F444727

General Info

Members Datasets Scaffolds Average Seq Length
441 237 882 156

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0325196|Ga0495580_0325196_342_890
Length 182
Sequence MFTHVAAFAAATWQLGLYKRREEFQSMKHGSRRQFLAASGGLAIAAVIPTRAAAQPARVPLNNMPDVIRKLVGPAPIKPGKVKIGLPPLVENGNLVPLSVSVESPMTEVDHVKAIHVFTEKNPLPETVSFYLGPRAGRADIATRIRLADTQTVVAIAQLSDGSFWSDSTHVIVTLAACLEEL

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
115 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
134 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
135 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 2.27
Rhizosphere 97.28
Stem 0
Stem Tuber 0
Unclassified 5.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0325196 3300046472 Bacteria 1045
2 Ga0070690_100009883 3300005330 Bacteria 5536
3 Ga0070690_100156008 3300005330 Bacteria 1561
4 Ga0068869_100031839 3300005334 Bacteria 3713
5 Ga0068869_100891572 3300005334 Bacteria 769
6 Ga0070680_100002875 3300005336 Bacteria 12790
7 Ga0070680_100130316 3300005336 Bacteria 2104
8 Ga0070680_100168751 3300005336 Bacteria 1841
9 Ga0070689_100544720 3300005340 Bacteria 999
10 Ga0070691_10053323 3300005341 Bacteria 1934
11 Ga0070692_10237112 3300005345 Bacteria 1085
12 Ga0070673_102041567 3300005364 Bacteria 544
13 Ga0070703_10001055 3300005406 Bacteria 8604
14 Ga0070714_100102063 3300005435 Bacteria 2528
15 Ga0070713_100008443 3300005436 Bacteria 7303
16 Ga0070713_100162246 3300005436 Bacteria 1996
17 Ga0070713_100198806 3300005436 Bacteria 1809
18 Ga0070701_10039650 3300005438 Bacteria 2391
19 Ga0070711_100104403 3300005439 Bacteria 2067
20 Ga0070705_100000653 3300005440 Bacteria 19834
21 Ga0070705_100040380 3300005440 Bacteria 2653
22 Ga0070700_100014079 3300005441 Bacteria 4510
23 Ga0070694_100638026 3300005444 Bacteria 861
24 Ga0070694_100673667 3300005444 Unclassified 839
25 Ga0070708_100041200 3300005445 Bacteria 4049
26 Ga0070708_100739034 3300005445 Bacteria 925
27 Ga0070663_100213649 3300005455 Bacteria 1512
28 Ga0070681_10007592 3300005458 Bacteria 10603
29 Ga0070681_10019125 3300005458 Bacteria 6854
30 Ga0070681_10303413 3300005458 Bacteria 1506
31 Ga0070706_100078100 3300005467 Bacteria 3065
32 Ga0070706_100356016 3300005467 Bacteria 1364
33 Ga0070706_100523572 3300005467 Bacteria 1103
34 Ga0070706_101011037 3300005467 Bacteria 766
35 Ga0070707_100374947 3300005468 Bacteria 1382
36 Ga0070698_100232776 3300005471 Bacteria 1776
37 Ga0070699_100002983 3300005518 Bacteria 15031
38 Ga0070699_100717944 3300005518 Bacteria 913
39 Ga0070699_100724310 3300005518 Bacteria 909
40 Ga0070679_100173780 3300005530 Bacteria 2127
41 Ga0070684_100080859 3300005535 Bacteria 2875
42 Ga0070697_100028284 3300005536 Bacteria 4488
43 Ga0070697_100262066 3300005536 Bacteria 1480
44 Ga0070686_100034464 3300005544 Bacteria 3120
45 Ga0070695_100004575 3300005545 Bacteria 8114
46 Ga0070696_100000152 3300005546 Bacteria 38688
47 Ga0070696_100632443 3300005546 Bacteria 866
48 Ga0070693_100282799 3300005547 Bacteria 1112
49 Ga0070693_100409675 3300005547 Bacteria 942
50 Ga0070704_100000818 3300005549 Bacteria 15440
51 Ga0070704_100102412 3300005549 Bacteria 2160
52 Ga0070704_100213775 3300005549 Bacteria 1564
53 Ga0070704_100243144 3300005549 Unclassified 1474
54 Ga0068857_100201799 3300005577 Bacteria 1813
55 Ga0068854_100561669 3300005578 Bacteria 969
56 Ga0070702_100092365 3300005615 Bacteria 1838
57 Ga0068859_100001122 3300005617 Bacteria 27371
58 Ga0068859_100327016 3300005617 Bacteria 1627
59 Ga0068859_100509781 3300005617 Bacteria 1298
60 Ga0068864_100053610 3300005618 Bacteria 3480
61 Ga0068861_100206895 3300005719 Bacteria 1651
62 Ga0068863_100156998 3300005841 Bacteria 2178
63 Ga0068860_100011165 3300005843 Bacteria 8852
64 Ga0068862_100032899 3300005844 Bacteria 4379
65 Ga0081455_10682117 3300005937 Bacteria 657
66 Ga0070717_10142606 3300006028 Bacteria 2067
67 Ga0075364_10437811 3300006051 Bacteria 893
68 Ga0075432_10036218 3300006058 Bacteria 1715
69 Ga0070715_10002540 3300006163 Bacteria 5628
70 Ga0070716_100298938 3300006173 Bacteria 1119
71 Ga0070712_100445462 3300006175 Bacteria 1077
72 Ga0070712_100461378 3300006175 Bacteria 1059
73 Ga0075427_10002884 3300006194 Bacteria 2336
74 Ga0097621_100028703 3300006237 Bacteria 4387
75 Ga0068871_100003878 3300006358 Bacteria 10311
76 Ga0068871_100367069 3300006358 Unclassified 1276
77 Ga0075428_100001502 3300006844 Bacteria 24964
78 Ga0075428_100026538 3300006844 Bacteria 6412
79 Ga0075428_100030120 3300006844 Bacteria 6002
80 Ga0075428_100128177 3300006844 Bacteria 2761
81 Ga0075430_100001098 3300006846 Bacteria 21488
82 Ga0075430_100002189 3300006846 Bacteria 16184
83 Ga0075430_100004195 3300006846 Bacteria 12162
84 Ga0075430_100018522 3300006846 Bacteria 5925
85 Ga0075430_100085632 3300006846 Bacteria 2639
86 Ga0075430_100088623 3300006846 Bacteria 2589
87 Ga0075430_100810259 3300006846 Bacteria 772
88 Ga0075431_100001010 3300006847 Bacteria 25028
89 Ga0075431_100021216 3300006847 Bacteria 6638
90 Ga0075431_100113774 3300006847 Bacteria 2793
91 Ga0075431_100355586 3300006847 Unclassified 1472
92 Ga0075431_100475698 3300006847 Bacteria 1242
93 Ga0075431_100593655 3300006847 Unclassified 1092
94 Ga0075433_10002337 3300006852 Bacteria 14428
95 Ga0075433_11176824 3300006852 Bacteria 666
96 Ga0075434_100006763 3300006871 Bacteria 10537
97 Ga0075434_100007426 3300006871 Bacteria 10147
98 Ga0075434_100128033 3300006871 Bacteria 2556
99 Ga0075434_100128441 3300006871 Bacteria 2552
100 Ga0075434_100440195 3300006871 Bacteria 1324
101 Ga0075429_100000055 3300006880 Bacteria 55152
102 Ga0075429_100023647 3300006880 Bacteria 5332
103 Ga0075429_100028891 3300006880 Bacteria 4816
104 Ga0075436_100085515 3300006914 Bacteria 2190
105 Ga0097620_100001122 3300006931 Bacteria 27371
106 Ga0097620_100327014 3300006931 Bacteria 1627
107 Ga0097620_100509803 3300006931 Bacteria 1298
108 Ga0075435_100003581 3300007076 Bacteria 10553
109 Ga0075435_100046546 3300007076 Bacteria 3480
110 Ga0075435_100097452 3300007076 Bacteria 2434
111 Ga0075435_100179058 3300007076 Bacteria 1791
112 Ga0075435_100316795 3300007076 Bacteria 1335
113 Ga0099794_10044826 3300007265 Bacteria 2114
114 Ga0105250_10047133 3300009092 Bacteria 1728
115 Ga0111539_10006571 3300009094 Bacteria 14984
116 Ga0111539_11632313 3300009094 Bacteria 748
117 Ga0111539_11728343 3300009094 Unclassified 725
118 Ga0105245_10361908 3300009098 Bacteria 1440
119 Ga0114129_10012532 3300009147 Bacteria 12074
120 Ga0114129_10060555 3300009147 Bacteria 5293
121 Ga0114129_10062210 3300009147 Bacteria 5215
122 Ga0114129_10204534 3300009147 Bacteria 2672
123 Ga0114129_10205342 3300009147 Bacteria 2666
124 Ga0114129_10308584 3300009147 Bacteria 2107
125 Ga0114129_10423547 3300009147 Bacteria 1750
126 Ga0114129_11034471 3300009147 Bacteria 1032
127 Ga0114129_11377051 3300009147 Bacteria 871
128 Ga0105242_10053686 3300009176 Bacteria 3292
129 Ga0105242_10569961 3300009176 Bacteria 1089
130 Ga0105248_10832584 3300009177 Bacteria 1041
131 Ga0105249_10093170 3300009553 Bacteria 2821
132 Ga0105246_10223122 3300011119 Bacteria 1478
133 Ga0157378_10596421 3300013297 Bacteria 1115
134 Ga0157380_10746727 3300014326 Bacteria 989
135 Ga0207696_1153343 3300025711 Bacteria 614
136 Ga0207653_10003735 3300025885 Bacteria 4789
137 Ga0207685_10023747 3300025905 Bacteria 2092
138 Ga0207685_10162912 3300025905 Bacteria 1020
139 Ga0207684_10179732 3300025910 Bacteria 1824
140 Ga0207684_10267778 3300025910 Bacteria 1474
141 Ga0207684_10399399 3300025910 Bacteria 1182
142 Ga0207684_10443555 3300025910 Bacteria 1115
143 Ga0207707_10011165 3300025912 Bacteria 7813
144 Ga0207707_10231540 3300025912 Bacteria 1607
145 Ga0207693_10018020 3300025915 Bacteria 5628
146 Ga0207693_10029414 3300025915 Bacteria 4339
147 Ga0207660_10004731 3300025917 Bacteria 8861
148 Ga0207660_10067317 3300025917 Bacteria 2594
149 Ga0207660_10160542 3300025917 Bacteria 1734
150 Ga0207652_10026429 3300025921 Bacteria 4835
151 Ga0207652_10953457 3300025921 Bacteria 756
152 Ga0207646_10514979 3300025922 Bacteria 1077
153 Ga0207687_10389523 3300025927 Bacteria 1144
154 Ga0207700_10087954 3300025928 Bacteria 2444
155 Ga0207700_10090767 3300025928 Bacteria 2412
156 Ga0207700_10780480 3300025928 Bacteria 854
157 Ga0207664_10130841 3300025929 Bacteria 2112
158 Ga0207686_10165502 3300025934 Bacteria 1554
159 Ga0207665_10480148 3300025939 Bacteria 957
160 Ga0207665_10607206 3300025939 Bacteria 855
161 Ga0207689_10030608 3300025942 Bacteria 4485
162 Ga0207689_10625587 3300025942 Bacteria 906
163 Ga0207661_10727135 3300025944 Bacteria 913
164 Ga0207651_10492926 3300025960 Bacteria 1058
165 Ga0207712_10031860 3300025961 Bacteria 3554
166 Ga0207668_10114145 3300025972 Bacteria 2033
167 Ga0207678_10007329 3300026067 Bacteria 9767
168 Ga0207708_10002614 3300026075 Bacteria 13246
169 Ga0207702_11463461 3300026078 Unclassified 677
170 Ga0207641_10253562 3300026088 Bacteria 1644
171 Ga0207676_10007549 3300026095 Bacteria 7715
172 Ga0207674_10428576 3300026116 Bacteria 1278
173 Ga0207675_100244406 3300026118 Bacteria 1735
174 Ga0209996_1028548 3300027395 Bacteria 805
175 Ga0209983_1049701 3300027665 Bacteria 917
176 Ga0209966_1002671 3300027695 Bacteria 2984
177 Ga0207428_10000417 3300027907 Bacteria 52860
178 Ga0207428_10001576 3300027907 Bacteria 23751
179 Ga0268265_10000666 3300028380 Bacteria 34070
180 Ga0268264_10008316 3300028381 Bacteria 8626
181 Ga0265337_1002058 3300028556 Bacteria 9514
182 Ga0265327_10392749 3300031251 Unclassified 603
183 Ga0265314_10007585 3300031711 Bacteria 9394
184 Ga0307409_100713935 3300031995 Bacteria 1003
185 Ga0307416_102252398 3300032002 Bacteria 646
186 Ga0373934_0123191 3300035086 Bacteria 1055
187 Ga0373944_0048210 3300035089 Bacteria 1336
188 Ga0373923_0071741 3300035111 Bacteria 1488
189 Ga0373923_0543622 3300035111 Bacteria 569
190 Ga0373932_0364573 3300035112 Bacteria 552
191 Ga0373936_0032285 3300035113 Bacteria 2070
192 Ga0373939_0110226 3300035114 Bacteria 957
193 Ga0373941_0017198 3300035115 Bacteria 1977
194 Ga0373945_0013741 3300035116 Bacteria 2705
195 Ga0373954_0186734 3300035118 Bacteria 1017
196 Ga0373956_0114050 3300035119 Bacteria 1259
197 Ga0373957_0031769 3300035120 Bacteria 1941
198 Ga0373943_0063253 3300035170 Bacteria 1854
199 Ga0373943_0099609 3300035170 Bacteria 1518
200 Ga0373961_0167102 3300035241 Bacteria 759
201 Ga0373924_0093060 3300035410 Bacteria 1291
202 Ga0373924_0207134 3300035410 Bacteria 866
203 Ga0373931_0010421 3300035691 Bacteria 4467
204 Ga0373931_0134167 3300035691 Bacteria 1428
205 Ga0373935_0103680 3300035692 Bacteria 1879
206 Ga0373935_0163503 3300035692 Bacteria 1518
207 Ga0373927_0205035 3300035695 Bacteria 1295
208 Ga0373947_0057333 3300035725 Bacteria 2356
209 Ga0373937_0004754 3300036401 Bacteria 11552
210 Ga0373937_0176391 3300036401 Bacteria 2006
211 Ga0373925_0363499 3300037068 Bacteria 1177
212 Ga0395899_0486287 3300037312 Bacteria 803
213 Ga0395905_0536424 3300037471 Bacteria 1071
214 Ga0395901_0088394 3300038443 Bacteria 3241
215 Ga0242420_047476 3300038996 Bacteria 833
216 Ga0436363_0568777 3300039450 Bacteria 814
217 Ga0439454_031814 3300042011 Bacteria 830
218 Ga0439435_0001468 3300042436 Bacteria 4378
219 Ga0439435_0010378 3300042436 Bacteria 2210
220 Ga0439460_0002117 3300042461 Bacteria 4757
221 Ga0439460_0043262 3300042461 Bacteria 1330
222 Ga0466965_0060429 3300044683 Bacteria 1893
223 Ga0495627_052973 3300046453 Bacteria 1216
224 Ga0495592_0001475 3300046454 Bacteria 16364
225 Ga0495592_0290932 3300046454 Bacteria 1065
226 Ga0495603_0066817 3300046455 Bacteria 2117
227 Ga0495590_0068277 3300046457 Bacteria 1246
228 Ga0495638_0019694 3300046460 Bacteria 4462
229 Ga0495641_0075737 3300046461 Bacteria 1508
230 Ga0495641_0168800 3300046461 Bacteria 979
231 Ga0495651_0334685 3300046462 Bacteria 1005
232 Ga0495653_0012697 3300046463 Bacteria 6881
233 Ga0495580_0487301 3300046472 Bacteria 824
234 Ga0495582_0129869 3300046473 Bacteria 1423
235 Ga0495605_0099626 3300046474 Bacteria 1337
236 Ga0495639_0115938 3300046475 Bacteria 1274
237 Ga0495662_0005331 3300046476 Bacteria 6441
238 Ga0495584_0010454 3300046491 Bacteria 4768
239 Ga0495584_0052867 3300046491 Bacteria 2044
240 Ga0495584_0077866 3300046491 Bacteria 1668
241 Ga0495585_0006135 3300046492 Bacteria 7500
242 Ga0495585_0258719 3300046492 Unclassified 866
243 Ga0495594_0732302 3300046499 Bacteria 558
244 Ga0495607_0063490 3300046501 Bacteria 2089
245 Ga0495608_0014819 3300046511 Bacteria 5408
246 Ga0495618_0097543 3300046514 Bacteria 1880
247 Ga0495628_0246925 3300046516 Bacteria 1333
248 Ga0495628_0770860 3300046516 Unclassified 675
249 Ga0495628_0816363 3300046516 Bacteria 652
250 Ga0495630_0016927 3300046517 Bacteria 5334
251 Ga0495630_0094284 3300046517 Bacteria 2263
252 Ga0495637_0016126 3300046520 Bacteria 3495
253 Ga0495663_0052882 3300046525 Bacteria 1261
254 Ga0495666_0023766 3300046526 Bacteria 3031
255 Ga0495642_0102755 3300046528 Bacteria 1217
256 Ga0495652_0264328 3300046529 Bacteria 1268
257 Ga0495640_0005456 3300046533 Bacteria 10118
258 Ga0495640_0103959 3300046533 Bacteria 1862
259 Ga0495586_0002272 3300046535 Bacteria 10454
260 Ga0495587_0020738 3300046536 Bacteria 4054
261 Ga0495598_0002638 3300046537 Bacteria 3714
262 Ga0495609_0124751 3300046538 Bacteria 1106
263 Ga0495645_0196269 3300046543 Bacteria 1372
264 Ga0495667_0002694 3300046559 Bacteria 11880
265 Ga0495656_0065166 3300046615 Bacteria 1601
266 Ga0495656_0206122 3300046615 Bacteria 978
267 Ga0495634_0003551 3300046642 Bacteria 12479
268 Ga0495659_0026224 3300046664 Bacteria 2001
269 Ga0495588_0139086 3300046674 Bacteria 1282
270 Ga0495599_0002703 3300046678 Bacteria 10357
271 Ga0495658_0024614 3300046683 Bacteria 3208
272 Ga0495669_0016289 3300046684 Bacteria 3182
273 Ga0495613_0003446 3300046689 Bacteria 11822
274 Ga0495624_0047318 3300046690 Bacteria 2733
275 Ga0495600_0077653 3300046809 Bacteria 2168
276 Ga0495581_0222919 3300047315 Bacteria 1103
277 Ga0495604_0002697 3300047317 Bacteria 14233
278 Ga0495636_0038176 3300047318 Bacteria 1986
279 Ga0495674_0411182 3300047319 Bacteria 1091
280 Ga0495680_0004055 3300047322 Bacteria 14117
281 Ga0495675_0215029 3300047444 Bacteria 1165
282 Ga0495614_0230951 3300048089 Bacteria 843
283 Ga0496100_0020488 3300048903 Bacteria 3966
284 Ga0496102_0018081 3300048905 Bacteria 6187
285 Ga0496102_0094232 3300048905 Bacteria 2774
286 Ga0496103_0183723 3300048906 Bacteria 1344
287 Ga0496104_0128559 3300048907 Bacteria 2433
288 Ga0496106_0040432 3300048909 Bacteria 3492
289 Ga0496107_0158420 3300048910 Bacteria 1677
290 Ga0496110_0526772 3300048913 Bacteria 1075
291 Ga0496113_0515913 3300048916 Bacteria 959
292 Ga0496115_0034204 3300048918 Bacteria 4016
293 Ga0501031_0066920 3300049568 Bacteria 2341
294 Ga0501033_0066352 3300049570 Bacteria 2654
295 Ga0501033_0373408 3300049570 Bacteria 997
296 Ga0501037_0371635 3300049573 Bacteria 984
297 Ga0501038_0090474 3300049574 Bacteria 2565
298 Ga0501039_0040879 3300049575 Bacteria 3579
299 Ga0501039_0137551 3300049575 Bacteria 1918
300 Ga0501039_0704318 3300049575 Unclassified 790
301 Ga0501040_0055396 3300049576 Bacteria 2719
302 Ga0501040_0160956 3300049576 Bacteria 1587
303 Ga0501040_0365058 3300049576 Bacteria 1035
304 Ga0501041_0044711 3300049577 Bacteria 2691
305 Ga0501041_0072604 3300049577 Bacteria 2114
306 Ga0501041_0151010 3300049577 Bacteria 1450
307 Ga0501042_0029750 3300049578 Bacteria 3853
308 Ga0501042_0077252 3300049578 Bacteria 2384
309 Ga0501042_0369940 3300049578 Unclassified 1037
310 Ga0501042_0648043 3300049578 Bacteria 768
311 Ga0501043_0020626 3300049579 Bacteria 5171
312 Ga0501043_0368974 3300049579 Bacteria 1088
313 Ga0501046_0014296 3300049580 Bacteria 6703
314 Ga0501046_0036615 3300049580 Bacteria 3948
315 Ga0501046_0173454 3300049580 Bacteria 1617
316 Ga0501046_0211944 3300049580 Bacteria 1438
317 Ga0501048_0468753 3300049582 Unclassified 902
318 Ga0501048_0624461 3300049582 Bacteria 774
319 Ga0501067_0059070 3300049583 Bacteria 2123
320 Ga0501068_0072013 3300049584 Bacteria 2110
321 Ga0501068_0747608 3300049584 Unclassified 640
322 Ga0501069_0383594 3300049585 Bacteria 830
323 Ga0501071_0073797 3300049587 Bacteria 2489
324 Ga0501071_0539667 3300049587 Bacteria 895
325 Ga0501072_0032344 3300049588 Bacteria 4097
326 Ga0501072_0062249 3300049588 Bacteria 2944
327 Ga0501072_0108474 3300049588 Bacteria 2209
328 Ga0501072_0162643 3300049588 Bacteria 1781
329 Ga0501072_0166251 3300049588 Bacteria 1760
330 Ga0501072_0684011 3300049588 Unclassified 807
331 Ga0501073_0363331 3300049589 Bacteria 1000
332 Ga0501073_0485877 3300049589 Unclassified 854
333 Ga0501074_0208896 3300049590 Unclassified 1391
334 Ga0501075_0028674 3300049591 Bacteria 4110
335 Ga0501075_0035366 3300049591 Bacteria 3725
336 Ga0501075_0082723 3300049591 Bacteria 2431
337 Ga0501075_0264696 3300049591 Bacteria 1310
338 Ga0501075_1041765 3300049591 Unclassified 621
339 Ga0501076_0000778 3300049592 Bacteria 20562
340 Ga0501076_0007558 3300049592 Bacteria 7912
341 Ga0501076_0011445 3300049592 Bacteria 6609
342 Ga0501076_0312146 3300049592 Bacteria 1290
343 Ga0501076_0614358 3300049592 Bacteria 897
344 Ga0501077_0043434 3300049593 Bacteria 2857
345 Ga0501077_0113909 3300049593 Bacteria 1715
346 Ga0501079_0017301 3300049741 Bacteria 5505
347 Ga0501079_0064786 3300049741 Bacteria 2819
348 Ga0501079_0093102 3300049741 Bacteria 2335
349 Ga0501079_0098297 3300049741 Bacteria 2269
350 Ga0501079_0126452 3300049741 Bacteria 1989
351 Ga0501079_0763400 3300049741 Bacteria 761
352 Ga0501079_0964158 3300049741 Bacteria 672
353 Ga0501080_0018081 3300049742 Bacteria 6526
354 Ga0501080_0254013 3300049742 Bacteria 1603
355 Ga0501081_0000811 3300049743 Bacteria 18451
356 Ga0501081_0013648 3300049743 Bacteria 5341
357 Ga0501081_0038926 3300049743 Bacteria 3252
358 Ga0501081_0068147 3300049743 Bacteria 2477
359 Ga0501081_0217442 3300049743 Bacteria 1389
360 Ga0501083_0235092 3300049744 Bacteria 1193
361 Ga0501083_0286831 3300049744 Bacteria 1071
362 Ga0501083_0684256 3300049744 Bacteria 667
363 Ga0501035_0116958 3300049822 Bacteria 2333
364 Ga0501035_0423942 3300049822 Unclassified 1104
365 Ga0501045_0130617 3300049824 Bacteria 1867
366 Ga0501045_0206767 3300049824 Bacteria 1462
367 Ga0501045_0391626 3300049824 Bacteria 1034
368 Ga0501045_0579165 3300049824 Bacteria 832
369 nmdc:mga05p37_131474_c1 3300050507 Bacteria 3071
370 nmdc:mga05p37_1315449_c1 3300050507 Bacteria 735
371 nmdc:mga05p37_1350153_c1 3300050507 Bacteria 722
372 nmdc:mga05p37_194279_c1 3300050507 Bacteria 2462
373 nmdc:mga05p37_21053_c1 3300050507 Bacteria 7893
374 nmdc:mga05p37_46111_c1 3300050507 Bacteria 5360
375 nmdc:mga05p37_483265_c1 3300050507 Bacteria 1426
376 nmdc:mga05p37_54085_c1 3300050507 Bacteria 4939
377 nmdc:mga09592_1117365_c1 3300050508 Bacteria 654
378 nmdc:mga09592_1606_c1 3300050508 Bacteria 18226
379 nmdc:mga09592_30630_c1 3300050508 Bacteria 4477
380 nmdc:mga09592_50783_c1 3300050508 Bacteria 3498
381 nmdc:mga09592_5534_c1 3300050508 Bacteria 10283
382 nmdc:mga09592_708805_c1 3300050508 Unclassified 856
383 nmdc:mga0qj67_129_c1 3300050509 Bacteria 50064
384 nmdc:mga0qj67_16667_c1 3300050509 Bacteria 5577
385 nmdc:mga0qj67_2103_c1 3300050509 Bacteria 14183
386 nmdc:mga0qj67_719387_c1 3300050509 Bacteria 793
387 nmdc:mga0qj67_733_c1 3300050509 Bacteria 22325
388 nmdc:mga0qj67_744960_c1 3300050509 Unclassified 778
389 nmdc:mga0qj67_885_c1 3300050509 Bacteria 20530
390 nmdc:mga06r32_10855_c1 3300050510 Bacteria 8202
391 nmdc:mga06r32_170493_c1 3300050510 Bacteria 2160
392 nmdc:mga06r32_3148_c1 3300050510 Bacteria 14786
393 nmdc:mga06r32_485259_c1 3300050510 Bacteria 1214
394 nmdc:mga06r32_6151_c1 3300050510 Bacteria 10773
395 nmdc:mga06r32_7619_c1 3300050510 Bacteria 9735
396 nmdc:mga06r32_82372_c1 3300050510 Bacteria 3134
397 nmdc:mga08y16_1044431_c1 3300050511 Bacteria 795
398 nmdc:mga08y16_21939_c1 3300050511 Bacteria 6740
399 nmdc:mga08y16_4218_c1 3300050511 Bacteria 14993
400 nmdc:mga0n895_10158_c1 3300050512 Bacteria 8290
401 nmdc:mga0n895_170235_c1 3300050512 Bacteria 2210
402 nmdc:mga0n895_197989_c1 3300050512 Bacteria 2040
403 nmdc:mga0n895_54156_c1 3300050512 Bacteria 3945
404 nmdc:mga0n895_82948_c1 3300050512 Bacteria 3196
405 nmdc:mga0rr50_132045_c1 3300050513 Bacteria 2000
406 nmdc:mga0rr50_16531_c1 3300050513 Bacteria 4905
407 nmdc:mga0rr50_167668_c1 3300050513 Bacteria 1787
408 nmdc:mga0rr50_510240_c1 3300050513 Bacteria 1023
409 nmdc:mga0rr50_721176_c1 3300050513 Bacteria 851
410 nmdc:mga08x19_167032_c1 3300050514 Unclassified 1497
411 nmdc:mga08x19_60073_c1 3300050514 Bacteria 2462
412 nmdc:mga0a205_120788_c1 3300050515 Bacteria 2519
413 nmdc:mga0a205_235570_c1 3300050515 Bacteria 1712
414 nmdc:mga0a205_2906_c2 3300050515 Bacteria 6369
415 nmdc:mga0a205_486094_c1 3300050515 Bacteria 1092
416 Ga0495601_0440252 3300053077 Unclassified 843
417 Ga0495655_0019493 3300053083 Bacteria 1507
418 Ga0501084_0055279 3300054114 Bacteria 3321
419 Ga0501084_0084857 3300054114 Bacteria 2659
420 Ga0501084_0130679 3300054114 Bacteria 2114
421 Ga0501084_0231255 3300054114 Bacteria 1561
422 Ga0501084_0343376 3300054114 Bacteria 1261
423 Ga0590071_168929 3300059421 Bacteria 571
424 Ga0590077_008345 3300059426 Bacteria 2122
425 Ga0501082_0002254 3300060353 Bacteria 16885
426 Ga0501082_0047253 3300060353 Bacteria 3709
427 Ga0501082_0059202 3300060353 Bacteria 3301
428 Ga0501082_0066276 3300060353 Bacteria 3110
429 Ga0501082_0175875 3300060353 Bacteria 1861
430 Ga0501082_0261003 3300060353 Bacteria 1507
431 Ga0501082_0425329 3300060353 Bacteria 1160
432 Ga0501082_0820324 3300060353 Bacteria 814
433 Ga0501082_1086444 3300060353 Bacteria 699
434 Ga0501082_1605117 3300060353 Bacteria 568
435 Ga0530510_0012323 3300061734 Bacteria 6004
436 Ga0530510_0214925 3300061734 Bacteria 1428
437 Ga0530510_0273026 3300061734 Bacteria 1262
438 Ga0530510_0701788 3300061734 Bacteria 771
439 Ga0530510_0788482 3300061734 Unclassified 725
440 Ga0530510_0962976 3300061734 Bacteria 653
441 Ga0530510_1353345 3300061734 Bacteria 546
442 Ga0495580_0325196
443 Ga0070690_100009883
444 Ga0070690_100156008
445 Ga0068869_100031839
446 Ga0068869_100891572
447 Ga0070680_100002875
448 Ga0070680_100130316
449 Ga0070680_100168751
450 Ga0070689_100544720
451 Ga0070691_10053323
452 Ga0070692_10237112
453 Ga0070673_102041567
454 Ga0070703_10001055
455 Ga0070714_100102063
456 Ga0070713_100008443
457 Ga0070713_100162246
458 Ga0070713_100198806
459 Ga0070701_10039650
460 Ga0070711_100104403
461 Ga0070705_100000653
462 Ga0070705_100040380
463 Ga0070700_100014079
464 Ga0070694_100638026
465 Ga0070694_100673667
466 Ga0070708_100041200
467 Ga0070708_100739034
468 Ga0070663_100213649
469 Ga0070681_10007592
470 Ga0070681_10019125
471 Ga0070681_10303413
472 Ga0070706_100078100
473 Ga0070706_100356016
474 Ga0070706_100523572
475 Ga0070706_101011037
476 Ga0070707_100374947
477 Ga0070698_100232776
478 Ga0070699_100002983
479 Ga0070699_100717944
480 Ga0070699_100724310
481 Ga0070679_100173780
482 Ga0070684_100080859
483 Ga0070697_100028284
484 Ga0070697_100262066
485 Ga0070686_100034464
486 Ga0070695_100004575
487 Ga0070696_100000152
488 Ga0070696_100632443
489 Ga0070693_100282799
490 Ga0070693_100409675
491 Ga0070704_100000818
492 Ga0070704_100102412
493 Ga0070704_100213775
494 Ga0070704_100243144
495 Ga0068857_100201799
496 Ga0068854_100561669
497 Ga0070702_100092365
498 Ga0068859_100001122
499 Ga0068859_100327016
500 Ga0068859_100509781
501 Ga0068864_100053610
502 Ga0068861_100206895
503 Ga0068863_100156998
504 Ga0068860_100011165
505 Ga0068862_100032899
506 Ga0081455_10682117
507 Ga0070717_10142606
508 Ga0075364_10437811
509 Ga0075432_10036218
510 Ga0070715_10002540
511 Ga0070716_100298938
512 Ga0070712_100445462
513 Ga0070712_100461378
514 Ga0075427_10002884
515 Ga0097621_100028703
516 Ga0068871_100003878
517 Ga0068871_100367069
518 Ga0075428_100001502
519 Ga0075428_100026538
520 Ga0075428_100030120
521 Ga0075428_100128177
522 Ga0075430_100001098
523 Ga0075430_100002189
524 Ga0075430_100004195
525 Ga0075430_100018522
526 Ga0075430_100085632
527 Ga0075430_100088623
528 Ga0075430_100810259
529 Ga0075431_100001010
530 Ga0075431_100021216
531 Ga0075431_100113774
532 Ga0075431_100355586
533 Ga0075431_100475698
534 Ga0075431_100593655
535 Ga0075433_10002337
536 Ga0075433_11176824
537 Ga0075434_100006763
538 Ga0075434_100007426
539 Ga0075434_100128033
540 Ga0075434_100128441
541 Ga0075434_100440195
542 Ga0075429_100000055
543 Ga0075429_100023647
544 Ga0075429_100028891
545 Ga0075436_100085515
546 Ga0097620_100001122
547 Ga0097620_100327014
548 Ga0097620_100509803
549 Ga0075435_100003581
550 Ga0075435_100046546
551 Ga0075435_100097452
552 Ga0075435_100179058
553 Ga0075435_100316795
554 Ga0099794_10044826
555 Ga0105250_10047133
556 Ga0111539_10006571
557 Ga0111539_11632313
558 Ga0111539_11728343
559 Ga0105245_10361908
560 Ga0114129_10012532
561 Ga0114129_10060555
562 Ga0114129_10062210
563 Ga0114129_10204534
564 Ga0114129_10205342
565 Ga0114129_10308584
566 Ga0114129_10423547
567 Ga0114129_11034471
568 Ga0114129_11377051
569 Ga0105242_10053686
570 Ga0105242_10569961
571 Ga0105248_10832584
572 Ga0105249_10093170
573 Ga0105246_10223122
574 Ga0157378_10596421
575 Ga0157380_10746727
576 Ga0207696_1153343
577 Ga0207653_10003735
578 Ga0207685_10023747
579 Ga0207685_10162912
580 Ga0207684_10179732
581 Ga0207684_10267778
582 Ga0207684_10399399
583 Ga0207684_10443555
584 Ga0207707_10011165
585 Ga0207707_10231540
586 Ga0207693_10018020
587 Ga0207693_10029414
588 Ga0207660_10004731
589 Ga0207660_10067317
590 Ga0207660_10160542
591 Ga0207652_10026429
592 Ga0207652_10953457
593 Ga0207646_10514979
594 Ga0207687_10389523
595 Ga0207700_10087954
596 Ga0207700_10090767
597 Ga0207700_10780480
598 Ga0207664_10130841
599 Ga0207686_10165502
600 Ga0207665_10480148
601 Ga0207665_10607206
602 Ga0207689_10030608
603 Ga0207689_10625587
604 Ga0207661_10727135
605 Ga0207651_10492926
606 Ga0207712_10031860
607 Ga0207668_10114145
608 Ga0207678_10007329
609 Ga0207708_10002614
610 Ga0207702_11463461
611 Ga0207641_10253562
612 Ga0207676_10007549
613 Ga0207674_10428576
614 Ga0207675_100244406
615 Ga0209996_1028548
616 Ga0209983_1049701
617 Ga0209966_1002671
618 Ga0207428_10000417
619 Ga0207428_10001576
620 Ga0268265_10000666
621 Ga0268264_10008316
622 Ga0265337_1002058
623 Ga0265327_10392749
624 Ga0265314_10007585
625 Ga0307409_100713935
626 Ga0307416_102252398
627 Ga0373934_0123191
628 Ga0373944_0048210
629 Ga0373923_0071741
630 Ga0373923_0543622
631 Ga0373932_0364573
632 Ga0373936_0032285
633 Ga0373939_0110226
634 Ga0373941_0017198
635 Ga0373945_0013741
636 Ga0373954_0186734
637 Ga0373956_0114050
638 Ga0373957_0031769
639 Ga0373943_0063253
640 Ga0373943_0099609
641 Ga0373961_0167102
642 Ga0373924_0093060
643 Ga0373924_0207134
644 Ga0373931_0010421
645 Ga0373931_0134167
646 Ga0373935_0103680
647 Ga0373935_0163503
648 Ga0373927_0205035
649 Ga0373947_0057333
650 Ga0373937_0004754
651 Ga0373937_0176391
652 Ga0373925_0363499
653 Ga0395899_0486287
654 Ga0395905_0536424
655 Ga0395901_0088394
656 Ga0242420_047476
657 Ga0436363_0568777
658 Ga0439454_031814
659 Ga0439435_0001468
660 Ga0439435_0010378
661 Ga0439460_0002117
662 Ga0439460_0043262
663 Ga0466965_0060429
664 Ga0495627_052973
665 Ga0495592_0001475
666 Ga0495592_0290932
667 Ga0495603_0066817
668 Ga0495590_0068277
669 Ga0495638_0019694
670 Ga0495641_0075737
671 Ga0495641_0168800
672 Ga0495651_0334685
673 Ga0495653_0012697
674 Ga0495580_0487301
675 Ga0495582_0129869
676 Ga0495605_0099626
677 Ga0495639_0115938
678 Ga0495662_0005331
679 Ga0495584_0010454
680 Ga0495584_0052867
681 Ga0495584_0077866
682 Ga0495585_0006135
683 Ga0495585_0258719
684 Ga0495594_0732302
685 Ga0495607_0063490
686 Ga0495608_0014819
687 Ga0495618_0097543
688 Ga0495628_0246925
689 Ga0495628_0770860
690 Ga0495628_0816363
691 Ga0495630_0016927
692 Ga0495630_0094284
693 Ga0495637_0016126
694 Ga0495663_0052882
695 Ga0495666_0023766
696 Ga0495642_0102755
697 Ga0495652_0264328
698 Ga0495640_0005456
699 Ga0495640_0103959
700 Ga0495586_0002272
701 Ga0495587_0020738
702 Ga0495598_0002638
703 Ga0495609_0124751
704 Ga0495645_0196269
705 Ga0495667_0002694
706 Ga0495656_0065166
707 Ga0495656_0206122
708 Ga0495634_0003551
709 Ga0495659_0026224
710 Ga0495588_0139086
711 Ga0495599_0002703
712 Ga0495658_0024614
713 Ga0495669_0016289
714 Ga0495613_0003446
715 Ga0495624_0047318
716 Ga0495600_0077653
717 Ga0495581_0222919
718 Ga0495604_0002697
719 Ga0495636_0038176
720 Ga0495674_0411182
721 Ga0495680_0004055
722 Ga0495675_0215029
723 Ga0495614_0230951
724 Ga0496100_0020488
725 Ga0496102_0018081
726 Ga0496102_0094232
727 Ga0496103_0183723
728 Ga0496104_0128559
729 Ga0496106_0040432
730 Ga0496107_0158420
731 Ga0496110_0526772
732 Ga0496113_0515913
733 Ga0496115_0034204
734 Ga0501031_0066920
735 Ga0501033_0066352
736 Ga0501033_0373408
737 Ga0501037_0371635
738 Ga0501038_0090474
739 Ga0501039_0040879
740 Ga0501039_0137551
741 Ga0501039_0704318
742 Ga0501040_0055396
743 Ga0501040_0160956
744 Ga0501040_0365058
745 Ga0501041_0044711
746 Ga0501041_0072604
747 Ga0501041_0151010
748 Ga0501042_0029750
749 Ga0501042_0077252
750 Ga0501042_0369940
751 Ga0501042_0648043
752 Ga0501043_0020626
753 Ga0501043_0368974
754 Ga0501046_0014296
755 Ga0501046_0036615
756 Ga0501046_0173454
757 Ga0501046_0211944
758 Ga0501048_0468753
759 Ga0501048_0624461
760 Ga0501067_0059070
761 Ga0501068_0072013
762 Ga0501068_0747608
763 Ga0501069_0383594
764 Ga0501071_0073797
765 Ga0501071_0539667
766 Ga0501072_0032344
767 Ga0501072_0062249
768 Ga0501072_0108474
769 Ga0501072_0162643
770 Ga0501072_0166251
771 Ga0501072_0684011
772 Ga0501073_0363331
773 Ga0501073_0485877
774 Ga0501074_0208896
775 Ga0501075_0028674
776 Ga0501075_0035366
777 Ga0501075_0082723
778 Ga0501075_0264696
779 Ga0501075_1041765
780 Ga0501076_0000778
781 Ga0501076_0007558
782 Ga0501076_0011445
783 Ga0501076_0312146
784 Ga0501076_0614358
785 Ga0501077_0043434
786 Ga0501077_0113909
787 Ga0501079_0017301
788 Ga0501079_0064786
789 Ga0501079_0093102
790 Ga0501079_0098297
791 Ga0501079_0126452
792 Ga0501079_0763400
793 Ga0501079_0964158
794 Ga0501080_0018081
795 Ga0501080_0254013
796 Ga0501081_0000811
797 Ga0501081_0013648
798 Ga0501081_0038926
799 Ga0501081_0068147
800 Ga0501081_0217442
801 Ga0501083_0235092
802 Ga0501083_0286831
803 Ga0501083_0684256
804 Ga0501035_0116958
805 Ga0501035_0423942
806 Ga0501045_0130617
807 Ga0501045_0206767
808 Ga0501045_0391626
809 Ga0501045_0579165
810 nmdc:mga05p37_131474_c1
811 nmdc:mga05p37_1315449_c1
812 nmdc:mga05p37_1350153_c1
813 nmdc:mga05p37_194279_c1
814 nmdc:mga05p37_21053_c1
815 nmdc:mga05p37_46111_c1
816 nmdc:mga05p37_483265_c1
817 nmdc:mga05p37_54085_c1
818 nmdc:mga09592_1117365_c1
819 nmdc:mga09592_1606_c1
820 nmdc:mga09592_30630_c1
821 nmdc:mga09592_50783_c1
822 nmdc:mga09592_5534_c1
823 nmdc:mga09592_708805_c1
824 nmdc:mga0qj67_129_c1
825 nmdc:mga0qj67_16667_c1
826 nmdc:mga0qj67_2103_c1
827 nmdc:mga0qj67_719387_c1
828 nmdc:mga0qj67_733_c1
829 nmdc:mga0qj67_744960_c1
830 nmdc:mga0qj67_885_c1
831 nmdc:mga06r32_10855_c1
832 nmdc:mga06r32_170493_c1
833 nmdc:mga06r32_3148_c1
834 nmdc:mga06r32_485259_c1
835 nmdc:mga06r32_6151_c1
836 nmdc:mga06r32_7619_c1
837 nmdc:mga06r32_82372_c1
838 nmdc:mga08y16_1044431_c1
839 nmdc:mga08y16_21939_c1
840 nmdc:mga08y16_4218_c1
841 nmdc:mga0n895_10158_c1
842 nmdc:mga0n895_170235_c1
843 nmdc:mga0n895_197989_c1
844 nmdc:mga0n895_54156_c1
845 nmdc:mga0n895_82948_c1
846 nmdc:mga0rr50_132045_c1
847 nmdc:mga0rr50_16531_c1
848 nmdc:mga0rr50_167668_c1
849 nmdc:mga0rr50_510240_c1
850 nmdc:mga0rr50_721176_c1
851 nmdc:mga08x19_167032_c1
852 nmdc:mga08x19_60073_c1
853 nmdc:mga0a205_120788_c1
854 nmdc:mga0a205_235570_c1
855 nmdc:mga0a205_2906_c2
856 nmdc:mga0a205_486094_c1
857 Ga0495601_0440252
858 Ga0495655_0019493
859 Ga0501084_0055279
860 Ga0501084_0084857
861 Ga0501084_0130679
862 Ga0501084_0231255
863 Ga0501084_0343376
864 Ga0590071_168929
865 Ga0590077_008345
866 Ga0501082_0002254
867 Ga0501082_0047253
868 Ga0501082_0059202
869 Ga0501082_0066276
870 Ga0501082_0175875
871 Ga0501082_0261003
872 Ga0501082_0425329
873 Ga0501082_0820324
874 Ga0501082_1086444
875 Ga0501082_1605117
876 Ga0530510_0012323
877 Ga0530510_0214925
878 Ga0530510_0273026
879 Ga0530510_0701788
880 Ga0530510_0788482
881 Ga0530510_0962976
882 Ga0530510_1353345

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13501

SoxY

Sulfur oxidation protein SoxY

68

178

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oxh-assembly3.cif.gz_D the soxyz complex of paracoccus pantotrophus 0.9043 33 145
4bk8-assembly1.cif.gz_A superoxide reductase (neelaredoxin) from ignicoccus hospitalis 0.894 47 144
2nnc-assembly1.cif.gz_A structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum 0.8832 34 145
2oxh-assembly1.cif.gz_Z the soxyz complex of paracoccus pantotrophus 0.8825 51 143
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.88 51 144
ID Description Score Start End Superfamily
2ox5B00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.9088 33 145 2.60.40.2470
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8832 34 145 2.60.40.2470
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8771 51 144 2.60.40.10
2ox5B00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8693 33 145 2.60.40.2470
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8609 51 142 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A258ZFI4-F1-model_v4 Thiosulfate oxidation carrier protein SoxY 0.9711 40 145
AF-A0A364NYZ9-F1-model_v4 Thiosulfate oxidation carrier protein SoxY 0.9709 35 145
AF-A0A258JGA4-F1-model_v4 Thiosulfate oxidation carrier protein SoxY 0.9701 31 145
AF-A0A526YJA9-F1-model_v4 Sulfur oxidation protein SoxY 0.9668 39 129
AF-A0A2V6WSE4-F1-model_v4 Ig-like SoxY domain-containing protein 0.9557 67 148

Map