3300026067 Bacteria 3448
266 Ga0207702_10252374 3300026078 Bacteria 1657
267 Ga0207641_10000020 3300026088 Bacteria 286415
268 Ga0207641_10009246 3300026088 Bacteria 8126
269 Ga0207641_10035234 3300026088 Bacteria 4168
270 Ga0207641_10211630 3300026088 Bacteria 1793
271 Ga0207641_10622180 3300026088 Bacteria 1059
272 Ga0207648_10003740 3300026089 Bacteria 15909
273 Ga0207648_10042198 3300026089 Unclassified 4005
274 Ga0207648_10300725 3300026089 Bacteria 1439
275 Ga0207676_10000108 3300026095 Bacteria 74129
276 Ga0207674_10000512 3300026116 Bacteria 50807
277 Ga0207674_10864538 3300026116 Unclassified 872
278 Ga0207675_100009751 3300026118 Bacteria 8991
279 Ga0207675_100131277 3300026118 Bacteria 2376
280 Ga0207675_100203208 3300026118 Bacteria 1903
281 Ga0207683_10000338 3300026121 Bacteria 42662
282 Ga0207683_10591728 3300026121 Unclassified 1027
283 Ga0207698_10397147 3300026142 Bacteria 1317
284 Ga0268266_10116737 3300028379 Bacteria 2371
285 Ga0268265_10007698 3300028380 Bacteria 7267
286 Ga0268265_10222416 3300028380 Bacteria 1653
287 Ga0268265_10680087 3300028380 Unclassified 992
288 Ga0268265_10845936 3300028380 Bacteria 895
289 Ga0268265_10883062 3300028380 Unclassified 877
290 Ga0268264_10052251 3300028381 Bacteria 3407
291 Ga0268264_10089212 3300028381 Bacteria 2655
292 Ga0268264_10258133 3300028381 Bacteria 1622
293 Ga0265338_10003174 3300028800 Bacteria 23452
294 Ga0265338_10066828 3300028800 Unclassified 3109
295 Ga0265338_10110702 3300028800 Bacteria 2213
296 Ga0265760_10000015 3300031090 Bacteria 91316
297 Ga0265340_10002562 3300031247 Bacteria 10323
298 Ga0265327_10000013 3300031251 Bacteria 519549
299 Ga0307408_100114186 3300031548 Bacteria 2080
300 Ga0307405_10088168 3300031731 Bacteria 2047
301 Ga0307413_10000712 3300031824 Bacteria 11408
302 Ga0307413_10001211 3300031824 Bacteria 9553
303 Ga0307413_10067887 3300031824 Bacteria 2231
304 Ga0307410_10019830 3300031852 Bacteria 4099
305 Ga0307410_10058235 3300031852 Bacteria 2633
306 Ga0307410_10069009 3300031852 Bacteria 2444
307 Ga0307406_10009639 3300031901 Bacteria 5427
308 Ga0307406_10416824 3300031901 Unclassified 1069
309 Ga0307407_10001669 3300031903 Bacteria 8215
310 Ga0307412_10144368 3300031911 Unclassified 1747
311 Ga0307412_10238612 3300031911 Bacteria 1405
312 Ga0307409_100009700 3300031995 Bacteria 5935
313 Ga0307409_100456878 3300031995 Bacteria 1234
314 Ga0307416_100014830 3300032002 Bacteria 5358
315 Ga0307416_100045795 3300032002 Bacteria 3447
316 Ga0307416_100084335 3300032002 Bacteria 2700
317 Ga0307416_100317963 3300032002 Unclassified 1557
318 Ga0307414_10009961 3300032004 Bacteria 5486
319 Ga0307411_10003945 3300032005 Bacteria 7004
320 Ga0307411_10010845 3300032005 Bacteria 4882
321 Ga0307411_10189878 3300032005 Bacteria 1568
322 Ga0307415_100005142 3300032126 Bacteria 6900
323 Ga0307510_10023391 3300033180 Bacteria 7163
324 Ga0373934_0000512 3300035086 Bacteria 13590
325 Ga0373934_0057157 3300035086 Bacteria 1552
326 Ga0373923_0053598 3300035111 Bacteria 1696
327 Ga0373953_0062454 3300035117 Bacteria 1525
328 Ga0373954_0000680 3300035118 Bacteria 13008
329 Ga0373954_0032322 3300035118 Bacteria 2418
330 Ga0373956_0127247 3300035119 Bacteria 1191
331 Ga0373955_0015441 3300035172 Bacteria 3740
332 Ga0373935_0323157 3300035692 Bacteria 1095
333 Ga0373935_0430545 3300035692 Bacteria 951
334 Ga0373927_0001529 3300035695 Bacteria 17400
335 Ga0373933_0030550 3300035724 Bacteria 3120
336 Ga0373933_0221741 3300035724 Bacteria 1213
337 Ga0373933_0239774 3300035724 Bacteria 1166
338 Ga0373937_0004591 3300036401 Bacteria 11717
339 Ga0373937_0004921 3300036401 Bacteria 11354
340 Ga0373937_0015566 3300036401 Bacteria 6730
341 Ga0373937_0016933 3300036401 Bacteria 6481
342 Ga0373937_0054806 3300036401 Bacteria 3659
343 Ga0373937_0120372 3300036401 Bacteria 2446
344 Ga0373925_0001034 3300037068 Bacteria 25228
345 Ga0395905_0065818 3300037471 Bacteria 3394
346 Ga0395905_0481013 3300037471 Bacteria 1141
347 Ga0400490_00558 3300038726 Bacteria 2365
348 Ga0451849_0773393 3300041505 Unclassified 925
349 Ga0453684_0562985 3300044712 Bacteria 1254
350 Ga0451576_0115076 3300045051 Bacteria 2800
351 Ga0495592_0003617 3300046454 Bacteria 11124
352 Ga0495592_0071752 3300046454 Bacteria 2520
353 Ga0495629_0166025 3300046459 Unclassified 1533
354 Ga0495651_0131271 3300046462 Bacteria 1828
355 Ga0495662_0032394 3300046476 Bacteria 2525
356 Ga0495662_0055219 3300046476 Bacteria 1919
357 Ga0495584_0017652 3300046491 Bacteria 3630
358 Ga0495607_0001801 3300046501 Bacteria 18308
359 Ga0495583_0020735 3300046506 Bacteria 3396
360 Ga0495616_0003174 3300046513 Bacteria 10609
361 Ga0495628_0057714 3300046516 Bacteria 3054
362 Ga0495628_0117531 3300046516 Bacteria 2042
363 Ga0495628_0265129 3300046516 Bacteria 1279
364 Ga0495642_0011865 3300046528 Bacteria 3357
365 Ga0495586_0044210 3300046535 Bacteria 2399
366 Ga0495587_0210310 3300046536 Bacteria 1099
367 Ga0495598_0120815 3300046537 Unclassified 888
368 Ga0495609_0000202 3300046538 Bacteria 59327
369 Ga0495645_0002705 3300046543 Bacteria 12026
370 Ga0495667_0117153 3300046559 Bacteria 1720
371 Ga0495668_0000114 3300046616 Bacteria 127503
372 Ga0495668_0064850 3300046616 Bacteria 2010
373 Ga0495634_0013371 3300046642 Bacteria 5931
374 Ga0495634_0114027 3300046642 Bacteria 1736
375 Ga0495625_0033412 3300046660 Bacteria 3804
376 Ga0495659_0004604 3300046664 Bacteria 4341
377 Ga0495657_0020478 3300046675 Bacteria 4753
378 Ga0495599_0134652 3300046678 Bacteria 1534
379 Ga0495647_0102587 3300046681 Unclassified 1186
380 Ga0495669_0002096 3300046684 Bacteria 8170
381 Ga0495613_0095689 3300046689 Bacteria 2148
382 Ga0495613_0118193 3300046689 Bacteria 1905
383 Ga0495613_0247501 3300046689 Bacteria 1245
384 Ga0495624_0426452 3300046690 Bacteria 795
385 Ga0495649_0018581 3300046694 Bacteria 3909
386 Ga0495600_0156296 3300046809 Bacteria 1475
387 Ga0495660_0076808 3300046810 Bacteria 1759
388 Ga0495604_0105803 3300047317 Bacteria 2059
389 Ga0495636_0073101 3300047318 Bacteria 1466
390 Ga0495674_0159296 3300047319 Unclassified 1889
391 Ga0495680_0029014 3300047322 Bacteria 4534
392 Ga0495675_0096921 3300047444 Unclassified 1849
393 Ga0495677_0003747 3300047445 Bacteria 5880
394 Ga0495679_026220 3300047446 Bacteria 1938
395 Ga0495685_012804 3300047447 Bacteria 2841
396 Ga0495681_0017667 3300047470 Bacteria 3952
397 Ga0495684_0010543 3300047471 Bacteria 7143
398 Ga0495684_0129701 3300047471 Unclassified 1895
399 Ga0495686_0001083 3300047472 Bacteria 32352
400 Ga0496100_0391061 3300048903 Bacteria 1057
401 Ga0496104_0161919 3300048907 Bacteria 2146
402 Ga0496104_0248152 3300048907 Unclassified 1693
403 Ga0496105_0225907 3300048908 Unclassified 1523
404 Ga0496106_0045176 3300048909 Bacteria 3309
405 Ga0496108_0005246 3300048911 Bacteria 10466
406 Ga0496109_0000018 3300048912 Bacteria 191977
407 Ga0496110_0001746 3300048913 Bacteria 16024
408 Ga0496110_0376458 3300048913 Bacteria 1294
409 Ga0496112_0001173 3300048915 Bacteria 19637
410 Ga0496113_0001440 3300048916 Bacteria 13218
411 Ga0496114_0211423 3300048917 Unclassified 1701
412 Ga0496115_0155030 3300048918 Bacteria 1892
413 Ga0501202_030146 3300049652 Unclassified 1128
414 Ga0501209_041646 3300049656 Unclassified 1217
415 Ga0501224_023630 3300049664 Unclassified 918
416 Ga0501233_018203 3300049668 Unclassified 1475
417 Ga0501235_053433 3300049669 Bacteria 939
418 Ga0501249_013745 3300049679 Bacteria 1722
419 Ga0501257_010337 3300049686 Bacteria 2117
420 Ga0501259_021874 3300049688 Unclassified 1145
421 Ga0501229_005633 3300049706 Bacteria 1540
422 Ga0501263_030314 3300049760 Unclassified 762
423 Ga0501268_000270 3300049765 Bacteria 5272
424 Ga0501272_012139 3300049769 Unclassified 976
425 Ga0501273_000390 3300049770 Bacteria 3504
426 nmdc:mga05p37_11896_c1 3300050507 Bacteria 10378
427 nmdc:mga09592_401874_c1 3300050508 Bacteria 1184
428 nmdc:mga09592_522434_c1 3300050508 Bacteria 1021
429 nmdc:mga0qj67_197567_c1 3300050509 Bacteria 1634
430 nmdc:mga06r32_104985_c1 3300050510 Bacteria 2775
431 nmdc:mga08y16_218350_c1 3300050511 Unclassified 1974
432 nmdc:mga08y16_435229_c1 3300050511 Bacteria 1339
433 nmdc:mga0n895_384549_c1 3300050512 Bacteria 1420
434 nmdc:mga0n895_40986_c1 3300050512 Unclassified 4500
435 nmdc:mga0a205_16114_c1 3300050515 Bacteria 6998
436 nmdc:mga0a205_26971_c1 3300050515 Bacteria 5485
437 nmdc:mga0a205_40009_c1 3300050515 Bacteria 4513
438 Ga0495601_0022697 3300053077 Bacteria 3856
439 Ga0495595_0209703 3300053084 Bacteria 971
440 Ga0495619_0276614 3300053085 Bacteria 1163
441 Ga0500568_0002062 3300053139 Bacteria 12180
442 3003234660 3003233435 Bacteria 4458031
443 Ga0070670_100063926
444 JGI24752J21851_1005821
445 JGI24743J22301_10002013
446 JGI24749J21850_1007184
447 JGI24033J26618_1021470
448 JGI24034J26672_10006442
449 JGI24751J29686_10004118
450 Ga0065712_10011859
451 Ga0065712_10309751
452 Ga0065715_10029689
453 Ga0065715_10155239
454 Ga0065707_10109343
455 Ga0065707_10255828
456 Ga0070658_10002059
457 Ga0070658_10082597
458 Ga0070676_10042070
459 Ga0070683_100022838
460 Ga0070670_100146846
461 Ga0070677_10027932
462 Ga0070666_10075620
463 Ga0070682_100000259
464 Ga0070682_100090774
465 Ga0068868_100322891
466 Ga0070660_100003182
467 Ga0070689_100011970
468 Ga0070689_100028665
469 Ga0070689_100083854
470 Ga0070687_100040611
471 Ga0070661_100109230
472 Ga0070668_100085084
473 Ga0070675_100060323
474 Ga0070675_100114964
475 Ga0070675_100150335
476 Ga0070675_100253014
477 Ga0070671_100147038
478 Ga0070674_100018921
479 Ga0070674_100054004
480 Ga0070673_100041641
481 Ga0070673_100195374
482 Ga0070688_100024263
483 Ga0070688_100059170
484 Ga0070659_100008280
485 Ga0070667_100406042
486 Ga0070667_100576585
487 Ga0070711_100028151
488 Ga0070700_100204258
489 Ga0070663_100034128
490 Ga0070663_100041039
491 Ga0070678_100072077
492 Ga0070662_100077211
493 Ga0068867_100002152
494 Ga0068867_100031203
495 Ga0070685_10033364
496 Ga0070685_10046668
497 Ga0070685_10078100
498 Ga0070679_100226887
499 Ga0070684_100154881
500 Ga0070684_100175345
501 Ga0070697_100083399
502 Ga0068853_100023624
503 Ga0068853_100024018
504 Ga0068853_100570921
505 Ga0070672_100086172
506 Ga0070672_100233471
507 Ga0070686_100000992
508 Ga0070665_100297495
509 Ga0068855_100054704
510 Ga0070664_100001999
511 Ga0068857_100006903
512 Ga0068857_100456457
513 Ga0068854_100100219
514 Ga0068854_100119378
515 Ga0068856_100009769
516 Ga0070702_100027230
517 Ga0068852_100048148
518 Ga0068852_100099261
519 Ga0068852_100149744
520 Ga0068852_100154655
521 Ga0068859_100006881
522 Ga0068859_100017276
523 Ga0068859_100035241
524 Ga0068859_100056951
525 Ga0068859_100093334
526 Ga0068859_100195645
527 Ga0068866_10044719
528 Ga0068861_100039199
529 Ga0068861_100507480
530 Ga0068851_10003001
531 Ga0068851_10029059
532 Ga0068851_10129039
533 Ga0068870_10358148
534 Ga0068863_100047448
535 Ga0068863_100166109
536 Ga0068863_100257150
537 Ga0068863_100702306
538 Ga0068858_100042731
539 Ga0068858_100047201
540 Ga0068858_100155367
541 Ga0068860_100173171
542 Ga0068860_100351902
543 Ga0068860_100829938
544 Ga0068862_100021628
545 Ga0068862_100229891
546 Ga0068862_100304808
547 Ga0097621_100047846
548 Ga0097621_100161094
549 Ga0097621_100190528
550 Ga0097621_100294457
551 Ga0097621_100465926
552 Ga0068871_100158641
553 Ga0068871_100241507
554 Ga0068871_100620855
555 Ga0075428_100045004
556 Ga0075433_10001747
557 Ga0075433_10011323
558 Ga0075434_100040795
559 Ga0075429_100425247
560 Ga0075429_100591629
561 Ga0068865_100051141
562 Ga0097620_100006881
563 Ga0097620_100017274
564 Ga0097620_100035243
565 Ga0097620_100056950
566 Ga0097620_100093342
567 Ga0097620_100195645
568 Ga0097620_100676510
569 Ga0111539_10210235
570 Ga0111539_10370070
571 Ga0105245_10017135
572 Ga0105247_10035836
573 Ga0105247_10184538
574 Ga0114129_10000412
575 Ga0114129_10428644
576 Ga0114129_10724297
577 Ga0105243_10441412
578 Ga0105241_10013770
579 Ga0105242_10030245
580 Ga0105242_10045412
581 Ga0105248_10095900
582 Ga0105248_10272443
583 Ga0105248_10407604
584 Ga0105248_10774438
585 Ga0105237_10199933
586 Ga0105238_10316642
587 Ga0105249_10007916
588 Ga0105249_10033359
589 Ga0105249_10138386
590 Ga0105249_10172524
591 Ga0105239_10033203
592 Ga0105246_10029138
593 Ga0105246_10120224
594 Ga0157373_10012901
595 Ga0157371_10115390
596 Ga0157370_10080492
597 Ga0157370_10224441
598 Ga0157369_10010252
599 Ga0157369_10070850
600 Ga0157374_10020950
601 Ga0157374_10173250
602 Ga0157374_10270243
603 Ga0157378_10060812
604 Ga0157378_10095523
605 Ga0157378_10095787
606 Ga0157378_10655161
607 Ga0157378_10655953
608 Ga0163162_10011826
609 Ga0163162_10064309
610 Ga0163162_10119813
611 Ga0163162_10156291
612 Ga0163162_10253000
613 Ga0163162_10413333
614 Ga0157372_10170487
615 Ga0157375_10059741
616 Ga0157375_10097746
617 Ga0157375_10244876
618 Ga0157375_10288152
619 Ga0157375_10483454
620 Ga0157375_10942465
621 Ga0163163_10002225
622 Ga0163163_10004445
623 Ga0163163_10761588
624 Ga0157380_10016836
625 Ga0157380_10025950
626 Ga0157380_10197678
627 Ga0157377_10001360
628 Ga0157377_10084952
629 Ga0157379_10050176
630 Ga0157376_10120755
631 Ga0157376_10299061
632 Ga0157376_10299719
633 Ga0157376_10840762
634 Ga0163161_10011379
635 Ga0163161_10086398
636 Ga0207697_10017686
637 Ga0207656_10015418
638 Ga0207656_10091359
639 Ga0207682_10018417
640 Ga0207642_10044322
641 Ga0207688_10038391
642 Ga0207680_10015819
643 Ga0207647_10000781
644 Ga0207647_10198775
645 Ga0207645_10002790
646 Ga0207643_10000928
647 Ga0207643_10276790
648 Ga0207705_10001059
649 Ga0207705_10035664
650 Ga0207654_10038579
651 Ga0207663_10136874
652 Ga0207662_10001345
653 Ga0207657_10002968
654 Ga0207649_10000349
655 Ga0207652_10701279
656 Ga0207650_10000104
657 Ga0207650_10015231
658 Ga0207650_10028875
659 Ga0207659_10021296
660 Ga0207687_10086788
661 Ga0207644_10248677
662 Ga0207706_10003401
663 Ga0207706_10225101
664 Ga0207686_10042230
665 Ga0207686_10143446
666 Ga0207709_10351600
667 Ga0207670_10030672
668 Ga0207670_10045520
669 Ga0207670_10128688
670 Ga0207704_10134330
671 Ga0207704_10796486
672 Ga0207691_10000280
673 Ga0207691_10442865
674 Ga0207711_10004306
675 Ga0207711_10007898
676 Ga0207711_10084084
677 Ga0207711_10213198
678 Ga0207711_10244363
679 Ga0207711_10594477
680 Ga0207689_10004892
681 Ga0207689_10007108
682 Ga0207689_10552227
683 Ga0207661_10000869
684 Ga0207661_10231388
685 Ga0207679_10000089
686 Ga0207679_10014383
687 Ga0207679_10242727
688 Ga0207679_10634353
689 Ga0207667_10211759
690 Ga0207651_10102877
691 Ga0207651_10560842
692 Ga0207712_10007815
693 Ga0207712_10116210
694 Ga0207712_10184945
695 Ga0207712_10352024
696 Ga0207668_10115333
697 Ga0207640_10145571
698 Ga0207640_10791519
699 Ga0207658_10028325
700 Ga0207658_10147389
701 Ga0207677_10152629
702 Ga0207703_10053682
703 Ga0207703_10196282
704 Ga0207703_10414290
705 Ga0207703_10947395
706 Ga0207678_10001258
707 Ga0207678_10054381
708 Ga0207702_10252374
709 Ga0207641_10000020
710 Ga0207641_10009246
711 Ga0207641_10035234
712 Ga0207641_10211630
713 Ga0207641_10622180
714 Ga0207648_10003740
715 Ga0207648_10042198
716 Ga0207648_10300725
717 Ga0207676_10000108
718 Ga0207674_10000512
719 Ga0207674_10864538
720 Ga0207675_100009751
721 Ga0207675_100131277
722 Ga0207675_100203208
723 Ga0207683_10000338
724 Ga0207683_10591728
725 Ga0207698_10397147
726 Ga0268266_10116737
727 Ga0268265_10007698
728 Ga0268265_10222416
729 Ga0268265_10680087
730 Ga0268265_10845936
731 Ga0268265_10883062
732 Ga0268264_10052251
733 Ga0268264_10089212
734 Ga0268264_10258133
735 Ga0265338_10003174
736 Ga0265338_10066828
737 Ga0265338_10110702
738 Ga0265760_10000015
739 Ga0265340_10002562
740 Ga0265327_10000013
741 Ga0307408_100114186
742 Ga0307405_10088168
743 Ga0307413_10000712
744 Ga0307413_10001211
745 Ga0307413_10067887
746 Ga0307410_10019830
747 Ga0307410_10058235
748 Ga0307410_10069009
749 Ga0307406_10009639
750 Ga0307406_10416824
751 Ga0307407_10001669
752 Ga0307412_10144368
753 Ga0307412_10238612
754 Ga0307409_100009700
755 Ga0307409_100456878
756 Ga0307416_100014830
757 Ga0307416_100045795
758 Ga0307416_100084335
759 Ga0307416_100317963
760 Ga0307414_10009961
761 Ga0307411_10003945
762 Ga0307411_10010845
763 Ga0307411_10189878
764 Ga0307415_100005142
765 Ga0307510_10023391
766 Ga0373934_0000512
767 Ga0373934_0057157
768 Ga0373923_0053598
769 Ga0373953_0062454
770 Ga0373954_0000680
771 Ga0373954_0032322
772 Ga0373956_0127247
773 Ga0373955_0015441
774 Ga0373935_0323157
775 Ga0373935_0430545
776 Ga0373927_0001529
777 Ga0373933_0030550
778 Ga0373933_0221741
779 Ga0373933_0239774
780 Ga0373937_0004591
781 Ga0373937_0004921
782 Ga0373937_0015566
783 Ga0373937_0016933
784 Ga0373937_0054806
785 Ga0373937_0120372
786 Ga0373925_0001034
787 Ga0395905_0065818
788 Ga0395905_0481013
789 Ga0400490_00558
790 Ga0451849_0773393
791 Ga0453684_0562985
792 Ga0451576_0115076
793 Ga0495592_0003617
794 Ga0495592_0071752
795 Ga0495629_0166025
796 Ga0495651_0131271
797 Ga0495662_0032394
798 Ga0495662_0055219
799 Ga0495584_0017652
800 Ga0495607_0001801
801 Ga0495583_0020735
802 Ga0495616_0003174
803 Ga0495628_0057714
804 Ga0495628_0117531
805 Ga0495628_0265129
806 Ga0495642_0011865
807 Ga0495586_0044210
808 Ga0495587_0210310
809 Ga0495598_0120815
810 Ga0495609_0000202
811 Ga0495645_0002705
812 Ga0495667_0117153
813 Ga0495668_0000114
814 Ga0495668_0064850
815 Ga0495634_0013371
816 Ga0495634_0114027
817 Ga0495625_0033412
818 Ga0495659_0004604
819 Ga0495657_0020478
820 Ga0495599_0134652
821 Ga0495647_0102587
822 Ga0495669_0002096
823 Ga0495613_0095689
824 Ga0495613_0118193
825 Ga0495613_0247501
826 Ga0495624_0426452
827 Ga0495649_0018581
828 Ga0495600_0156296
829 Ga0495660_0076808
830 Ga0495604_0105803
831 Ga0495636_0073101
832 Ga0495674_0159296
833 Ga0495680_0029014
834 Ga0495675_0096921
835 Ga0495677_0003747
836 Ga0495679_026220
837 Ga0495685_012804
838 Ga0495681_0017667
839 Ga0495684_0010543
840 Ga0495684_0129701
841 Ga0495686_0001083
842 Ga0496100_0391061
843 Ga0496104_0161919
844 Ga0496104_0248152
845 Ga0496105_0225907
846 Ga0496106_0045176
847 Ga0496108_0005246
848 Ga0496109_0000018
849 Ga0496110_0001746
850 Ga0496110_0376458
851 Ga0496112_0001173
852 Ga0496113_0001440
853 Ga0496114_0211423
854 Ga0496115_0155030
855 Ga0501202_030146
856 Ga0501209_041646
857 Ga0501224_023630
858 Ga0501233_018203
859 Ga0501235_053433
860 Ga0501249_013745
861 Ga0501257_010337
862 Ga0501259_021874
863 Ga0501229_005633
864 Ga0501263_030314
865 Ga0501268_000270
866 Ga0501272_012139
867 Ga0501273_000390
868 nmdc:mga05p37_11896_c1
869 nmdc:mga09592_401874_c1
870 nmdc:mga09592_522434_c1
871 nmdc:mga0qj67_197567_c1
872 nmdc:mga06r32_104985_c1
873 nmdc:mga08y16_218350_c1
874 nmdc:mga08y16_435229_c1
875 nmdc:mga0n895_384549_c1
876 nmdc:mga0n895_40986_c1
877 nmdc:mga0a205_16114_c1
878 nmdc:mga0a205_26971_c1
879 nmdc:mga0a205_40009_c1
880 Ga0495601_0022697
881 Ga0495595_0209703
882 Ga0495619_0276614
883 Ga0500568_0002062
884 3003234660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

175

260

0.99

PF02678

Pirin

Pirin

32

148

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9744 1 232
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9679 1 231
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.958 1 232
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9514 1 231
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.8405 37 120
ID Description Score Start End Superfamily
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9817 11 135 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9766 13 131 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9737 11 135 2.60.120.10
1tq5A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9733 142 232 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9608 13 131 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A059WJ16-F1-model_v4 Pirin 0.9961 1 232 GO:0046872
AF-A0A3D6EKF5-F1-model_v4 Quercetin 2,3-dioxygenase 0.9947 1 232 GO:0046872
GO:0051213
AF-A0A3A5FIM1-F1-model_v4 deleted 0.9945 1 232
AF-A0A4D8RCU3-F1-model_v4 Pirin family protein 0.9942 1 232 GO:0046872
AF-A0A2W7A1N5-F1-model_v4 Quercetin 2,3-dioxygenase 0.9939 1 232 GO:0046872
GO:0051213

Map