metagRoot

F444735

General Info

Members	Datasets	Scaffolds	Average Seq Length
441	271	364	286

Family's Representative Sequence

Representative Sequence	3300046615\|Ga0495656_0017327\|Ga0495656_0017327_382_1368
Length	328
Sequence	LLCFEVRDKMRHAPKKRPKGYDRVKIARLGPAGQEIPVIYATAANGEEMAYDASSITADIDGAFLAADGVARLRGALTASALPVLPGAAGLRIGTPLARPNNVICIGMNYAAHAAESGSAAPVTPVVFLKPNNTVAGPYDDAPIPPGSRKYDWEVELGIVIGKEASYLDTPAEAMTAVAGYLVANDLSERGYQLPGAAGQWTKGKSLPKSTPLGPWLVPADEVDAGNLRLRSWVNGEERQDSNTADLIFDVATVVHHVSQYMLLEPGDVILTGTPEGVALSGRFPYLQDGDVVDLEIEGLGRQRQTYVHTLVPRAPVRAGATPAPASK

Samples

	Sample ID	Description	Type	Environment
1	2585428094	Herbiconiux sp. YR403	Isolate	Rhizosphere
2	2643221549	Agromyces sp. Root1464	Isolate	Unclassified
3	2643221575	Microbacterium sp. Root61	Isolate	Unclassified
4	2643221613	Oerskovia sp. Root22	Isolate	Unclassified
5	2643221619	Agromyces sp. Root81	Isolate	Unclassified
6	2643221632	Leifsonia sp. Root112D2	Isolate	Unclassified
7	2643221649	Leifsonia sp. Root4	Isolate	Unclassified
8	2643221721	Oerskovia sp. Root918	Isolate	Unclassified
9	2643221961	Aeromicrobium sp. Root236	Isolate	Unclassified
10	2643221962	Aeromicrobium sp. Root344	Isolate	Unclassified
11	2675903059	Asanoa hainanensis CGMCC 4.5593	Isolate	Rhizosphere
12	2690315906	Arthrobacter sp. OY3WO11	Isolate	Unclassified
13	2739367654	Promicromonospora sp. YR516	Isolate	Unclassified
14	2758568522	Promicromonospora thailandica SAI-039	Isolate	Unclassified
15	2775506735	Arthrobacter sp. S95 1704	Isolate	Unclassified
16	2784132148	Streptomyces sp. E5N91 SAI-083	Isolate	Unclassified
17	2808606357	Arthrobacter sp. SLBN-122	Isolate	Unclassified
18	2808606360	Arthrobacter sp. SLBN-112	Isolate	Unclassified
19	2808606366	Arthrobacter sp. SLBN-83	Isolate	Unclassified
20	2808606370	Arthrobacter sp. SLBN-100	Isolate	Unclassified
21	2808606371	Arthrobacter sp. SLBN-53	Isolate	Unclassified
22	2808606447	Microbacterium sp. HAR-UPW-R2A-48	Isolate	Unclassified
23	2808606448	Streptomyces sp. 193411	Isolate	Unclassified
24	2811994871	Arthrobacter sp. SLBN-179	Isolate	Unclassified
25	2811994872	Microbacterium sp. MU4Y-5-1	Isolate	Unclassified
26	2833709550	Microbacterium sp. 3290	Isolate	Rhizosphere
27	2844849076	Arthrobacter cupressi DSM 24664	Isolate	Rhizosphere
28	2852632344	Microbacterium sp. AK009	Isolate	Rhizosphere
29	2852646457	Microbacterium sp. AK031	Isolate	Rhizosphere
30	2857710386	Brevibacterium sp. R-73093	Isolate	Unclassified
31	2857729791	Plantibacter sp. R-72288	Isolate	Unclassified
32	2857733635	Salinibacterium sp. R-73062	Isolate	Unclassified
33	2857740372	Paenarthrobacter sp. R-74611	Isolate	Unclassified
34	2862574272	Streptomyces sp. AcE210	Isolate	Nodule
35	2870622029	Conyzicola lurida DSM 105784	Isolate	Unclassified
36	2884763398	Leifsonia sp. PS1209	Isolate	Stem Tuber
37	2899370129	Amycolatopsis alkalitolerans SYSUP0005	Isolate	Stem Tuber
38	2904497146	Arthrobacter sp. 1276	Isolate	Rhizosphere
39	2904776348	Paenarthrobacter sp. 1092	Isolate	Rhizosphere
40	2906799679	Microbacterium karelineae TRM80801	Isolate	Unclassified
41	2910809715	Paenarthrobacter sp. CM16	Isolate	Unclassified
42	2919034639	Paenarthrobacter nitroguajacolicus 247	Isolate	Rhizosphere
43	2919051321	Sinomonas atrocyanea 1003	Isolate	Rhizosphere
44	2919059106	Arthrobacter sp. 1088	Isolate	Rhizosphere
45	2919538618	Paenarthrobacter nitroguajacolicus 3945	Isolate	Unclassified
46	2928121344	Plantibacter flavus 1756	Isolate	Rhizosphere
47	2932426870	Paenarthrobacter sp. 4246	Isolate	Rhizosphere
48	2932431166	Cellulosimicrobium sp. 4261	Isolate	Rhizosphere
49	2933418574	Jeotgalibacillus campisalis 4120	Isolate	Rhizosphere
50	2935890801	Oerskovia enterophila 3230	Isolate	Rhizosphere
51	2939598168	Arthrobacter sp. 754	Isolate	Rhizosphere
52	2939647034	Arthrobacter sp. 2762	Isolate	Rhizosphere
53	2939657138	Conyzicola nivalis 2857	Isolate	Rhizosphere
54	2939674588	Arthrobacter bambusae 3552	Isolate	Rhizosphere
55	2945916053	Arthrobacter ulcerisalmonis W1I2	Isolate	Rhizosphere
56	2945920336	Pseudarthrobacter siccitolerans W1I3	Isolate	Rhizosphere
57	2945941187	Arthrobacter pascens W1I14	Isolate	Rhizosphere
58	2946024296	Arthrobacter woluwensis W4I2	Isolate	Rhizosphere
59	2946037020	Arthrobacter sp. W4I7	Isolate	Rhizosphere
60	2946059875	Arthrobacter sp. SLBN-112	Isolate	Rhizosphere
61	2946080515	Microbacterium sp. W4I20	Isolate	Rhizosphere
62	2953998280	Pseudarthrobacter sp. W1I19	Isolate	Rhizosphere
63	2974302888	Pseudarthrobacter sp. SORGH_AS 212	Isolate	Unclassified
64	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
65	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
66	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
67	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
68	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
69	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
70	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
71	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
72	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
73	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
74	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
75	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
76	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
77	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
78	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
79	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
80	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
81	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
82	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
83	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
84	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
85	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
87	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
88	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
89	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
90	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
91	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
92	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
93	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
94	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
95	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
96	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
97	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
98	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
99	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
100	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
101	3300013250	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05	Metagenome	Rhizosphere
102	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
103	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
104	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
105	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
106	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
107	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
108	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
109	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
110	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
111	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
112	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
113	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
114	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
115	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
116	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
118	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
135	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
136	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
137	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
138	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
139	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
140	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
141	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
142	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
143	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
144	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
145	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
146	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
147	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
148	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
149	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
150	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
151	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
152	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
153	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
154	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
155	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
156	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
157	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
158	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
159	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
160	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
161	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
162	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
163	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
164	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
165	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
166	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
167	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
168	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
169	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
170	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
171	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
172	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
173	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
174	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
175	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
176	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
177	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
178	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
179	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
180	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
181	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
182	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
183	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
184	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
185	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
186	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
187	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
188	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
189	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
190	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
191	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
192	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
193	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
194	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
195	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
196	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
197	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
198	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
199	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
200	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
201	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
202	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
203	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
204	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
205	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
206	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
207	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
208	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
209	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
210	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
211	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
212	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
213	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
214	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
215	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
216	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
217	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
218	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
219	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
220	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
221	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
222	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
223	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
224	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
225	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
226	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
227	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
228	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
229	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
230	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
231	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
232	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
233	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
234	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
235	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
236	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
237	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
238	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
239	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
240	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
241	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
242	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
243	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
244	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
245	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
246	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
247	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
248	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
249	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
250	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
251	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
252	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
253	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
254	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
255	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
256	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
257	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
258	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
259	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
260	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
261	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
262	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
263	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
264	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
265	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
266	8003856774	Micromonospora echinofusca MPMI6	Isolate	Unclassified
267	8004025490	Arthrobacter wenxiniae AETb3-4	Isolate	Rhizosphere
268	8023623736	Streptomyces sp. 111WW2	Isolate	Unclassified
269	8048127548	Streptomyces samsunensis DSM 42010	Isolate	Rhizosphere
270	8054107350	Arthrobacter rhizosphaerae CCNWLXL 1-35	Isolate	Rhizosphere
271	8057345674	Herbiconiux aconitum CPCC 205763	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	82.31
Metatranscriptomes	0.23
Isolates	17.46

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	8.62
Nodule	0.23
Rhizoplane	8.39
Rhizosphere	66.44
Stem	0
Stem Tuber	0.45
Unclassified	15.87

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25152J39213_1000109	3300002773	Bacteria	57724
2	JGI25151J46595_10039938	3300003187	Bacteria	1726
3	JGI25165J46597_1000014	3300003214	Bacteria	390383
4	rootL2_10097992	3300003322	Bacteria	20641
5	Ga0070658_10122589	3300005327	Bacteria	2161
6	Ga0070660_100304418	3300005339	Bacteria	1307
7	Ga0070714_100331443	3300005435	Bacteria	1425
8	Ga0070713_100163671	3300005436	Bacteria	1988
9	Ga0068859_100402838	3300005617	Bacteria	1464
10	Ga0068864_100245070	3300005618	Bacteria	1662
11	Ga0068862_100192064	3300005844	Bacteria	1838
12	Ga0075365_10050100	3300006038	Bacteria	2754
13	Ga0075365_10113884	3300006038	Bacteria	1861
14	Ga0075368_10015360	3300006042	Bacteria	2840
15	Ga0075363_100000053	3300006048	Bacteria	22667
16	Ga0075363_100004881	3300006048	Bacteria	5925
17	Ga0075364_10025680	3300006051	Bacteria	3751
18	Ga0075364_10102505	3300006051	Bacteria	1905
19	Ga0075364_10338827	3300006051	Bacteria	1025
20	Ga0075432_10021652	3300006058	Bacteria	2197
21	Ga0075367_10022273	3300006178	Bacteria	3551
22	Ga0075369_10032410	3300006186	Bacteria	2211
23	Ga0075370_10022169	3300006353	Bacteria	3485
24	Ga0075428_100000147	3300006844	Bacteria	63737
25	Ga0075430_100400418	3300006846	Bacteria	1133
26	Ga0097620_100402792	3300006931	Bacteria	1464
27	Ga0105244_10006177	3300009036	Bacteria	7813
28	Ga0111539_10462026	3300009094	Bacteria	1478
29	Ga0105247_10022573	3300009101	Bacteria	3790
30	Ga0114129_10000058	3300009147	Bacteria	99035
31	Ga0114129_10000087	3300009147	Bacteria	86722
32	Ga0114129_10440633	3300009147	Bacteria	1710
33	Ga0105243_10119887	3300009148	Bacteria	2216
34	Ga0105248_10005729	3300009177	Bacteria	13638
35	Ga0105248_10091852	3300009177	Bacteria	3419
36	Ga0105237_10070173	3300009545	Bacteria	3499
37	Ga0105238_10108096	3300009551	Bacteria	2762
38	Ga0105249_10193518	3300009553	Bacteria	1986
39	Ga0105239_10022064	3300010375	Bacteria	7018
40	Ga0105246_10004952	3300011119	Bacteria	8106
41	Ga0157373_10001132	3300013100	Bacteria	20506
42	Ga0157371_10125559	3300013102	Bacteria	1825
43	Ga0157370_10013524	3300013104	Bacteria	8403
44	Ga0157370_10013956	3300013104	Bacteria	8250
45	Ga0157370_10123120	3300013104	Bacteria	2421
46	Ga0157369_10001527	3300013105	Bacteria	28378
47	Ga0157369_10021609	3300013105	Bacteria	7196
48	Ga0157369_10052032	3300013105	Bacteria	4431
49	Ga0157369_10166400	3300013105	Bacteria	2325
50	Ga0157369_10182671	3300013105	Bacteria	2206
51	Ga0157369_10323656	3300013105	Bacteria	1602
52	Ga0171462_1002	3300013250	Bacteria	1052134
53	Ga0157378_10424125	3300013297	Bacteria	1315
54	Ga0163162_10136413	3300013306	Bacteria	2564
55	Ga0157372_10111805	3300013307	Bacteria	3129
56	Ga0157372_10430036	3300013307	Bacteria	1539
57	Ga0157375_10270955	3300013308	Bacteria	1860
58	Ga0157375_10386386	3300013308	Bacteria	1566
59	Ga0163163_10018110	3300014325	Bacteria	6583
60	Ga0157380_10011659	3300014326	Bacteria	6355
61	Ga0157380_10689077	3300014326	Bacteria	1025
62	Ga0206353_10475656	3300020082	Bacteria	2091
63	Ga0207427_100039	3300025231	Bacteria	291576
64	Ga0209437_100441	3300025233	Bacteria	34752
65	Ga0209646_1000014	3300025246	Bacteria	550484
66	Ga0209677_102010	3300025253	Bacteria	8086
67	Ga0209759_1021729	3300025256	Bacteria	1452
68	Ga0209129_1000180	3300025258	Bacteria	90882
69	Ga0209233_1000014	3300025261	Bacteria	996641
70	Ga0209025_1001362	3300025294	Bacteria	32778
71	Ga0209051_1004857	3300025303	Bacteria	8079
72	Ga0209051_1031499	3300025303	Bacteria	2040
73	Ga0207697_10004439	3300025315	Bacteria	6702
74	Ga0207655_1017282	3300025728	Bacteria	3898
75	Ga0207655_1031289	3300025728	Bacteria	2455
76	Ga0207710_10025391	3300025900	Bacteria	2556
77	Ga0207680_10036561	3300025903	Bacteria	2829
78	Ga0207693_10063919	3300025915	Bacteria	2883
79	Ga0207694_10209764	3300025924	Bacteria	1586
80	Ga0207700_10151571	3300025928	Bacteria	1916
81	Ga0207664_10426152	3300025929	Bacteria	1182
82	Ga0207711_10007623	3300025941	Bacteria	9051
83	Ga0207711_10007872	3300025941	Bacteria	8914
84	Ga0207667_10000837	3300025949	Bacteria	39713
85	Ga0207712_10146330	3300025961	Bacteria	1819
86	Ga0207677_10583425	3300026023	Bacteria	979
87	Ga0207676_10041890	3300026095	Bacteria	3519
88	Ga0207674_10224057	3300026116	Bacteria	1829
89	Ga0207674_10772019	3300026116	Bacteria	928
90	Ga0207675_100120366	3300026118	Bacteria	2483
91	Ga0268265_10402969	3300028380	Bacteria	1265
92	Ga0265337_1001442	3300028556	Bacteria	11698
93	Ga0265319_1005065	3300028563	Bacteria	6403
94	Ga0265334_10000895	3300028573	Bacteria	14866
95	Ga0265334_10055183	3300028573	Bacteria	1513
96	Ga0265323_10001328	3300028653	Bacteria	12258
97	Ga0307515_10116182	3300028794	Bacteria	3074
98	Ga0265338_10001059	3300028800	Bacteria	45752
99	Ga0265330_10000046	3300031235	Bacteria	108853
100	Ga0265332_10000028	3300031238	Bacteria	184029
101	Ga0265332_10001786	3300031238	Bacteria	11577
102	Ga0265325_10001934	3300031241	Bacteria	14288
103	Ga0265325_10013900	3300031241	Bacteria	4568
104	Ga0265340_10006999	3300031247	Bacteria	6154
105	Ga0265340_10075906	3300031247	Bacteria	1588
106	Ga0265316_10006188	3300031344	Bacteria	11471
107	Ga0307408_100000455	3300031548	Bacteria	35737
108	Ga0307408_100003856	3300031548	Bacteria	10200
109	Ga0307408_100004591	3300031548	Bacteria	9341
110	Ga0307408_100006153	3300031548	Bacteria	7967
111	Ga0307408_100008788	3300031548	Bacteria	6669
112	Ga0307408_100009409	3300031548	Bacteria	6441
113	Ga0307408_100020986	3300031548	Bacteria	4416
114	Ga0307408_100042132	3300031548	Bacteria	3240
115	Ga0307508_10121320	3300031616	Bacteria	2216
116	Ga0307514_10007746	3300031649	Bacteria	9236
117	Ga0265314_10000054	3300031711	Bacteria	184029
118	Ga0265314_10012842	3300031711	Bacteria	6805
119	Ga0316578_10029877	3300031728	Bacteria	3096
120	Ga0307516_10042047	3300031730	Bacteria	4536
121	Ga0307405_10001228	3300031731	Bacteria	10657
122	Ga0307405_10003075	3300031731	Bacteria	7568
123	Ga0307405_10006708	3300031731	Bacteria	5688
124	Ga0307405_10013679	3300031731	Bacteria	4335
125	Ga0307405_10034609	3300031731	Bacteria	3007
126	Ga0307405_10136481	3300031731	Bacteria	1704
127	Ga0307405_10143732	3300031731	Bacteria	1667
128	Ga0307405_10306780	3300031731	Bacteria	1206
129	Ga0307413_10002843	3300031824	Bacteria	7144
130	Ga0307413_10004616	3300031824	Bacteria	6021
131	Ga0307413_10013954	3300031824	Bacteria	4063
132	Ga0307413_10054001	3300031824	Bacteria	2435
133	Ga0307413_10077892	3300031824	Bacteria	2113
134	Ga0307518_10006246	3300031838	Bacteria	8533
135	Ga0307410_10001642	3300031852	Bacteria	10282
136	Ga0307410_10017751	3300031852	Bacteria	4281
137	Ga0307410_10018863	3300031852	Bacteria	4179
138	Ga0307410_10153624	3300031852	Bacteria	1716
139	Ga0307410_10177891	3300031852	Bacteria	1608
140	Ga0307406_10000203	3300031901	Bacteria	35453
141	Ga0307406_10040454	3300031901	Bacteria	2899
142	Ga0307406_10103231	3300031901	Bacteria	1947
143	Ga0307406_10227646	3300031901	Bacteria	1390
144	Ga0307407_10001628	3300031903	Bacteria	8304
145	Ga0307407_10021887	3300031903	Bacteria	3306
146	Ga0307407_10045882	3300031903	Bacteria	2472
147	Ga0307407_10050883	3300031903	Bacteria	2372
148	Ga0307407_10070598	3300031903	Bacteria	2076
149	Ga0307412_10000382	3300031911	Bacteria	27676
150	Ga0307412_10004106	3300031911	Bacteria	8117
151	Ga0307412_10006101	3300031911	Bacteria	6789
152	Ga0307412_10010554	3300031911	Bacteria	5321
153	Ga0307412_10016782	3300031911	Bacteria	4370
154	Ga0307412_10026767	3300031911	Bacteria	3588
155	Ga0307412_10090927	3300031911	Bacteria	2135
156	Ga0307412_10094295	3300031911	Bacteria	2101
157	Ga0307412_10347204	3300031911	Bacteria	1190
158	Ga0307409_100007968	3300031995	Bacteria	6383
159	Ga0307409_100213046	3300031995	Bacteria	1738
160	Ga0307409_100326560	3300031995	Bacteria	1438
161	Ga0307409_100546827	3300031995	Bacteria	1136
162	Ga0307416_100002117	3300032002	Bacteria	11214
163	Ga0307416_100020608	3300032002	Bacteria	4709
164	Ga0307416_100093875	3300032002	Bacteria	2586
165	Ga0307416_100115860	3300032002	Bacteria	2374
166	Ga0307416_100222663	3300032002	Bacteria	1811
167	Ga0307416_100332037	3300032002	Bacteria	1528
168	Ga0307416_100437691	3300032002	Bacteria	1356
169	Ga0307416_100494118	3300032002	Bacteria	1286
170	Ga0307416_100810768	3300032002	Bacteria	1032
171	Ga0307416_100866642	3300032002	Bacteria	1002
172	Ga0307414_10002443	3300032004	Bacteria	9716
173	Ga0307414_10061831	3300032004	Bacteria	2654
174	Ga0307414_10232515	3300032004	Bacteria	1521
175	Ga0307414_10290686	3300032004	Bacteria	1378
176	Ga0307414_10363731	3300032004	Bacteria	1246
177	Ga0307411_10001306	3300032005	Bacteria	10016
178	Ga0307411_10301557	3300032005	Bacteria	1285
179	Ga0307415_100170552	3300032126	Bacteria	1696
180	Ga0307415_100273543	3300032126	Bacteria	1385
181	Ga0307415_100366040	3300032126	Bacteria	1219
182	Ga0307415_100428162	3300032126	Bacteria	1138
183	Ga0316574_0203545	3300035398	Bacteria	1271
184	Ga0316584_0041238	3300036712	Bacteria	3441
185	Ga0395899_0002401	3300037312	Bacteria	15210
186	Ga0395899_0012483	3300037312	Bacteria	6508
187	Ga0395899_0040705	3300037312	Bacteria	3475
188	Ga0395899_0102095	3300037312	Bacteria	2069
189	Ga0395900_0022957	3300037418	Bacteria	6384
190	Ga0395900_0031275	3300037418	Bacteria	5467
191	Ga0395900_0058354	3300037418	Bacteria	3973
192	Ga0395900_0803166	3300037418	Bacteria	869
193	Ga0395898_0000748	3300037466	Bacteria	56700
194	Ga0395898_0061922	3300037466	Bacteria	3635
195	Ga0395898_0148441	3300037466	Bacteria	2244
196	Ga0395898_0248501	3300037466	Bacteria	1696
197	Ga0395905_0421370	3300037471	Bacteria	1231
198	Ga0395901_0001256	3300038443	Bacteria	26947
199	Ga0395901_0077881	3300038443	Bacteria	3460
200	Ga0395901_0217728	3300038443	Bacteria	1996
201	Ga0395901_0512053	3300038443	Bacteria	1220
202	Ga0451789_0166412	3300041443	Bacteria	1583
203	Ga0451791_0424444	3300041451	Bacteria	5841
204	Ga0451793_0178665	3300041452	Bacteria	1673
205	Ga0451797_0060128	3300041453	Bacteria	3623
206	Ga0451843_0067289	3300041509	Bacteria	2992
207	Ga0451843_0781061	3300041509	Bacteria	1819
208	Ga0451853_1884088	3300041512	Bacteria	2391
209	Ga0451853_2700302	3300041512	Bacteria	3578
210	Ga0439442_026741	3300042002	Bacteria	1201
211	Ga0450920_005922	3300042122	Bacteria	2185
212	Ga0439434_0004818	3300042435	Bacteria	3948
213	Ga0466965_0003333	3300044683	Bacteria	7033
214	Ga0466966_0176164	3300044684	Bacteria	1299
215	Ga0466963_0014076	3300044694	Bacteria	4928
216	Ga0466963_0341908	3300044694	Bacteria	1054
217	Ga0466970_0107674	3300044765	Bacteria	1521
218	Ga0466957_0163318	3300044842	Bacteria	1447
219	Ga0466958_0181071	3300045836	Bacteria	1337
220	Ga0466967_0374293	3300045976	Bacteria	1382
221	Ga0495603_0043527	3300046455	Bacteria	2680
222	Ga0495638_0081636	3300046460	Bacteria	1962
223	Ga0495653_0008750	3300046463	Bacteria	8290
224	Ga0495653_0081769	3300046463	Bacteria	2386
225	Ga0495650_0000727	3300046471	Bacteria	41607
226	Ga0495650_0028062	3300046471	Bacteria	2591
227	Ga0495580_0141990	3300046472	Bacteria	1664
228	Ga0495664_0012825	3300046477	Bacteria	4747
229	Ga0495608_0142400	3300046511	Bacteria	1530
230	Ga0495620_0026469	3300046515	Bacteria	2728
231	Ga0495630_0246750	3300046517	Bacteria	1364
232	Ga0495654_0011476	3300046530	Bacteria	4793
233	Ga0495665_0005224	3300046531	Bacteria	6996
234	Ga0495586_0157112	3300046535	Bacteria	1281
235	Ga0495645_0005065	3300046543	Bacteria	9029
236	Ga0495645_0034408	3300046543	Bacteria	3697
237	Ga0495645_0270222	3300046543	Bacteria	1122
238	Ga0495656_0017327	3300046615	Bacteria	2748
239	Ga0495657_0099993	3300046675	Bacteria	1849
240	Ga0495613_0017296	3300046689	Bacteria	5373
241	Ga0495613_0090241	3300046689	Bacteria	2220
242	Ga0495670_0014161	3300046691	Bacteria	3925
243	Ga0495649_0108889	3300046694	Bacteria	1470
244	Ga0495600_0030266	3300046809	Bacteria	3506
245	Ga0495581_0006970	3300047315	Bacteria	6547
246	Ga0495676_0006832	3300047321	Bacteria	10489
247	Ga0495675_0025375	3300047444	Bacteria	3778
248	Ga0495686_0119738	3300047472	Bacteria	1571
249	Ga0495614_0017908	3300048089	Bacteria	3071
250	Ga0496100_0161737	3300048903	Bacteria	1605
251	Ga0496101_0012193	3300048904	Bacteria	5730
252	Ga0496102_0035584	3300048905	Bacteria	4483
253	Ga0496102_0172160	3300048905	Bacteria	2038
254	Ga0496102_0629236	3300048905	Bacteria	996
255	Ga0496103_0136665	3300048906	Bacteria	1566
256	Ga0496104_0153845	3300048907	Bacteria	2207
257	Ga0496105_0066831	3300048908	Bacteria	2968
258	Ga0496105_0155524	3300048908	Bacteria	1878
259	Ga0496105_0339166	3300048908	Bacteria	1202
260	Ga0496107_0018207	3300048910	Bacteria	4944
261	Ga0496107_0169573	3300048910	Bacteria	1619
262	Ga0496108_0015318	3300048911	Bacteria	6255
263	Ga0496109_0085403	3300048912	Bacteria	2913
264	Ga0496109_0300932	3300048912	Bacteria	1512
265	Ga0496110_0092799	3300048913	Bacteria	2702
266	Ga0496110_0207831	3300048913	Bacteria	1779
267	Ga0496110_0396428	3300048913	Bacteria	1258
268	Ga0496111_0104800	3300048914	Bacteria	2080
269	Ga0496112_0172226	3300048915	Bacteria	2130
270	Ga0496112_0226377	3300048915	Bacteria	1825
271	Ga0496112_0499717	3300048915	Bacteria	1152
272	Ga0496113_0079758	3300048916	Bacteria	2506
273	Ga0496113_0181503	3300048916	Bacteria	1668
274	Ga0496114_0054746	3300048917	Bacteria	3326
275	Ga0496114_0070452	3300048917	Bacteria	2937
276	Ga0496114_0083633	3300048917	Bacteria	2701
277	Ga0496114_0086502	3300048917	Bacteria	2657
278	Ga0496114_0114437	3300048917	Bacteria	2313
279	Ga0496114_0151405	3300048917	Bacteria	2012
280	Ga0496114_0195795	3300048917	Bacteria	1769
281	Ga0496115_0028872	3300048918	Bacteria	4350
282	Ga0496115_0262999	3300048918	Bacteria	1418
283	Ga0496117_0000819	3300048920	Bacteria	48200
284	Ga0496117_0010464	3300048920	Bacteria	8452
285	Ga0496117_0021446	3300048920	Bacteria	5225
286	Ga0496118_0018263	3300048921	Bacteria	6334
287	Ga0496118_0052017	3300048921	Bacteria	3129
288	Ga0496119_0000533	3300048922	Bacteria	51798
289	Ga0496119_0001350	3300048922	Bacteria	29989
290	Ga0496120_0043077	3300048923	Bacteria	2632
291	Ga0496121_0000015	3300048924	Bacteria	571958
292	Ga0496121_0018268	3300048924	Bacteria	7084
293	Ga0496122_0001410	3300048925	Bacteria	38928
294	Ga0496122_0042613	3300048925	Bacteria	3568
295	Ga0496123_0000363	3300048926	Bacteria	85560
296	Ga0496123_0050072	3300048926	Bacteria	2794
297	Ga0496126_0015806	3300048929	Bacteria	7580
298	Ga0496126_0068535	3300048929	Bacteria	3167
299	Ga0496126_0198083	3300048929	Bacteria	1697
300	Ga0496126_0492344	3300048929	Bacteria	981
301	Ga0501032_0006270	3300049569	Bacteria	8758
302	Ga0501032_0009624	3300049569	Bacteria	7003
303	Ga0501032_0010561	3300049569	Bacteria	6658
304	Ga0501032_0019718	3300049569	Bacteria	4711
305	Ga0501033_0051889	3300049570	Bacteria	3040
306	Ga0501034_0000038	3300049571	Bacteria	237795
307	Ga0501034_0035453	3300049571	Bacteria	5057
308	Ga0501034_0072448	3300049571	Bacteria	3454
309	Ga0501034_0122143	3300049571	Bacteria	2591
310	Ga0501036_0122546	3300049572	Bacteria	2196
311	Ga0501036_0208575	3300049572	Bacteria	1642
312	Ga0501037_0012084	3300049573	Bacteria	6359
313	Ga0501037_0012854	3300049573	Bacteria	6170
314	Ga0501037_0024294	3300049573	Bacteria	4482
315	Ga0501037_0029992	3300049573	Bacteria	4018
316	Ga0501037_0042656	3300049573	Bacteria	3334
317	Ga0501037_0131136	3300049573	Bacteria	1797
318	Ga0501038_0013023	3300049574	Bacteria	7585
319	Ga0501038_0018394	3300049574	Bacteria	6308
320	Ga0501039_0054796	3300049575	Bacteria	3087
321	Ga0501039_0093326	3300049575	Bacteria	2345
322	Ga0501039_0183536	3300049575	Bacteria	1645
323	Ga0501043_0009487	3300049579	Bacteria	7633
324	Ga0501043_0017339	3300049579	Bacteria	5648
325	Ga0501043_0044793	3300049579	Bacteria	3479
326	Ga0501043_0102538	3300049579	Bacteria	2249
327	Ga0501046_0049699	3300049580	Bacteria	3317
328	Ga0501047_0012031	3300049581	Bacteria	8189
329	Ga0501047_0296663	3300049581	Bacteria	1459
330	Ga0501048_0010494	3300049582	Bacteria	6914
331	Ga0501048_0086427	3300049582	Bacteria	2212
332	Ga0501070_0000058	3300049586	Bacteria	94954
333	Ga0501070_0027974	3300049586	Bacteria	4729
334	Ga0501070_0209100	3300049586	Bacteria	1602
335	Ga0501083_0007010	3300049744	Bacteria	8001
336	Ga0501035_0008960	3300049822	Bacteria	9310
337	Ga0501035_0009342	3300049822	Bacteria	9111
338	Ga0501035_0048160	3300049822	Bacteria	3823
339	Ga0501044_0021423	3300049823	Bacteria	6895
340	Ga0501044_0215903	3300049823	Bacteria	1870
341	Ga0501045_0158346	3300049824	Bacteria	1685
342	nmdc:mga03n38_3871_c1	3300050490	Bacteria	4871
343	nmdc:mga00v17_310027_c1	3300050491	Bacteria	1025
344	nmdc:mga0yw44_440591_c1	3300050492	Bacteria	883
345	nmdc:mga06z11_6609_c1	3300050494	Bacteria	4735
346	nmdc:mga07m45_59267_c1	3300050496	Bacteria	2166
347	nmdc:mga05p37_2511_c1	3300050507	Bacteria	21330
348	nmdc:mga05p37_47437_c1	3300050507	Bacteria	5283
349	nmdc:mga09592_373_c1	3300050508	Bacteria	18449
350	nmdc:mga0qj67_1_c1	3300050509	Bacteria	45422
351	nmdc:mga06r32_2665_c1	3300050510	Bacteria	15962
352	nmdc:mga06r32_350648_c1	3300050510	Bacteria	1460
353	nmdc:mga08y16_190792_c1	3300050511	Bacteria	2125
354	Ga0500635_0000006	3300053080	Bacteria	187108
355	Ga0500635_0000088	3300053080	Bacteria	58889
356	Ga0500556_0001237	3300053104	Bacteria	11849
357	Ga0500573_0014069	3300053140	Bacteria	4522
358	Ga0500573_0044001	3300053140	Bacteria	2575
359	Ga0500573_0106005	3300053140	Bacteria	1577
360	Ga0500616_0000113	3300053153	Bacteria	150722
361	Ga0500616_0014234	3300053153	Bacteria	4578
362	Ga0500620_000022	3300053155	Bacteria	31020
363	Ga0500636_0090584	3300053177	Bacteria	1752
364	Ga0500645_001254	3300053730	Bacteria	13370

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005618	Ga0068864_100245070	Ga0068864_1002450702	256
2	3300014325	Ga0163163_10018110	Ga0163163_100181106	256
3	3300026095	Ga0207676_10041890	Ga0207676_100418904	256
4	3300048908	Ga0496105_0155524	Ga0496105_0155524_569_1417	262
5	3300046675	Ga0495657_0099993	Ga0495657_0099993_1020_1814	263
6	3300048917	Ga0496114_0114437	Ga0496114_0114437_1414_2259	263
7	3300053080	Ga0500635_0000088	Ga0500635_0000088_17550_18398	263
8	iso_pu_bacteria	2833709550	2833712501	263
9	3300053080	Ga0500635_0000006	Ga0500635_0000006_98580_99434	265
10	iso_pu_bacteria	2808606366	2808876588	266
11	3300009147	Ga0114129_10000087	Ga0114129_1000008735	267
12	3300050507	nmdc:mga05p37_47437_c1	nmdc:mga05p37_47437_c1_3862_4704	267
13	3300009177	Ga0105248_10091852	Ga0105248_100918522	269
14	3300046471	Ga0495650_0000727	Ga0495650_0000727_32898_33722	269
15	3300048917	Ga0496114_0195795	Ga0496114_0195795_361_1179	269
16	3300050490	nmdc:mga03n38_3871_c1	nmdc:mga03n38_3871_c1_3210_4028	269
17	3300050492	nmdc:mga0yw44_440591_c1	nmdc:mga0yw44_440591_c1_47_865	269
18	3300037418	Ga0395900_0803166	Ga0395900_0803166_23_838	270
19	3300028573	Ga0265334_10055183	Ga0265334_100551831	271
20	3300031235	Ga0265330_10000046	Ga0265330_1000004699	271
21	3300031238	Ga0265332_10000028	Ga0265332_1000002814	271
22	3300031241	Ga0265325_10001934	Ga0265325_100019344	271
23	3300031247	Ga0265340_10075906	Ga0265340_100759062	271
24	3300031711	Ga0265314_10000054	Ga0265314_1000005414	271
25	3300037471	Ga0395905_0421370	Ga0395905_0421370_125_1018	271
26	3300041451	Ga0451791_0424444	Ga0451791_0424444_1528_2424	271
27	3300041453	Ga0451797_0060128	Ga0451797_0060128_2674_3570	271
28	3300046543	Ga0495645_0034408	Ga0495645_0034408_1422_2246	271
29	3300048917	Ga0496114_0083633	Ga0496114_0083633_277_1128	271
30	3300048917	Ga0496114_0086502	Ga0496114_0086502_1063_1887	271
31	3300028794	Ga0307515_10116182	Ga0307515_101161822	273
32	3300031730	Ga0307516_10042047	Ga0307516_100420473	273
33	3300041443	Ga0451789_0166412	Ga0451789_0166412_142_1038	273
34	3300041512	Ga0451853_1884088	Ga0451853_1884088_264_1160	273
35	iso_pu_bacteria	2899370129	2899376844	273
36	iso_pu_bacteria	2906799679	2906802434	273
37	3300031548	Ga0307408_100003856	Ga0307408_10000385610	274
38	3300031616	Ga0307508_10121320	Ga0307508_101213202	274
39	3300031731	Ga0307405_10034609	Ga0307405_100346093	274
40	3300031911	Ga0307412_10010554	Ga0307412_100105543	274
41	3300048908	Ga0496105_0339166	Ga0496105_0339166_282_1133	275
42	3300048911	Ga0496108_0015318	Ga0496108_0015318_4375_5226	275
43	3300048912	Ga0496109_0085403	Ga0496109_0085403_1115_1966	275
44	3300048913	Ga0496110_0396428	Ga0496110_0396428_321_1172	275
45	3300053155	Ga0500620_000022	Ga0500620_000022_26603_27532	275
46	iso_pu_bacteria	2862574272	2862583922	275
47	iso_pu_bacteria	2939598168	2939602071	275
48	iso_pu_bacteria	8057345674	8057347715	275
49	3300025941	Ga0207711_10007872	Ga0207711_100078724	276
50	3300031838	Ga0307518_10006246	Ga0307518_100062462	276
51	3300041509	Ga0451843_0781061	Ga0451843_0781061_152_1024	276
52	3300046511	Ga0495608_0142400	Ga0495608_0142400_220_1059	276
53	3300046543	Ga0495645_0270222	Ga0495645_0270222_174_1013	276
54	iso_pu_bacteria	2643221649	2644277198	276
55	iso_pu_bacteria	2775506735	2775655879	276
56	iso_pu_bacteria	2775506735	2775658742	276
57	iso_pu_bacteria	2808606357	2808830153	276
58	iso_pu_bacteria	2808606360	2808851340	276
59	iso_pu_bacteria	2808606366	2808876137	276
60	iso_pu_bacteria	2808606371	2808897646	276
61	iso_pu_bacteria	2857733635	2857733786	276
62	iso_pu_bacteria	2945916053	2945920163	276
63	iso_pu_bacteria	8048127548	8048128070	276
64	3300044694	Ga0466963_0014076	Ga0466963_0014076_2444_3280	277
65	3300049569	Ga0501032_0006270	Ga0501032_0006270_2681_3517	277
66	3300049570	Ga0501033_0051889	Ga0501033_0051889_225_1061	277
67	3300049571	Ga0501034_0035453	Ga0501034_0035453_2730_3566	277
68	3300049573	Ga0501037_0024294	Ga0501037_0024294_1909_2745	277
69	3300049573	Ga0501037_0042656	Ga0501037_0042656_2274_3110	277
70	3300049574	Ga0501038_0018394	Ga0501038_0018394_1259_2095	277
71	3300049575	Ga0501039_0183536	Ga0501039_0183536_137_973	277
72	3300049579	Ga0501043_0017339	Ga0501043_0017339_1598_2434	277
73	3300049581	Ga0501047_0012031	Ga0501047_0012031_7154_7990	277
74	3300049582	Ga0501048_0010494	Ga0501048_0010494_4158_4994	277
75	3300049582	Ga0501048_0086427	Ga0501048_0086427_182_1018	277
76	3300049822	Ga0501035_0009342	Ga0501035_0009342_8263_9099	277
77	3300049823	Ga0501044_0215903	Ga0501044_0215903_364_1200	277
78	iso_pu_bacteria	2643221549	2643769420	277
79	iso_pu_bacteria	2643221619	2644114034	277
80	iso_pu_bacteria	2643221632	2644182093	277
81	iso_pu_bacteria	2675903059	2676480727	277
82	iso_pu_bacteria	2784132148	2784586096	277
83	iso_pu_bacteria	2808606447	2809225503	277
84	iso_pu_bacteria	2808606448	2809236436	277
85	iso_pu_bacteria	2811994872	2812321929	277
86	3300005327	Ga0070658_10122589	Ga0070658_101225892	278
87	3300005617	Ga0068859_100402838	Ga0068859_1004028381	278
88	3300005844	Ga0068862_100192064	Ga0068862_1001920643	278
89	3300006931	Ga0097620_100402792	Ga0097620_1004027921	278
90	3300009545	Ga0105237_10070173	Ga0105237_100701732	278
91	3300009553	Ga0105249_10193518	Ga0105249_101935182	278
92	3300013105	Ga0157369_10182671	Ga0157369_101826712	278
93	3300020082	Ga0206353_10475656	Ga0206353_104756562	278
94	3300025253	Ga0209677_102010	Ga0209677_1020106	278
95	3300025961	Ga0207712_10146330	Ga0207712_101463302	278
96	3300028380	Ga0268265_10402969	Ga0268265_104029691	278
97	3300048903	Ga0496100_0161737	Ga0496100_0161737_33_872	278
98	3300048904	Ga0496101_0012193	Ga0496101_0012193_3301_4140	278
99	3300048908	Ga0496105_0066831	Ga0496105_0066831_1207_2046	278
100	3300048910	Ga0496107_0169573	Ga0496107_0169573_199_1038	278
101	3300048912	Ga0496109_0300932	Ga0496109_0300932_113_952	278
102	3300048913	Ga0496110_0207831	Ga0496110_0207831_259_1098	278
103	3300048915	Ga0496112_0172226	Ga0496112_0172226_55_894	278
104	3300048916	Ga0496113_0079758	Ga0496113_0079758_1436_2275	278
105	3300048917	Ga0496114_0151405	Ga0496114_0151405_338_1177	278
106	3300048918	Ga0496115_0262999	Ga0496115_0262999_40_879	278
107	3300053177	Ga0500636_0090584	Ga0500636_0090584_465_1307	278
108	iso_pu_bacteria	2739367654	2739609229	278
109	iso_pu_bacteria	2758568522	2760303328	278
110	3300026116	Ga0207674_10772019	Ga0207674_107720191	279
111	3300046463	Ga0495653_0081769	Ga0495653_0081769_494_1336	279
112	3300046477	Ga0495664_0012825	Ga0495664_0012825_2485_3327	279
113	3300046517	Ga0495630_0246750	Ga0495630_0246750_52_894	279
114	3300046531	Ga0495665_0005224	Ga0495665_0005224_2660_3502	279
115	3300046543	Ga0495645_0005065	Ga0495645_0005065_3417_4259	279
116	3300046691	Ga0495670_0014161	Ga0495670_0014161_2088_2930	279
117	3300046809	Ga0495600_0030266	Ga0495600_0030266_2338_3180	279
118	3300047315	Ga0495581_0006970	Ga0495581_0006970_4165_5007	279
119	3300047444	Ga0495675_0025375	Ga0495675_0025375_599_1441	279
120	3300053140	Ga0500573_0014069	Ga0500573_0014069_859_1701	279
121	3300053153	Ga0500616_0014234	Ga0500616_0014234_490_1365	279
122	iso_pu_bacteria	2643221575	2643887120	279
123	iso_pu_bacteria	2870622029	2870623157	279
124	iso_pu_bacteria	2932431166	2932434360	279
125	iso_pu_bacteria	2939657138	2939657566	279
126	iso_pu_bacteria	8003856774	8003858643	279
127	3300006844	Ga0075428_100000147	Ga0075428_10000014751	280
128	3300009147	Ga0114129_10000058	Ga0114129_1000005886	280
129	3300010375	Ga0105239_10022064	Ga0105239_100220642	280
130	3300014326	Ga0157380_10689077	Ga0157380_106890771	280
131	3300031548	Ga0307408_100000455	Ga0307408_10000045533	280
132	3300031731	Ga0307405_10003075	Ga0307405_100030756	280
133	3300031731	Ga0307405_10136481	Ga0307405_101364812	280
134	3300031824	Ga0307413_10013954	Ga0307413_100139545	280
135	3300031911	Ga0307412_10000382	Ga0307412_100003826	280
136	3300031911	Ga0307412_10347204	Ga0307412_103472042	280
137	3300031995	Ga0307409_100546827	Ga0307409_1005468272	280
138	3300032002	Ga0307416_100115860	Ga0307416_1001158602	280
139	3300037312	Ga0395899_0102095	Ga0395899_0102095_202_1047	280
140	3300037466	Ga0395898_0061922	Ga0395898_0061922_1278_2123	280
141	3300037466	Ga0395898_0148441	Ga0395898_0148441_420_1265	280
142	3300038443	Ga0395901_0077881	Ga0395901_0077881_1327_2172	280
143	3300041452	Ga0451793_0178665	Ga0451793_0178665_12_863	280
144	3300041512	Ga0451853_2700302	Ga0451853_2700302_506_1357	280
145	3300044765	Ga0466970_0107674	Ga0466970_0107674_279_1124	280
146	3300046463	Ga0495653_0008750	Ga0495653_0008750_5792_6643	280
147	3300048920	Ga0496117_0010464	Ga0496117_0010464_2696_3541	280
148	3300048922	Ga0496119_0000533	Ga0496119_0000533_49258_50103	280
149	3300048923	Ga0496120_0043077	Ga0496120_0043077_12_857	280
150	3300048924	Ga0496121_0000015	Ga0496121_0000015_489949_490794	280
151	3300048925	Ga0496122_0042613	Ga0496122_0042613_2459_3304	280
152	3300048926	Ga0496123_0050072	Ga0496123_0050072_367_1212	280
153	3300048929	Ga0496126_0492344	Ga0496126_0492344_109_954	280
154	3300049569	Ga0501032_0019718	Ga0501032_0019718_3300_4145	280
155	3300049571	Ga0501034_0072448	Ga0501034_0072448_1098_1943	280
156	3300049572	Ga0501036_0122546	Ga0501036_0122546_1099_1944	280
157	3300049573	Ga0501037_0012854	Ga0501037_0012854_313_1158	280
158	3300049579	Ga0501043_0009487	Ga0501043_0009487_5282_6127	280
159	3300049586	Ga0501070_0209100	Ga0501070_0209100_659_1504	280
160	3300049822	Ga0501035_0008960	Ga0501035_0008960_6376_7221	280
161	3300049823	Ga0501044_0021423	Ga0501044_0021423_2627_3472	280
162	3300050507	nmdc:mga05p37_2511_c1	nmdc:mga05p37_2511_c1_3745_4602	280
163	3300050508	nmdc:mga09592_373_c1	nmdc:mga09592_373_c1_13671_14528	280
164	3300050509	nmdc:mga0qj67_1_c1	nmdc:mga0qj67_1_c1_3922_4779	280
165	3300050510	nmdc:mga06r32_2665_c1	nmdc:mga06r32_2665_c1_10475_11332	280
166	3300053104	Ga0500556_0001237	Ga0500556_0001237_1589_2434	280
167	iso_pu_bacteria	2643221961	2645720918	280
168	iso_pu_bacteria	2643221962	2645723915	280
169	iso_pu_bacteria	2852646457	2852647880	280
170	iso_pu_bacteria	2946080515	2946083692	280
171	3300005435	Ga0070714_100331443	Ga0070714_1003314431	281
172	3300005436	Ga0070713_100163671	Ga0070713_1001636712	281
173	3300006846	Ga0075430_100400418	Ga0075430_1004004182	281
174	3300009147	Ga0114129_10440633	Ga0114129_104406331	281
175	3300013100	Ga0157373_10001132	Ga0157373_1000113215	281
176	3300025915	Ga0207693_10063919	Ga0207693_100639193	281
177	3300025928	Ga0207700_10151571	Ga0207700_101515712	281
178	3300025929	Ga0207664_10426152	Ga0207664_104261522	281
179	3300028556	Ga0265337_1001442	Ga0265337_10014428	281
180	3300028563	Ga0265319_1005065	Ga0265319_10050652	281
181	3300028573	Ga0265334_10000895	Ga0265334_1000089511	281
182	3300028653	Ga0265323_10001328	Ga0265323_100013282	281
183	3300028800	Ga0265338_10001059	Ga0265338_1000105923	281
184	3300031238	Ga0265332_10001786	Ga0265332_100017862	281
185	3300031241	Ga0265325_10013900	Ga0265325_100139002	281
186	3300031247	Ga0265340_10006999	Ga0265340_100069994	281
187	3300031344	Ga0265316_10006188	Ga0265316_100061889	281
188	3300031649	Ga0307514_10007746	Ga0307514_100077465	281
189	3300031711	Ga0265314_10012842	Ga0265314_100128424	281
190	3300031731	Ga0307405_10143732	Ga0307405_101437322	281
191	3300031995	Ga0307409_100213046	Ga0307409_1002130462	281
192	3300032002	Ga0307416_100810768	Ga0307416_1008107681	281
193	3300032004	Ga0307414_10363731	Ga0307414_103637311	281
194	3300032126	Ga0307415_100366040	Ga0307415_1003660402	281
195	3300032126	Ga0307415_100428162	Ga0307415_1004281622	281
196	3300044842	Ga0466957_0163318	Ga0466957_0163318_324_1187	281
197	3300046455	Ga0495603_0043527	Ga0495603_0043527_1476_2327	281
198	3300046460	Ga0495638_0081636	Ga0495638_0081636_349_1197	281
199	3300046689	Ga0495613_0017296	Ga0495613_0017296_1481_2332	281
200	3300046689	Ga0495613_0090241	Ga0495613_0090241_1044_1892	281
201	3300047321	Ga0495676_0006832	Ga0495676_0006832_8186_9037	281
202	3300048089	Ga0495614_0017908	Ga0495614_0017908_865_1716	281
203	3300048925	Ga0496122_0001410	Ga0496122_0001410_356_1204	281
204	3300048929	Ga0496126_0015806	Ga0496126_0015806_976_1824	281
205	3300048929	Ga0496126_0068535	Ga0496126_0068535_2069_2917	281
206	3300049571	Ga0501034_0122143	Ga0501034_0122143_1437_2288	281
207	3300049572	Ga0501036_0208575	Ga0501036_0208575_242_1093	281
208	3300049573	Ga0501037_0131136	Ga0501037_0131136_27_878	281
209	3300049574	Ga0501038_0013023	Ga0501038_0013023_3556_4407	281
210	3300049575	Ga0501039_0054796	Ga0501039_0054796_1702_2553	281
211	3300049580	Ga0501046_0049699	Ga0501046_0049699_1725_2576	281
212	3300049581	Ga0501047_0296663	Ga0501047_0296663_519_1370	281
213	3300049822	Ga0501035_0048160	Ga0501035_0048160_285_1136	281
214	3300049824	Ga0501045_0158346	Ga0501045_0158346_511_1362	281
215	3300050510	nmdc:mga06r32_350648_c1	nmdc:mga06r32_350648_c1_567_1418	281
216	3300053153	Ga0500616_0000113	Ga0500616_0000113_40355_41203	281
217	3300053730	Ga0500645_001254	Ga0500645_001254_5641_6489	281
218	iso_pu_bacteria	2857710386	2857712920	281
219	iso_pu_bacteria	2946024296	2946027295	281
220	3300005339	Ga0070660_100304418	Ga0070660_1003044182	282
221	3300013105	Ga0157369_10001527	Ga0157369_1000152712	282
222	3300013307	Ga0157372_10430036	Ga0157372_104300362	282
223	3300013308	Ga0157375_10270955	Ga0157375_102709551	282
224	3300031728	Ga0316578_10029877	Ga0316578_100298771	282
225	3300031901	Ga0307406_10103231	Ga0307406_101032312	282
226	3300035398	Ga0316574_0203545	Ga0316574_0203545_83_934	282
227	3300036712	Ga0316584_0041238	Ga0316584_0041238_286_1137	282
228	3300038443	Ga0395901_0512053	Ga0395901_0512053_33_884	282
229	3300045836	Ga0466958_0181071	Ga0466958_0181071_354_1214	282
230	iso_pu_bacteria	2690315906	2691512468	282
231	iso_pu_bacteria	2884763398	2884764065	282
232	3300006051	Ga0075364_10338827	Ga0075364_103388272	283
233	3300013308	Ga0157375_10386386	Ga0157375_103863861	283
234	3300048917	Ga0496114_0070452	Ga0496114_0070452_513_1373	283
235	3300048920	Ga0496117_0000819	Ga0496117_0000819_17291_18148	283
236	3300048920	Ga0496117_0021446	Ga0496117_0021446_3026_3883	283
237	3300048921	Ga0496118_0018263	Ga0496118_0018263_4773_5630	283
238	3300048926	Ga0496123_0000363	Ga0496123_0000363_75633_76619	283
239	3300048929	Ga0496126_0198083	Ga0496126_0198083_722_1576	283
240	3300049579	Ga0501043_0102538	Ga0501043_0102538_230_1084	283
241	3300049744	Ga0501083_0007010	Ga0501083_0007010_436_1290	283
242	3300050491	nmdc:mga00v17_310027_c1	nmdc:mga00v17_310027_c1_42_902	283
243	3300053140	Ga0500573_0044001	Ga0500573_0044001_768_1622	283
244	iso_pu_bacteria	2643221613	2644082686	283
245	iso_pu_bacteria	2643221721	2644665548	283
246	iso_pu_bacteria	2852632344	2852633811	283
247	iso_pu_bacteria	2935890801	2935893065	283
248	3300006038	Ga0075365_10050100	Ga0075365_100501003	284
249	3300006038	Ga0075365_10113884	Ga0075365_101138842	284
250	3300006042	Ga0075368_10015360	Ga0075368_100153603	284
251	3300006048	Ga0075363_100000053	Ga0075363_10000005316	284
252	3300006048	Ga0075363_100004881	Ga0075363_1000048812	284
253	3300006051	Ga0075364_10025680	Ga0075364_100256802	284
254	3300006051	Ga0075364_10102505	Ga0075364_101025051	284
255	3300006178	Ga0075367_10022273	Ga0075367_100222733	284
256	3300006186	Ga0075369_10032410	Ga0075369_100324102	284
257	3300006353	Ga0075370_10022169	Ga0075370_100221693	284
258	3300009148	Ga0105243_10119887	Ga0105243_101198872	284
259	3300009551	Ga0105238_10108096	Ga0105238_101080964	284
260	3300013104	Ga0157370_10123120	Ga0157370_101231203	284
261	3300013105	Ga0157369_10052032	Ga0157369_100520324	284
262	3300013105	Ga0157369_10166400	Ga0157369_101664003	284
263	3300013105	Ga0157369_10323656	Ga0157369_103236562	284
264	3300013250	Ga0171462_1002	Ga0171462_1002417	284
265	3300013306	Ga0163162_10136413	Ga0163162_101364133	284
266	3300013307	Ga0157372_10111805	Ga0157372_101118053	284
267	3300014326	Ga0157380_10011659	Ga0157380_100116595	284
268	3300025246	Ga0209646_1000014	Ga0209646_1000014420	284
269	3300025924	Ga0207694_10209764	Ga0207694_102097643	284
270	3300026023	Ga0207677_10583425	Ga0207677_105834251	284
271	3300026118	Ga0207675_100120366	Ga0207675_1001203662	284
272	3300031901	Ga0307406_10000203	Ga0307406_1000020328	284
273	3300031911	Ga0307412_10090927	Ga0307412_100909273	284
274	3300031995	Ga0307409_100326560	Ga0307409_1003265602	284
275	3300032004	Ga0307414_10290686	Ga0307414_102906862	284
276	3300032126	Ga0307415_100170552	Ga0307415_1001705521	284
277	3300041509	Ga0451843_0067289	Ga0451843_0067289_263_1126	284
278	3300046530	Ga0495654_0011476	Ga0495654_0011476_2115_2975	284
279	3300047472	Ga0495686_0119738	Ga0495686_0119738_684_1544	284
280	3300048905	Ga0496102_0035584	Ga0496102_0035584_2980_3843	284
281	3300048906	Ga0496103_0136665	Ga0496103_0136665_48_911	284
282	3300048907	Ga0496104_0153845	Ga0496104_0153845_266_1129	284
283	3300048910	Ga0496107_0018207	Ga0496107_0018207_386_1249	284
284	3300048913	Ga0496110_0092799	Ga0496110_0092799_662_1525	284
285	3300048914	Ga0496111_0104800	Ga0496111_0104800_435_1298	284
286	3300048915	Ga0496112_0226377	Ga0496112_0226377_520_1383	284
287	3300048915	Ga0496112_0499717	Ga0496112_0499717_219_1100	284
288	3300048916	Ga0496113_0181503	Ga0496113_0181503_558_1421	284
289	3300048917	Ga0496114_0054746	Ga0496114_0054746_1087_1950	284
290	3300048918	Ga0496115_0028872	Ga0496115_0028872_551_1414	284
291	3300048922	Ga0496119_0001350	Ga0496119_0001350_28141_29001	284
292	3300048924	Ga0496121_0018268	Ga0496121_0018268_4527_5387	284
293	3300049586	Ga0501070_0000058	Ga0501070_0000058_52813_53670	284
294	3300049586	Ga0501070_0027974	Ga0501070_0027974_2972_3832	284
295	3300050494	nmdc:mga06z11_6609_c1	nmdc:mga06z11_6609_c1_1058_1918	284
296	3300050496	nmdc:mga07m45_59267_c1	nmdc:mga07m45_59267_c1_324_1184	284
297	iso_pu_bacteria	2585428094	2587864723	284
298	iso_pu_bacteria	2974302888	2974304291	284
299	iso_pu_bacteria	8023623736	8023626714	284
300	3300003322	rootL2_10097992	rootL2_1009799221	285
301	3300009101	Ga0105247_10022573	Ga0105247_100225732	285
302	3300009177	Ga0105248_10005729	Ga0105248_100057292	285
303	3300025900	Ga0207710_10025391	Ga0207710_100253912	285
304	3300025903	Ga0207680_10036561	Ga0207680_100365613	285
305	3300025941	Ga0207711_10007623	Ga0207711_100076232	285
306	3300025949	Ga0207667_10000837	Ga0207667_1000083727	285
307	3300026116	Ga0207674_10224057	Ga0207674_102240572	285
308	3300031824	Ga0307413_10002843	Ga0307413_100028436	285
309	3300031903	Ga0307407_10045882	Ga0307407_100458821	285
310	3300032002	Ga0307416_100093875	Ga0307416_1000938753	285
311	3300042122	Ga0450920_005922	Ga0450920_005922_293_1156	285
312	3300044694	Ga0466963_0341908	Ga0466963_0341908_100_969	285
313	3300046471	Ga0495650_0028062	Ga0495650_0028062_598_1458	285
314	3300046515	Ga0495620_0026469	Ga0495620_0026469_100_960	285
315	3300046694	Ga0495649_0108889	Ga0495649_0108889_526_1386	285
316	3300003214	JGI25165J46597_1000014	JGI25165J46597_100001470	286
317	3300025231	Ga0207427_100039	Ga0207427_10003940	286
318	3300025233	Ga0209437_100441	Ga0209437_1004417	286
319	3300025261	Ga0209233_1000014	Ga0209233_1000014478	286
320	3300031911	Ga0307412_10006101	Ga0307412_100061015	286
321	3300032005	Ga0307411_10301557	Ga0307411_103015571	286
322	3300037312	Ga0395899_0040705	Ga0395899_0040705_1584_2459	286
323	3300037466	Ga0395898_0000748	Ga0395898_0000748_1593_2468	286
324	3300038443	Ga0395901_0001256	Ga0395901_0001256_24240_25115	286
325	3300044683	Ga0466965_0003333	Ga0466965_0003333_2688_3557	286
326	iso_pu_bacteria	2775506735	2775657762	286
327	iso_pu_bacteria	2808606357	2808829720	286
328	iso_pu_bacteria	2808606360	2808850900	286
329	iso_pu_bacteria	2808606371	2808898085	286
330	iso_pu_bacteria	2811994871	2812318577	286
331	iso_pu_bacteria	2928121344	2928121873	286
332	iso_pu_bacteria	2946059875	2946060133	286
333	3300031548	Ga0307408_100006153	Ga0307408_1000061535	287
334	3300053140	Ga0500573_0106005	Ga0500573_0106005_235_1140	287
335	iso_pu_bacteria	2945920336	2945923524	287
336	iso_pu_bacteria	2946037020	2946040752	287
337	3300031548	Ga0307408_100009409	Ga0307408_1000094097	288
338	3300031731	Ga0307405_10006708	Ga0307405_100067082	288
339	3300031824	Ga0307413_10077892	Ga0307413_100778921	288
340	3300031852	Ga0307410_10018863	Ga0307410_100188634	288
341	3300031911	Ga0307412_10004106	Ga0307412_100041064	288
342	3300032002	Ga0307416_100332037	Ga0307416_1003320372	288
343	3300032004	Ga0307414_10061831	Ga0307414_100618313	288
344	3300032126	Ga0307415_100273543	Ga0307415_1002735432	288
345	3300049569	Ga0501032_0010561	Ga0501032_0010561_291_1160	288
346	3300049573	Ga0501037_0012084	Ga0501037_0012084_957_1826	288
347	3300049575	Ga0501039_0093326	Ga0501039_0093326_68_937	288
348	iso_pu_bacteria	2919051321	2919054247	288
349	iso_pu_bacteria	2945941187	2945945463	288
350	iso_pu_bacteria	8054107350	8054108870	288
351	3300006058	Ga0075432_10021652	Ga0075432_100216522	289
352	3300009094	Ga0111539_10462026	Ga0111539_104620261	289
353	3300031548	Ga0307408_100020986	Ga0307408_1000209863	289
354	3300031852	Ga0307410_10177891	Ga0307410_101778912	289
355	3300031901	Ga0307406_10227646	Ga0307406_102276462	289
356	3300031903	Ga0307407_10070598	Ga0307407_100705983	289
357	3300032002	Ga0307416_100437691	Ga0307416_1004376912	289
358	3300032002	Ga0307416_100866642	Ga0307416_1008666421	289
359	3300032004	Ga0307414_10002443	Ga0307414_1000244310	289
360	3300050511	nmdc:mga08y16_190792_c1	nmdc:mga08y16_190792_c1_477_1358	289
361	iso_pu_bacteria	2857729791	2857733168	289
362	3300013105	Ga0157369_10021609	Ga0157369_100216095	290
363	3300031548	Ga0307408_100008788	Ga0307408_1000087885	290
364	3300031731	Ga0307405_10001228	Ga0307405_100012289	290
365	3300031731	Ga0307405_10306780	Ga0307405_103067802	290
366	3300031824	Ga0307413_10054001	Ga0307413_100540012	290
367	3300031852	Ga0307410_10001642	Ga0307410_100016428	290
368	3300031901	Ga0307406_10040454	Ga0307406_100404543	290
369	3300031903	Ga0307407_10001628	Ga0307407_100016285	290
370	3300031903	Ga0307407_10050883	Ga0307407_100508832	290
371	3300031911	Ga0307412_10016782	Ga0307412_100167822	290
372	3300031911	Ga0307412_10094295	Ga0307412_100942952	290
373	3300031995	Ga0307409_100007968	Ga0307409_1000079684	290
374	3300032002	Ga0307416_100020608	Ga0307416_1000206085	290
375	3300032002	Ga0307416_100222663	Ga0307416_1002226632	290
376	3300032004	Ga0307414_10232515	Ga0307414_102325152	290
377	3300037312	Ga0395899_0012483	Ga0395899_0012483_4905_5786	290
378	3300037418	Ga0395900_0058354	Ga0395900_0058354_2642_3523	290
379	3300037466	Ga0395898_0248501	Ga0395898_0248501_552_1433	290
380	3300048921	Ga0496118_0052017	Ga0496118_0052017_1988_2890	290
381	iso_pu_bacteria	8004025490	8004026559	290
382	iso_pu_bacteria	2808606370	2808893973	291
383	3300011119	Ga0105246_10004952	Ga0105246_100049526	292
384	3300037312	Ga0395899_0002401	Ga0395899_0002401_1803_2687	292
385	3300037418	Ga0395900_0022957	Ga0395900_0022957_5377_6261	292
386	3300042002	Ga0439442_026741	Ga0439442_026741_174_1103	292
387	3300044684	Ga0466966_0176164	Ga0466966_0176164_105_992	292
388	3300045976	Ga0466967_0374293	Ga0466967_0374293_223_1140	292
389	iso_pu_bacteria	2953998280	2954001993	292
390	3300031548	Ga0307408_100042132	Ga0307408_1000421323	293
391	3300031548	Ga0307408_100004591	Ga0307408_1000045918	294
392	3300031824	Ga0307413_10004616	Ga0307413_100046166	294
393	3300031852	Ga0307410_10017751	Ga0307410_100177514	294
394	3300031903	Ga0307407_10021887	Ga0307407_100218872	294
395	3300031911	Ga0307412_10026767	Ga0307412_100267672	294
396	3300032002	Ga0307416_100002117	Ga0307416_1000021178	294
397	3300032005	Ga0307411_10001306	Ga0307411_100013067	294
398	3300049571	Ga0501034_0000038	Ga0501034_0000038_228854_229801	294
399	3300049569	Ga0501032_0009624	Ga0501032_0009624_4263_5189	295
400	3300049579	Ga0501043_0044793	Ga0501043_0044793_1794_2720	295
401	iso_pu_bacteria	2904497146	2904499109	295
402	iso_pu_bacteria	2910809715	2910811429	295
403	iso_pu_bacteria	2919034639	2919039083	295
404	iso_pu_bacteria	2919059106	2919060910	295
405	iso_pu_bacteria	2939647034	2939651235	295
406	iso_pu_bacteria	2904497146	2904497212	296
407	iso_pu_bacteria	2904776348	2904780599	296
408	3300031731	Ga0307405_10013679	Ga0307405_100136795	297
409	3300031852	Ga0307410_10153624	Ga0307410_101536241	297
410	3300032002	Ga0307416_100494118	Ga0307416_1004941181	297
411	iso_pu_bacteria	2919538618	2919541326	297
412	3300013102	Ga0157371_10125559	Ga0157371_101255592	298
413	3300013104	Ga0157370_10013524	Ga0157370_100135243	298
414	3300013104	Ga0157370_10013956	Ga0157370_100139567	298
415	3300025315	Ga0207697_10004439	Ga0207697_100044393	299
416	3300025728	Ga0207655_1031289	Ga0207655_10312892	299
417	3300037418	Ga0395900_0031275	Ga0395900_0031275_728_1636	299
418	3300038443	Ga0395901_0217728	Ga0395901_0217728_718_1626	299
419	3300049573	Ga0501037_0029992	Ga0501037_0029992_2330_3238	299
420	iso_pu_bacteria	2857740372	2857744858	299
421	iso_pu_bacteria	2919034639	2919037843	299
422	iso_pu_bacteria	2933418574	2933422150	299
423	3300009036	Ga0105244_10006177	Ga0105244_100061776	300
424	3300025303	Ga0209051_1004857	Ga0209051_10048572	300
425	3300025728	Ga0207655_1017282	Ga0207655_10172822	300
426	3300042435	Ga0439434_0004818	Ga0439434_0004818_328_1236	300
427	3300046615	Ga0495656_0017327	Ga0495656_0017327_382_1368	300
428	3300013297	Ga0157378_10424125	Ga0157378_104241252	301
429	3300025256	Ga0209759_1021729	Ga0209759_10217292	301
430	3300046472	Ga0495580_0141990	Ga0495580_0141990_172_1083	301
431	3300048905	Ga0496102_0172160	Ga0496102_0172160_113_1024	301
432	iso_pu_bacteria	2939674588	2939678958	301
433	3300048905	Ga0496102_0629236	Ga0496102_0629236_20_985	302
434	3300046535	Ga0495586_0157112	Ga0495586_0157112_291_1211	303
435	iso_pu_bacteria	2844849076	2844850580	304
436	iso_pu_bacteria	2932426870	2932430162	305
437	3300002773	JGI25152J39213_1000109	JGI25152J39213_10001094	309
438	3300003187	JGI25151J46595_10039938	JGI25151J46595_100399382	309
439	3300025258	Ga0209129_1000180	Ga0209129_100018018	309
440	3300025294	Ga0209025_1001362	Ga0209025_100136228	309
441	3300025303	Ga0209051_1031499	Ga0209051_10314992	309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

102

308

0.96 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8gst-assembly2.cif.gz_D	crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (pyruvate bound-form)	0.9232	4	291
6fog-assembly4.cif.gz_D	x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution.	0.9185	80	289
1wzo-assembly1.cif.gz_A	crystal structure of the hpce from thermus thermophilus hb8	0.9077	4	289
6j5x-assembly1.cif.gz_B	crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate	0.9071	4	289
1nr9-assembly1.cif.gz_B	crystal structure of escherichia coli 1262 (apc5008), putative isomerase	0.9058	73	285

ID	Description	Score	Start	End	Superfamily
af_Q9VU50_128_337_3.90.850.10	Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain	0.9601	78	289	3.90.850.10
1wzoC02	Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain	0.9512	76	288	3.90.850.10
af_A0A0R4IWE1_56_289_3.90.850.10	Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain	0.9509	54	285	3.90.850.10
1wzoC02	Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain	0.9465	76	288	3.90.850.10
af_Q9VU50_128_337_3.90.850.10	Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain	0.9424	78	289	3.90.850.10

ID	Description	Score	Start	End	GO Terms
AF-A0A0B9A5S9-F1-model_v4	Fumarylacetoacetate (FAA) hydrolase	0.9876	185	289	GO:0016787 GO:0046872
AF-A0A2N6TZ12-F1-model_v4	Fumarylacetoacetase-like C-terminal domain-containing protein	0.9802	2	289	GO:0003824 GO:0044281
AF-A0A366IIW0-F1-model_v4	2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase in catechol pathway	0.974	4	289	GO:0003824 GO:0044281
AF-M2XC14-F1-model_v4	5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase	0.9727	70	288	GO:0018773 GO:0046872
AF-A0A0R2P9V5-F1-model_v4	Fumarylacetoacetase-like C-terminal domain-containing protein	0.9726	78	287	GO:0003824 GO:0044281

Feature Viewer

pLDDT	pTM	Quality
89.84	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F444735

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

102

308

0.96

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map