F444782

General Info

Members Datasets Scaffolds Average Seq Length
441 213 882 198

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_1125434_c1|nmdc:mga06r32_1125434_c1_11_715
Length 234
Sequence MKLVVGLGNPGKEYSGTRHNIGFEGVEAFAARNGWVSSPADFKRMAKQKFEALALDGVMQVSGGGTEKVLLLEPMTFMNLSGRSVQAALAFYQLTPADLLVVLDDVALPCGKLRLRAGGSSGGHNGLKDIERALGTSQYPRLRIGVDPPPPRVPQRDWVLGKFSTEQRQQIDPAVARACGAVAVWLDKGIVPAMSQFNGDEQEKEKHEARNPRSETNSKNKPGKDPNEGSPSPF

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 0.23
Rhizosphere 99.32
Stem 0
Stem Tuber 0
Unclassified 8.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_1125434_c1 3300050510 Unclassified 733
2 rootH1_10228327 3300003323 Bacteria 1619
3 Ga0070658_10006240 3300005327 Bacteria 9657
4 Ga0070676_10016517 3300005328 Bacteria 4082
5 Ga0070676_10040025 3300005328 Bacteria 2713
6 Ga0070683_100031727 3300005329 Bacteria 4807
7 Ga0070683_100945947 3300005329 Bacteria 827
8 Ga0070670_100014411 3300005331 Bacteria 6784
9 Ga0070670_100021685 3300005331 Bacteria 5523
10 Ga0070670_100536404 3300005331 Bacteria 1043
11 Ga0070670_100617463 3300005331 Bacteria 971
12 Ga0068869_100013919 3300005334 Bacteria 5364
13 Ga0068869_100031537 3300005334 Bacteria 3728
14 Ga0070666_10058393 3300005335 Bacteria 2609
15 Ga0070666_10151111 3300005335 Bacteria 1620
16 Ga0070680_100016972 3300005336 Bacteria 5733
17 Ga0070682_100130979 3300005337 Bacteria 1697
18 Ga0068868_100029467 3300005338 Bacteria 4203
19 Ga0068868_100179148 3300005338 Unclassified 1757
20 Ga0068868_100517617 3300005338 Bacteria 1047
21 Ga0068868_101106467 3300005338 Bacteria 729
22 Ga0070660_100259176 3300005339 Bacteria 1420
23 Ga0070660_100714091 3300005339 Bacteria 841
24 Ga0070689_100033760 3300005340 Bacteria 3900
25 Ga0070687_100002344 3300005343 Bacteria 7057
26 Ga0070687_100363888 3300005343 Bacteria 937
27 Ga0070661_100000704 3300005344 Bacteria 24498
28 Ga0070661_100003464 3300005344 Bacteria 10886
29 Ga0070661_100317816 3300005344 Bacteria 1215
30 Ga0070668_100043162 3300005347 Bacteria 3458
31 Ga0070668_100094555 3300005347 Bacteria 2360
32 Ga0070668_100524459 3300005347 Unclassified 1028
33 Ga0070668_100948282 3300005347 Bacteria 771
34 Ga0070669_100024251 3300005353 Bacteria 4349
35 Ga0070669_100049813 3300005353 Bacteria 3058
36 Ga0070669_100410298 3300005353 Bacteria 1110
37 Ga0070675_100011216 3300005354 Bacteria 7015
38 Ga0070675_100036392 3300005354 Bacteria 4006
39 Ga0070675_100104879 3300005354 Bacteria 2385
40 Ga0070675_100154236 3300005354 Bacteria 1971
41 Ga0070675_100705104 3300005354 Bacteria 919
42 Ga0070671_100069680 3300005355 Bacteria 2933
43 Ga0070674_100045826 3300005356 Bacteria 2988
44 Ga0070674_100099368 3300005356 Bacteria 2117
45 Ga0070674_100145467 3300005356 Bacteria 1784
46 Ga0070674_100163149 3300005356 Bacteria 1692
47 Ga0070673_100189257 3300005364 Bacteria 1767
48 Ga0070673_100194335 3300005364 Bacteria 1744
49 Ga0070673_100353697 3300005364 Bacteria 1304
50 Ga0070673_100513879 3300005364 Bacteria 1085
51 Ga0070688_100480478 3300005365 Unclassified 934
52 Ga0070659_100095282 3300005366 Bacteria 2391
53 Ga0070667_100001910 3300005367 Bacteria 18487
54 Ga0070667_100007302 3300005367 Bacteria 9189
55 Ga0070667_100071442 3300005367 Bacteria 2956
56 Ga0070713_100046944 3300005436 Bacteria 3547
57 Ga0070710_10177478 3300005437 Bacteria 1331
58 Ga0070711_100032995 3300005439 Bacteria 3446
59 Ga0070700_100239616 3300005441 Bacteria 1295
60 Ga0070694_100159692 3300005444 Bacteria 1653
61 Ga0070663_100174613 3300005455 Bacteria 1663
62 Ga0070678_100296964 3300005456 Bacteria 1371
63 Ga0070678_100847470 3300005456 Bacteria 833
64 Ga0070662_100013389 3300005457 Bacteria 5458
65 Ga0070662_100025850 3300005457 Bacteria 4059
66 Ga0070662_100304302 3300005457 Bacteria 1296
67 Ga0070681_10016378 3300005458 Bacteria 7400
68 Ga0068867_100057131 3300005459 Bacteria 2889
69 Ga0068867_100058758 3300005459 Bacteria 2850
70 Ga0068867_100125209 3300005459 Bacteria 1991
71 Ga0068867_100287481 3300005459 Bacteria 1350
72 Ga0070706_100420799 3300005467 Bacteria 1243
73 Ga0070707_101442084 3300005468 Bacteria 655
74 Ga0070698_100120607 3300005471 Bacteria 2583
75 Ga0070679_100009829 3300005530 Bacteria 9050
76 Ga0070684_100003088 3300005535 Bacteria 12427
77 Ga0070684_100032192 3300005535 Bacteria 4468
78 Ga0068853_100009609 3300005539 Bacteria 7791
79 Ga0068853_100324887 3300005539 Bacteria 1427
80 Ga0070672_100033226 3300005543 Bacteria 3904
81 Ga0070672_100036791 3300005543 Bacteria 3732
82 Ga0070672_100372585 3300005543 Bacteria 1220
83 Ga0070686_100264076 3300005544 Bacteria 1263
84 Ga0070665_100001162 3300005548 Bacteria 32364
85 Ga0070665_100096598 3300005548 Bacteria 2959
86 Ga0070665_100208701 3300005548 Bacteria 1954
87 Ga0070665_100264293 3300005548 Bacteria 1722
88 Ga0070665_100349050 3300005548 Bacteria 1485
89 Ga0070665_101188212 3300005548 Bacteria 774
90 Ga0070704_100527299 3300005549 Unclassified 1029
91 Ga0068855_100100083 3300005563 Bacteria 3338
92 Ga0068855_100153312 3300005563 Bacteria 2619
93 Ga0070664_100042840 3300005564 Bacteria 3820
94 Ga0070664_100082537 3300005564 Bacteria 2772
95 Ga0070664_100279114 3300005564 Bacteria 1506
96 Ga0070664_101007886 3300005564 Bacteria 783
97 Ga0068857_100002362 3300005577 Bacteria 15385
98 Ga0068857_100005713 3300005577 Bacteria 10637
99 Ga0068857_101035136 3300005577 Bacteria 791
100 Ga0068854_100263980 3300005578 Bacteria 1380
101 Ga0068854_100299228 3300005578 Unclassified 1301
102 Ga0068856_100193107 3300005614 Bacteria 2050
103 Ga0070702_100145874 3300005615 Bacteria 1513
104 Ga0068859_100027134 3300005617 Bacteria 5745
105 Ga0068859_101006577 3300005617 Bacteria 915
106 Ga0068859_101330606 3300005617 Bacteria 792
107 Ga0068864_100095989 3300005618 Bacteria 2623
108 Ga0068864_100108621 3300005618 Bacteria 2469
109 Ga0068864_100485058 3300005618 Bacteria 1187
110 Ga0068861_100001999 3300005719 Bacteria 13184
111 Ga0068851_10014922 3300005834 Bacteria 3695
112 Ga0068851_10471371 3300005834 Bacteria 749
113 Ga0068870_10235081 3300005840 Bacteria 1129
114 Ga0068870_10301920 3300005840 Bacteria 1011
115 Ga0068863_100172378 3300005841 Bacteria 2076
116 Ga0068863_100249415 3300005841 Bacteria 1714
117 Ga0068860_100016147 3300005843 Bacteria 7286
118 Ga0068860_100026376 3300005843 Bacteria 5602
119 Ga0068860_100160558 3300005843 Unclassified 2167
120 Ga0068860_100188801 3300005843 Bacteria 1994
121 Ga0068862_100000229 3300005844 Bacteria 62419
122 Ga0068862_100025469 3300005844 Bacteria 4967
123 Ga0081538_10000007 3300005981 Bacteria 175313
124 Ga0081539_10009883 3300005985 Bacteria 7868
125 Ga0075432_10086989 3300006058 Bacteria 1140
126 Ga0070712_100059702 3300006175 Bacteria 2687
127 Ga0097621_100241614 3300006237 Bacteria 1579
128 Ga0075428_100003592 3300006844 Bacteria 16998
129 Ga0075428_100079313 3300006844 Bacteria 3583
130 Ga0075430_100005139 3300006846 Bacteria 11017
131 Ga0075430_100012080 3300006846 Bacteria 7351
132 Ga0075430_100013209 3300006846 Bacteria 7036
133 Ga0075430_100239230 3300006846 Bacteria 1505
134 Ga0075431_100010190 3300006847 Bacteria 9450
135 Ga0075431_100112812 3300006847 Bacteria 2805
136 Ga0075431_100142490 3300006847 Bacteria 2471
137 Ga0075431_100319481 3300006847 Bacteria 1566
138 Ga0075433_10026927 3300006852 Bacteria 4873
139 Ga0075433_10083750 3300006852 Bacteria 2815
140 Ga0075433_10184896 3300006852 Bacteria 1854
141 Ga0075434_100010818 3300006871 Bacteria 8573
142 Ga0075434_100126590 3300006871 Bacteria 2572
143 Ga0075434_100155996 3300006871 Bacteria 2302
144 Ga0075429_100077044 3300006880 Bacteria 2904
145 Ga0075429_100127824 3300006880 Bacteria 2223
146 Ga0075429_100179681 3300006880 Bacteria 1854
147 Ga0075429_100470262 3300006880 Bacteria 1101
148 Ga0068865_100086455 3300006881 Bacteria 2264
149 Ga0068865_100237360 3300006881 Bacteria 1433
150 Ga0068865_100309267 3300006881 Unclassified 1267
151 Ga0097620_100027132 3300006931 Bacteria 5745
152 Ga0097620_101006682 3300006931 Bacteria 915
153 Ga0097620_101330680 3300006931 Bacteria 792
154 Ga0105240_10063091 3300009093 Bacteria 4611
155 Ga0105240_10228609 3300009093 Unclassified 2163
156 Ga0111539_10210931 3300009094 Bacteria 2263
157 Ga0111539_10254474 3300009094 Bacteria 2045
158 Ga0111539_10495662 3300009094 Unclassified 1423
159 Ga0111539_10983581 3300009094 Bacteria 981
160 Ga0114129_10041073 3300009147 Bacteria 6520
161 Ga0114129_10389899 3300009147 Bacteria 1837
162 Ga0114129_11085221 3300009147 Bacteria 1003
163 Ga0105241_10389701 3300009174 Bacteria 1219
164 Ga0105248_10066109 3300009177 Bacteria 4060
165 Ga0105248_10344909 3300009177 Unclassified 1677
166 Ga0105248_10878933 3300009177 Bacteria 1012
167 Ga0105237_10346563 3300009545 Bacteria 1490
168 Ga0105249_10000179 3300009553 Bacteria 74358
169 Ga0105249_10036624 3300009553 Bacteria 4451
170 Ga0105239_10310308 3300010375 Bacteria 1778
171 Ga0157373_10384913 3300013100 Bacteria 1004
172 Ga0157371_10014608 3300013102 Bacteria 5918
173 Ga0157371_10255569 3300013102 Unclassified 1262
174 Ga0157370_10836664 3300013104 Bacteria 837
175 Ga0157369_10049204 3300013105 Bacteria 4570
176 Ga0157369_10094165 3300013105 Bacteria 3197
177 Ga0157369_10195844 3300013105 Bacteria 2122
178 Ga0157369_10595578 3300013105 Bacteria 1141
179 Ga0157369_11007007 3300013105 Bacteria 853
180 Ga0157374_10187295 3300013296 Bacteria 2023
181 Ga0157374_11418476 3300013296 Unclassified 717
182 Ga0157378_10398669 3300013297 Bacteria 1355
183 Ga0163162_10002125 3300013306 Bacteria 18615
184 Ga0163162_10007391 3300013306 Bacteria 10683
185 Ga0163162_10086047 3300013306 Bacteria 3221
186 Ga0163162_10148665 3300013306 Bacteria 2460
187 Ga0163162_10406765 3300013306 Bacteria 1494
188 Ga0163162_10559872 3300013306 Bacteria 1271
189 Ga0157372_10035735 3300013307 Bacteria 5471
190 Ga0157372_10265951 3300013307 Bacteria 1991
191 Ga0157372_10713298 3300013307 Bacteria 1167
192 Ga0157372_10840783 3300013307 Bacteria 1066
193 Ga0157375_10082747 3300013308 Bacteria 3253
194 Ga0157375_10088691 3300013308 Bacteria 3148
195 Ga0157375_10196235 3300013308 Bacteria 2173
196 Ga0157375_10593102 3300013308 Bacteria 1268
197 Ga0163163_10056001 3300014325 Bacteria 3897
198 Ga0163163_10159709 3300014325 Bacteria 2299
199 Ga0163163_10582267 3300014325 Unclassified 1182
200 Ga0163163_11727511 3300014325 Bacteria 686
201 Ga0157380_10265086 3300014326 Unclassified 1563
202 Ga0157380_10376192 3300014326 Bacteria 1339
203 Ga0157380_10405060 3300014326 Bacteria 1295
204 Ga0157377_10037495 3300014745 Bacteria 2671
205 Ga0157377_10083202 3300014745 Bacteria 1875
206 Ga0157377_10215138 3300014745 Bacteria 1227
207 Ga0157379_10013639 3300014968 Bacteria 7122
208 Ga0157376_10144645 3300014969 Bacteria 2137
209 Ga0157376_10597790 3300014969 Bacteria 1098
210 Ga0182005_1054647 3300015265 Bacteria 1088
211 Ga0163161_10007801 3300017792 Bacteria 7404
212 Ga0163161_10081916 3300017792 Bacteria 2377
213 Ga0224712_10022177 3300022467 Bacteria 2185
214 Ga0207697_10007484 3300025315 Bacteria 4867
215 Ga0207656_10345317 3300025321 Unclassified 742
216 Ga0207682_10013532 3300025893 Bacteria 3178
217 Ga0207682_10178752 3300025893 Bacteria 968
218 Ga0207642_10065252 3300025899 Bacteria 1710
219 Ga0207680_10140805 3300025903 Bacteria 1599
220 Ga0207680_10191413 3300025903 Bacteria 1389
221 Ga0207647_10009786 3300025904 Bacteria 6799
222 Ga0207645_10000164 3300025907 Bacteria 52549
223 Ga0207645_10049314 3300025907 Bacteria 2688
224 Ga0207643_10282550 3300025908 Bacteria 1029
225 Ga0207705_10805715 3300025909 Bacteria 729
226 Ga0207707_10010135 3300025912 Bacteria 8177
227 Ga0207695_10000211 3300025913 Bacteria 156467
228 Ga0207663_10712570 3300025916 Bacteria 795
229 Ga0207660_10144360 3300025917 Bacteria 1822
230 Ga0207662_10025405 3300025918 Bacteria 3411
231 Ga0207657_10031985 3300025919 Bacteria 4759
232 Ga0207657_10099306 3300025919 Bacteria 2418
233 Ga0207657_10479121 3300025919 Bacteria 975
234 Ga0207649_10012643 3300025920 Bacteria 4689
235 Ga0207649_10038454 3300025920 Bacteria 2897
236 Ga0207649_10248923 3300025920 Bacteria 1279
237 Ga0207652_10275100 3300025921 Bacteria 1519
238 Ga0207681_10009599 3300025923 Bacteria 5914
239 Ga0207681_10030006 3300025923 Bacteria 3540
240 Ga0207681_10082370 3300025923 Bacteria 2274
241 Ga0207681_10360673 3300025923 Bacteria 1166
242 Ga0207650_10016571 3300025925 Bacteria 5152
243 Ga0207650_10049166 3300025925 Bacteria 3113
244 Ga0207650_10051342 3300025925 Bacteria 3051
245 Ga0207650_10111013 3300025925 Bacteria 2123
246 Ga0207650_10166448 3300025925 Bacteria 1750
247 Ga0207650_10667799 3300025925 Bacteria 877
248 Ga0207659_10002713 3300025926 Bacteria 10552
249 Ga0207659_10040912 3300025926 Bacteria 3244
250 Ga0207659_10166384 3300025926 Bacteria 1736
251 Ga0207659_10363471 3300025926 Bacteria 1203
252 Ga0207659_10713762 3300025926 Bacteria 859
253 Ga0207700_10025570 3300025928 Bacteria 4102
254 Ga0207644_10043617 3300025931 Bacteria 3184
255 Ga0207644_10056525 3300025931 Bacteria 2832
256 Ga0207690_10013719 3300025932 Bacteria 4877
257 Ga0207690_10297853 3300025932 Bacteria 1261
258 Ga0207706_10000199 3300025933 Bacteria 65959
259 Ga0207706_10015642 3300025933 Bacteria 6856
260 Ga0207706_10088516 3300025933 Bacteria 2722
261 Ga0207706_10260046 3300025933 Bacteria 1515
262 Ga0207706_10433299 3300025933 Bacteria 1138
263 Ga0207686_10034237 3300025934 Bacteria 3039
264 Ga0207669_10132960 3300025937 Bacteria 1713
265 Ga0207669_10183012 3300025937 Bacteria 1504
266 Ga0207669_10495726 3300025937 Bacteria 976
267 Ga0207704_10129816 3300025938 Bacteria 1743
268 Ga0207704_10252657 3300025938 Bacteria 1324
269 Ga0207704_10332853 3300025938 Bacteria 1176
270 Ga0207704_11065627 3300025938 Bacteria 686
271 Ga0207691_10002168 3300025940 Bacteria 19197
272 Ga0207691_10025623 3300025940 Bacteria 5536
273 Ga0207691_10046864 3300025940 Bacteria 3970
274 Ga0207691_10072000 3300025940 Bacteria 3118
275 Ga0207691_10265846 3300025940 Bacteria 1478
276 Ga0207711_10131487 3300025941 Bacteria 2245
277 Ga0207711_10263898 3300025941 Bacteria 1583
278 Ga0207711_10835521 3300025941 Unclassified 857
279 Ga0207689_10011136 3300025942 Bacteria 7720
280 Ga0207689_10039854 3300025942 Bacteria 3889
281 Ga0207661_10075418 3300025944 Bacteria 2767
282 Ga0207661_10079851 3300025944 Bacteria 2697
283 Ga0207679_10004274 3300025945 Bacteria 8871
284 Ga0207679_10024716 3300025945 Bacteria 4122
285 Ga0207679_10042929 3300025945 Bacteria 3252
286 Ga0207679_10044108 3300025945 Bacteria 3216
287 Ga0207667_10190870 3300025949 Unclassified 2102
288 Ga0207651_10039636 3300025960 Bacteria 3108
289 Ga0207651_10726954 3300025960 Unclassified 876
290 Ga0207712_10038940 3300025961 Bacteria 3254
291 Ga0207712_10050225 3300025961 Bacteria 2911
292 Ga0207668_10023605 3300025972 Bacteria 3956
293 Ga0207668_10077067 3300025972 Bacteria 2402
294 Ga0207668_10398530 3300025972 Unclassified 1163
295 Ga0207640_10095700 3300025981 Bacteria 2068
296 Ga0207658_10011176 3300025986 Bacteria 6115
297 Ga0207658_10016496 3300025986 Bacteria 5080
298 Ga0207677_10035753 3300026023 Bacteria 3229
299 Ga0207677_10153647 3300026023 Bacteria 1779
300 Ga0207677_10301497 3300026023 Bacteria 1324
301 Ga0207677_10623183 3300026023 Bacteria 949
302 Ga0207703_10125258 3300026035 Bacteria 2211
303 Ga0207639_10230447 3300026041 Bacteria 1605
304 Ga0207639_10413952 3300026041 Bacteria 1217
305 Ga0207678_10160217 3300026067 Bacteria 1922
306 Ga0207678_10571225 3300026067 Bacteria 990
307 Ga0207708_10029584 3300026075 Bacteria 4152
308 Ga0207641_10219822 3300026088 Bacteria 1761
309 Ga0207641_10222974 3300026088 Bacteria 1749
310 Ga0207648_10062613 3300026089 Bacteria 3243
311 Ga0207648_10079960 3300026089 Unclassified 2852
312 Ga0207648_10107880 3300026089 Bacteria 2444
313 Ga0207648_10307714 3300026089 Bacteria 1422
314 Ga0207676_10313529 3300026095 Bacteria 1437
315 Ga0207676_10437391 3300026095 Bacteria 1230
316 Ga0207674_10000687 3300026116 Bacteria 44015
317 Ga0207674_10001632 3300026116 Bacteria 28867
318 Ga0207674_10047282 3300026116 Bacteria 4412
319 Ga0207675_100000275 3300026118 Bacteria 49008
320 Ga0207675_100013012 3300026118 Bacteria 7767
321 Ga0207683_10233048 3300026121 Bacteria 1679
322 Ga0207683_10256748 3300026121 Bacteria 1595
323 Ga0207683_10473369 3300026121 Unclassified 1156
324 Ga0207683_10592760 3300026121 Bacteria 1026
325 Ga0207698_10187230 3300026142 Bacteria 1840
326 Ga0207428_10050291 3300027907 Bacteria 3335
327 Ga0207428_10629305 3300027907 Unclassified 771
328 Ga0268266_10000395 3300028379 Bacteria 66128
329 Ga0268266_10144038 3300028379 Bacteria 2141
330 Ga0268266_10154810 3300028379 Bacteria 2069
331 Ga0268265_10001416 3300028380 Bacteria 20295
332 Ga0268265_10069459 3300028380 Bacteria 2735
333 Ga0268264_10038790 3300028381 Bacteria 3933
334 Ga0268264_10076012 3300028381 Bacteria 2857
335 Ga0268264_10335114 3300028381 Bacteria 1435
336 Ga0268264_10427043 3300028381 Unclassified 1279
337 Ga0265340_10171751 3300031247 Bacteria 982
338 Ga0265339_10060920 3300031249 Bacteria 2032
339 Ga0265339_10326767 3300031249 Unclassified 727
340 Ga0307408_100056873 3300031548 Bacteria 2837
341 Ga0265313_10109050 3300031595 Bacteria 1219
342 Ga0265314_10010665 3300031711 Bacteria 7646
343 Ga0307405_10368051 3300031731 Bacteria 1115
344 Ga0307413_10313233 3300031824 Bacteria 1195
345 Ga0307410_10244714 3300031852 Bacteria 1392
346 Ga0307410_10556999 3300031852 Unclassified 951
347 Ga0307410_10613423 3300031852 Unclassified 909
348 Ga0307410_10636425 3300031852 Bacteria 893
349 Ga0307406_10002103 3300031901 Bacteria 10855
350 Ga0307406_10199121 3300031901 Bacteria 1473
351 Ga0307412_10616891 3300031911 Bacteria 921
352 Ga0307409_100125413 3300031995 Bacteria 2183
353 Ga0307409_100203241 3300031995 Bacteria 1774
354 Ga0307409_101610330 3300031995 Bacteria 678
355 Ga0307416_100059374 3300032002 Bacteria 3108
356 Ga0307416_100247635 3300032002 Bacteria 1732
357 Ga0307416_100254516 3300032002 Bacteria 1712
358 Ga0307414_10101451 3300032004 Bacteria 2167
359 Ga0307411_10437069 3300032005 Bacteria 1091
360 Ga0307415_100117759 3300032126 Bacteria 1985
361 Ga0307415_100141372 3300032126 Bacteria 1839
362 Ga0307415_100474855 3300032126 Bacteria 1087
363 Ga0373934_0201256 3300035086 Bacteria 820
364 Ga0373943_0027335 3300035170 Bacteria 2680
365 Ga0373961_0023115 3300035241 Bacteria 1670
366 Ga0373924_0004963 3300035410 Bacteria 4684
367 Ga0373937_0032077 3300036401 Bacteria 4763
368 Ga0373937_1463925 3300036401 Bacteria 630
369 Ga0395905_0311270 3300037471 Bacteria 1463
370 Ga0395901_0136116 3300038443 Bacteria 2582
371 Ga0395901_0484148 3300038443 Bacteria 1262
372 Ga0436360_0598535 3300039438 Bacteria 956
373 Ga0436362_0030987 3300039453 Bacteria 1296
374 Ga0436362_1049251 3300039453 Bacteria 1000
375 Ga0439448_0022369 3300042005 Bacteria 1965
376 Ga0453684_0329514 3300044712 Bacteria 1727
377 Ga0451576_0376128 3300045051 Unclassified 1489
378 Ga0495592_0044126 3300046454 Bacteria 3333
379 Ga0495629_0045676 3300046459 Bacteria 3073
380 Ga0495594_0106292 3300046499 Unclassified 1581
381 Ga0495628_0031734 3300046516 Bacteria 4272
382 Ga0495628_0348158 3300046516 Unclassified 1090
383 Ga0495630_0100420 3300046517 Unclassified 2189
384 Ga0495587_0005622 3300046536 Bacteria 8180
385 Ga0495667_0024133 3300046559 Bacteria 4096
386 Ga0495667_0391485 3300046559 Unclassified 876
387 Ga0495634_0016548 3300046642 Bacteria 5272
388 Ga0495634_0185618 3300046642 Bacteria 1300
389 Ga0495657_0037817 3300046675 Bacteria 3324
390 Ga0495613_0040247 3300046689 Bacteria 3464
391 Ga0495613_0107264 3300046689 Bacteria 2015
392 Ga0495600_0044884 3300046809 Bacteria 2883
393 Ga0495581_0287824 3300047315 Bacteria 961
394 Ga0495604_0127460 3300047317 Unclassified 1833
395 Ga0495636_0298723 3300047318 Bacteria 753
396 Ga0495674_0323605 3300047319 Bacteria 1256
397 Ga0495674_0503121 3300047319 Bacteria 969
398 Ga0495684_0032813 3300047471 Bacteria 3989
399 Ga0495684_0149253 3300047471 Bacteria 1749
400 Ga0495686_0052206 3300047472 Unclassified 2564
401 Ga0496108_0348851 3300048911 Bacteria 1291
402 Ga0501034_0000836 3300049571 Bacteria 45672
403 Ga0501034_0003366 3300049571 Bacteria 18254
404 Ga0501034_0015636 3300049571 Bacteria 7795
405 Ga0501037_0075545 3300049573 Bacteria 2447
406 Ga0501046_0183443 3300049580 Bacteria 1564
407 Ga0501046_0272920 3300049580 Bacteria 1240
408 Ga0501048_0275152 3300049582 Bacteria 1197
409 Ga0501070_0084311 3300049586 Bacteria 2631
410 Ga0501071_0847965 3300049587 Bacteria 705
411 Ga0501233_183136 3300049668 Bacteria 601
412 Ga0501080_0002086 3300049742 Bacteria 17356
413 Ga0501080_0110156 3300049742 Unclassified 2552
414 Ga0501080_0246195 3300049742 Unclassified 1631
415 Ga0501083_0039040 3300049744 Unclassified 3225
416 Ga0501044_0000881 3300049823 Bacteria 36201
417 Ga0501044_0010913 3300049823 Bacteria 9861
418 Ga0501044_0061595 3300049823 Bacteria 3838
419 nmdc:mga05p37_291650_c1 3300050507 Bacteria 1942
420 nmdc:mga05p37_97613_c1 3300050507 Bacteria 3619
421 nmdc:mga09592_167031_c1 3300050508 Bacteria 1902
422 nmdc:mga09592_31056_c1 3300050508 Bacteria 4449
423 nmdc:mga09592_40071_c1 3300050508 Bacteria 3936
424 nmdc:mga09592_64001_c1 3300050508 Bacteria 3113
425 nmdc:mga0qj67_134663_c1 3300050509 Bacteria 2002
426 nmdc:mga0qj67_2305_c1 3300050509 Bacteria 13569
427 nmdc:mga0qj67_32049_c1 3300050509 Bacteria 4097
428 nmdc:mga0qj67_320802_c1 3300050509 Bacteria 1254
429 nmdc:mga0qj67_60050_c1 3300050509 Bacteria 3016
430 nmdc:mga06r32_31561_c1 3300050510 Bacteria 4977
431 nmdc:mga06r32_383188_c1 3300050510 Bacteria 1389
432 nmdc:mga06r32_60158_c1 3300050510 Bacteria 3655
433 nmdc:mga08y16_185721_c1 3300050511 Bacteria 2157
434 nmdc:mga0n895_185391_c1 3300050512 Bacteria 2112
435 nmdc:mga0n895_185701_c1 3300050512 Bacteria 2110
436 nmdc:mga0n895_7480_c1 3300050512 Bacteria 9377
437 nmdc:mga0rr50_517920_c1 3300050513 Bacteria 1015
438 nmdc:mga0a205_25456_c1 3300050515 Bacteria 5638
439 nmdc:mga0a205_620507_c1 3300050515 Unclassified 934
440 nmdc:mga0a205_96629_c1 3300050515 Bacteria 2853
441 Ga0500556_0039484 3300053104 Bacteria 1654
442 nmdc:mga06r32_1125434_c1
443 rootH1_10228327
444 Ga0070658_10006240
445 Ga0070676_10016517
446 Ga0070676_10040025
447 Ga0070683_100031727
448 Ga0070683_100945947
449 Ga0070670_100014411
450 Ga0070670_100021685
451 Ga0070670_100536404
452 Ga0070670_100617463
453 Ga0068869_100013919
454 Ga0068869_100031537
455 Ga0070666_10058393
456 Ga0070666_10151111
457 Ga0070680_100016972
458 Ga0070682_100130979
459 Ga0068868_100029467
460 Ga0068868_100179148
461 Ga0068868_100517617
462 Ga0068868_101106467
463 Ga0070660_100259176
464 Ga0070660_100714091
465 Ga0070689_100033760
466 Ga0070687_100002344
467 Ga0070687_100363888
468 Ga0070661_100000704
469 Ga0070661_100003464
470 Ga0070661_100317816
471 Ga0070668_100043162
472 Ga0070668_100094555
473 Ga0070668_100524459
474 Ga0070668_100948282
475 Ga0070669_100024251
476 Ga0070669_100049813
477 Ga0070669_100410298
478 Ga0070675_100011216
479 Ga0070675_100036392
480 Ga0070675_100104879
481 Ga0070675_100154236
482 Ga0070675_100705104
483 Ga0070671_100069680
484 Ga0070674_100045826
485 Ga0070674_100099368
486 Ga0070674_100145467
487 Ga0070674_100163149
488 Ga0070673_100189257
489 Ga0070673_100194335
490 Ga0070673_100353697
491 Ga0070673_100513879
492 Ga0070688_100480478
493 Ga0070659_100095282
494 Ga0070667_100001910
495 Ga0070667_100007302
496 Ga0070667_100071442
497 Ga0070713_100046944
498 Ga0070710_10177478
499 Ga0070711_100032995
500 Ga0070700_100239616
501 Ga0070694_100159692
502 Ga0070663_100174613
503 Ga0070678_100296964
504 Ga0070678_100847470
505 Ga0070662_100013389
506 Ga0070662_100025850
507 Ga0070662_100304302
508 Ga0070681_10016378
509 Ga0068867_100057131
510 Ga0068867_100058758
511 Ga0068867_100125209
512 Ga0068867_100287481
513 Ga0070706_100420799
514 Ga0070707_101442084
515 Ga0070698_100120607
516 Ga0070679_100009829
517 Ga0070684_100003088
518 Ga0070684_100032192
519 Ga0068853_100009609
520 Ga0068853_100324887
521 Ga0070672_100033226
522 Ga0070672_100036791
523 Ga0070672_100372585
524 Ga0070686_100264076
525 Ga0070665_100001162
526 Ga0070665_100096598
527 Ga0070665_100208701
528 Ga0070665_100264293
529 Ga0070665_100349050
530 Ga0070665_101188212
531 Ga0070704_100527299
532 Ga0068855_100100083
533 Ga0068855_100153312
534 Ga0070664_100042840
535 Ga0070664_100082537
536 Ga0070664_100279114
537 Ga0070664_101007886
538 Ga0068857_100002362
539 Ga0068857_100005713
540 Ga0068857_101035136
541 Ga0068854_100263980
542 Ga0068854_100299228
543 Ga0068856_100193107
544 Ga0070702_100145874
545 Ga0068859_100027134
546 Ga0068859_101006577
547 Ga0068859_101330606
548 Ga0068864_100095989
549 Ga0068864_100108621
550 Ga0068864_100485058
551 Ga0068861_100001999
552 Ga0068851_10014922
553 Ga0068851_10471371
554 Ga0068870_10235081
555 Ga0068870_10301920
556 Ga0068863_100172378
557 Ga0068863_100249415
558 Ga0068860_100016147
559 Ga0068860_100026376
560 Ga0068860_100160558
561 Ga0068860_100188801
562 Ga0068862_100000229
563 Ga0068862_100025469
564 Ga0081538_10000007
565 Ga0081539_10009883
566 Ga0075432_10086989
567 Ga0070712_100059702
568 Ga0097621_100241614
569 Ga0075428_100003592
570 Ga0075428_100079313
571 Ga0075430_100005139
572 Ga0075430_100012080
573 Ga0075430_100013209
574 Ga0075430_100239230
575 Ga0075431_100010190
576 Ga0075431_100112812
577 Ga0075431_100142490
578 Ga0075431_100319481
579 Ga0075433_10026927
580 Ga0075433_10083750
581 Ga0075433_10184896
582 Ga0075434_100010818
583 Ga0075434_100126590
584 Ga0075434_100155996
585 Ga0075429_100077044
586 Ga0075429_100127824
587 Ga0075429_100179681
588 Ga0075429_100470262
589 Ga0068865_100086455
590 Ga0068865_100237360
591 Ga0068865_100309267
592 Ga0097620_100027132
593 Ga0097620_101006682
594 Ga0097620_101330680
595 Ga0105240_10063091
596 Ga0105240_10228609
597 Ga0111539_10210931
598 Ga0111539_10254474
599 Ga0111539_10495662
600 Ga0111539_10983581
601 Ga0114129_10041073
602 Ga0114129_10389899
603 Ga0114129_11085221
604 Ga0105241_10389701
605 Ga0105248_10066109
606 Ga0105248_10344909
607 Ga0105248_10878933
608 Ga0105237_10346563
609 Ga0105249_10000179
610 Ga0105249_10036624
611 Ga0105239_10310308
612 Ga0157373_10384913
613 Ga0157371_10014608
614 Ga0157371_10255569
615 Ga0157370_10836664
616 Ga0157369_10049204
617 Ga0157369_10094165
618 Ga0157369_10195844
619 Ga0157369_10595578
620 Ga0157369_11007007
621 Ga0157374_10187295
622 Ga0157374_11418476
623 Ga0157378_10398669
624 Ga0163162_10002125
625 Ga0163162_10007391
626 Ga0163162_10086047
627 Ga0163162_10148665
628 Ga0163162_10406765
629 Ga0163162_10559872
630 Ga0157372_10035735
631 Ga0157372_10265951
632 Ga0157372_10713298
633 Ga0157372_10840783
634 Ga0157375_10082747
635 Ga0157375_10088691
636 Ga0157375_10196235
637 Ga0157375_10593102
638 Ga0163163_10056001
639 Ga0163163_10159709
640 Ga0163163_10582267
641 Ga0163163_11727511
642 Ga0157380_10265086
643 Ga0157380_10376192
644 Ga0157380_10405060
645 Ga0157377_10037495
646 Ga0157377_10083202
647 Ga0157377_10215138
648 Ga0157379_10013639
649 Ga0157376_10144645
650 Ga0157376_10597790
651 Ga0182005_1054647
652 Ga0163161_10007801
653 Ga0163161_10081916
654 Ga0224712_10022177
655 Ga0207697_10007484
656 Ga0207656_10345317
657 Ga0207682_10013532
658 Ga0207682_10178752
659 Ga0207642_10065252
660 Ga0207680_10140805
661 Ga0207680_10191413
662 Ga0207647_10009786
663 Ga0207645_10000164
664 Ga0207645_10049314
665 Ga0207643_10282550
666 Ga0207705_10805715
667 Ga0207707_10010135
668 Ga0207695_10000211
669 Ga0207663_10712570
670 Ga0207660_10144360
671 Ga0207662_10025405
672 Ga0207657_10031985
673 Ga0207657_10099306
674 Ga0207657_10479121
675 Ga0207649_10012643
676 Ga0207649_10038454
677 Ga0207649_10248923
678 Ga0207652_10275100
679 Ga0207681_10009599
680 Ga0207681_10030006
681 Ga0207681_10082370
682 Ga0207681_10360673
683 Ga0207650_10016571
684 Ga0207650_10049166
685 Ga0207650_10051342
686 Ga0207650_10111013
687 Ga0207650_10166448
688 Ga0207650_10667799
689 Ga0207659_10002713
690 Ga0207659_10040912
691 Ga0207659_10166384
692 Ga0207659_10363471
693 Ga0207659_10713762
694 Ga0207700_10025570
695 Ga0207644_10043617
696 Ga0207644_10056525
697 Ga0207690_10013719
698 Ga0207690_10297853
699 Ga0207706_10000199
700 Ga0207706_10015642
701 Ga0207706_10088516
702 Ga0207706_10260046
703 Ga0207706_10433299
704 Ga0207686_10034237
705 Ga0207669_10132960
706 Ga0207669_10183012
707 Ga0207669_10495726
708 Ga0207704_10129816
709 Ga0207704_10252657
710 Ga0207704_10332853
711 Ga0207704_11065627
712 Ga0207691_10002168
713 Ga0207691_10025623
714 Ga0207691_10046864
715 Ga0207691_10072000
716 Ga0207691_10265846
717 Ga0207711_10131487
718 Ga0207711_10263898
719 Ga0207711_10835521
720 Ga0207689_10011136
721 Ga0207689_10039854
722 Ga0207661_10075418
723 Ga0207661_10079851
724 Ga0207679_10004274
725 Ga0207679_10024716
726 Ga0207679_10042929
727 Ga0207679_10044108
728 Ga0207667_10190870
729 Ga0207651_10039636
730 Ga0207651_10726954
731 Ga0207712_10038940
732 Ga0207712_10050225
733 Ga0207668_10023605
734 Ga0207668_10077067
735 Ga0207668_10398530
736 Ga0207640_10095700
737 Ga0207658_10011176
738 Ga0207658_10016496
739 Ga0207677_10035753
740 Ga0207677_10153647
741 Ga0207677_10301497
742 Ga0207677_10623183
743 Ga0207703_10125258
744 Ga0207639_10230447
745 Ga0207639_10413952
746 Ga0207678_10160217
747 Ga0207678_10571225
748 Ga0207708_10029584
749 Ga0207641_10219822
750 Ga0207641_10222974
751 Ga0207648_10062613
752 Ga0207648_10079960
753 Ga0207648_10107880
754 Ga0207648_10307714
755 Ga0207676_10313529
756 Ga0207676_10437391
757 Ga0207674_10000687
758 Ga0207674_10001632
759 Ga0207674_10047282
760 Ga0207675_100000275
761 Ga0207675_100013012
762 Ga0207683_10233048
763 Ga0207683_10256748
764 Ga0207683_10473369
765 Ga0207683_10592760
766 Ga0207698_10187230
767 Ga0207428_10050291
768 Ga0207428_10629305
769 Ga0268266_10000395
770 Ga0268266_10144038
771 Ga0268266_10154810
772 Ga0268265_10001416
773 Ga0268265_10069459
774 Ga0268264_10038790
775 Ga0268264_10076012
776 Ga0268264_10335114
777 Ga0268264_10427043
778 Ga0265340_10171751
779 Ga0265339_10060920
780 Ga0265339_10326767
781 Ga0307408_100056873
782 Ga0265313_10109050
783 Ga0265314_10010665
784 Ga0307405_10368051
785 Ga0307413_10313233
786 Ga0307410_10244714
787 Ga0307410_10556999
788 Ga0307410_10613423
789 Ga0307410_10636425
790 Ga0307406_10002103
791 Ga0307406_10199121
792 Ga0307412_10616891
793 Ga0307409_100125413
794 Ga0307409_100203241
795 Ga0307409_101610330
796 Ga0307416_100059374
797 Ga0307416_100247635
798 Ga0307416_100254516
799 Ga0307414_10101451
800 Ga0307411_10437069
801 Ga0307415_100117759
802 Ga0307415_100141372
803 Ga0307415_100474855
804 Ga0373934_0201256
805 Ga0373943_0027335
806 Ga0373961_0023115
807 Ga0373924_0004963
808 Ga0373937_0032077
809 Ga0373937_1463925
810 Ga0395905_0311270
811 Ga0395901_0136116
812 Ga0395901_0484148
813 Ga0436360_0598535
814 Ga0436362_0030987
815 Ga0436362_1049251
816 Ga0439448_0022369
817 Ga0453684_0329514
818 Ga0451576_0376128
819 Ga0495592_0044126
820 Ga0495629_0045676
821 Ga0495594_0106292
822 Ga0495628_0031734
823 Ga0495628_0348158
824 Ga0495630_0100420
825 Ga0495587_0005622
826 Ga0495667_0024133
827 Ga0495667_0391485
828 Ga0495634_0016548
829 Ga0495634_0185618
830 Ga0495657_0037817
831 Ga0495613_0040247
832 Ga0495613_0107264
833 Ga0495600_0044884
834 Ga0495581_0287824
835 Ga0495604_0127460
836 Ga0495636_0298723
837 Ga0495674_0323605
838 Ga0495674_0503121
839 Ga0495684_0032813
840 Ga0495684_0149253
841 Ga0495686_0052206
842 Ga0496108_0348851
843 Ga0501034_0000836
844 Ga0501034_0003366
845 Ga0501034_0015636
846 Ga0501037_0075545
847 Ga0501046_0183443
848 Ga0501046_0272920
849 Ga0501048_0275152
850 Ga0501070_0084311
851 Ga0501071_0847965
852 Ga0501233_183136
853 Ga0501080_0002086
854 Ga0501080_0110156
855 Ga0501080_0246195
856 Ga0501083_0039040
857 Ga0501044_0000881
858 Ga0501044_0010913
859 Ga0501044_0061595
860 nmdc:mga05p37_291650_c1
861 nmdc:mga05p37_97613_c1
862 nmdc:mga09592_167031_c1
863 nmdc:mga09592_31056_c1
864 nmdc:mga09592_40071_c1
865 nmdc:mga09592_64001_c1
866 nmdc:mga0qj67_134663_c1
867 nmdc:mga0qj67_2305_c1
868 nmdc:mga0qj67_32049_c1
869 nmdc:mga0qj67_320802_c1
870 nmdc:mga0qj67_60050_c1
871 nmdc:mga06r32_31561_c1
872 nmdc:mga06r32_383188_c1
873 nmdc:mga06r32_60158_c1
874 nmdc:mga08y16_185721_c1
875 nmdc:mga0n895_185391_c1
876 nmdc:mga0n895_185701_c1
877 nmdc:mga0n895_7480_c1
878 nmdc:mga0rr50_517920_c1
879 nmdc:mga0a205_25456_c1
880 nmdc:mga0a205_620507_c1
881 nmdc:mga0a205_96629_c1
882 Ga0500556_0039484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

3

198

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9388 1 195
4olj-assembly1.cif.gz_A crystal structure of arg119gln mutant of peptidyl-trna hydrolase from acinetobacter baumannii at 1.49 a resolution 0.9339 3 207
7brd-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from klebsiella pneumoniae 0.9331 1 204
5zk0-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase mutant -m71a from vibrio cholerae 0.9326 4 203
4p7b-assembly2.cif.gz_C crystal structure of s. typhimurium peptidyl-trna hydrolase 0.9282 3 204
ID Description Score Start End Superfamily
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9279 3 210 3.40.50.1470
af_Q86Y79_27_209_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9249 2 197 3.40.50.1470
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.917 3 210 3.40.50.1470
1rynA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9112 1 197 3.40.50.1470
3neaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9081 3 200 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A4Q3UV06-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9968 82 210 GO:0004045
AF-A0A4Q3UV06-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9891 82 210 GO:0004045
AF-A0A1A9IBD9-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9887 1 210 GO:0004045
AF-A0A3C1C8J1-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9842 1 209 GO:0004045
GO:0005737
GO:0006412
AF-C3J8L0-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9838 2 206 GO:0004045
GO:0005737
GO:0006412

Map